ELFa( 4C4 ( ;;((Ccc`ۣeȧCȧcȧc$$_DO! "&@00Q_: 0/C\@/ XX@0 6QQO @@( @0 P`D! B00 R ᗏР -L @:c(Pj=jcmain() returned , p-, LP 0S P) p4 ` ,  0P,00,0p 0 $0D PT0T0S , , p -0P@Lp8`  R  0@ 0 dR -0P@Lp8`  R  0 @ 0 dR/ -L_Œ @x`0 P  'H0!@ 0',0 0` 0 0' M-LM0'XX @X0 , %X 0  ( "('$' ,  pPP( 0"(X )%( 0 0 , 0'(h@(K 0-_02@P L0@ 0'0@-0@  0S  4000$ 4 @4@ -4L0S@440S - L0 -LM40S  3 lH0 ,P6 K 0 Kh6꜅99 p-LM@`P3PUOp3e H0 Ph600 h0 \8^63 @W689S63  : M6J6갅9ԅ9-:999 Q-L@ ;60 66 99 -PLA4p`V$ 4! ,0 v0 666,0 000,  ,  0hTPU@0D PT,0 0,009@:89@9L9\9l9 0-0L @P ,00,0 R 0$ 0 00  0 0,00,0 R$ 0 0 00  0   0;00h0h^0 p-8P@L@`4 00 00S > S 0 p R  B  h3 000 P3Xp 0 00 39 99 0-L@LPT 㫾0( ᣾0( 0h蚾' p-L@`: 㑾PUP00S`XP ?ip  000PS p 0U 0 0 d0P@p0UPp -0LSP 0S" 00 @ = p`Z8:Xo`Z6 @ 3S `V !0@ 0TTPPQ @Po@ 00000@TP303k9P060 0 308#83 R 00  [ @㘷00Ըh ; p-L@V 㭽P`dU  0㠽00PY YR`pp 0-LP@P 0)d〽H@ @0aP' 0H@ 0T 0' -LM0` Pp @2Z0S3  07P.0  0*0,0K0,0 Kh 2 KhQ&0S !08#808#80KhN  0P00 0S  0P3g4 Kh* -0`10#LP8p@P@ 00 0000  0 0, |0| 004 P孶`0  @0@  00  h   P9 -L M0PSp 0S` K@K P%PS 03K 3[8#808#83K0` P`h3[8#808#83K 3[8#8<8#83K0@0 4 @K?0K 50T;@T*6 @0S4 000S$ 00~ v 60Ts@T*v0OK000 r,#P000Bl0  >PH0@ 5P0 0 0   h ; p-L@P04`Kd @#p -|2L M PRh2   \`0KSP2`0 o0 S82004 plPRd0S{ 3/3>1 :`@ 000S3033 T] Ǻ3dp0p|14 P=303@To3 `3`V㏏H0"S3R1  K固0 ,pK E#3 00,0K,0K3 f @4  0+@K*K( +##t003 P3,00,0POch ;p @ ;r,  0-L M|P@T   P00 K0H 0@`@(,($0 M00 ;X9lgt T'0 0  /> p-0LM @+P-` p0 00> `P0 R0C  (P01Ł'B'D'F'H'J'L' 0-LM R7 7 @7 \7 6 6 6 6 x7 7 7 7 7 6 8 48 8 8 6 7 6 8 0P@0!80! 001P @1 P @@P1P @x1 P @`1P @H1  8!0 @P0- @0 P0 000 0 0 0 0P @0 P @l 0`@0 PD D0 @P|T'2'4'6'8':'<'B'D'F'H'L'J' R-L e p-LMQ@;01  P `# 0!0  0PPV0(B(R`0 01> 0PP9 p+r 00a=C4`#hl 0d1+p0S 40< `*  `0:0 T'80'd9 p-0L P@p= `  000l2  R` ^L00 S 0OPV@p #=j# -LM8 `x0\2\0 00 H4 ,  82 R 0(K002@ Q@PA  0#PTl TM TUR  002@P 0 PT > $= $= $= $= <> ,> > = 819 $1 40R 1 ,8 0x|R TU@@ 00@ R0 ,RU0  0 X0@@D0@@40 $00 U 8.:D$T'  -LM4 < /<8 0@P` S @@ T@ h@ > |@ > > > > > @  00 ,0 80A C0R8? (? ,@ ? (? ? 0 , @$@`< p0P00K4@ nN0 0 P{P   408 <00(K8@04 R7@7@8@0@00 ,@ 0 ,  0 ,  00 ,0  0 , .8: -L`M4@K` 03K/ 3#K #s[Qk Qg 0S2Q l   b2 3K2#K 2[R["[`0 dP h  O03Kh2T3K0[["10!40: R2[ R2KKK 5 Rq Rk 1!>?!DFc l^,Ϡ2cl`P10PdP!0PhPc l0p P@)(K @1   TQ,1 lP  @!@1PPZ@K&$1 %K5K P'V0[@S$T0[.S!Q0[-SN0[SO [S[U[*BR[5.B* 3" 1C 0P [1 1  00 d ["[2[H(T'T8D$ 'H$:hQ9x9v'N$99 0-LMPp0 0 ,<%L0@D0!0@ 9I@09A0 0T' -9L@@, 000 000  0-`3 LR@P D3R *83R W,3R 20RH R3 0R [(00CR "2Rg -2Rv 0R- # 0hV0CRt 72RD >0R@|2|@ 0C 0h0CRI T2Ry 0R @2@@00CR0 0R( 0? R1 0h,0CR> 0R1@@00CR 0R1@@0@A=@0 1 01@@0p1@@0`1@@0@0  01@@01 0h0@@0 = 0 0h@0@@0D 0 # >0h. t0 00 0 #9 C:8<JD#26>B.F4# -MLM1 0 p 000CSp(KBKII D ^0T `0S` @ T KpP@VP9 3S; 14K3 R ZM@ 0S9SD 0 D B0000 . LP  S0 #10C 0P w%ZK _20Sp0 pQ= RyP TKN t >K H8K D0h"0C4K02K#K t B("(04"43K@QBK0 5[Z90K  5K(Z*K #ZM @ 0 BR$[4[Q04KD 0 D B0000 <  ZM@0 BR,DPt 0 P0! 0C0 0 b= RC $Z0 R 5[TK< 5K06KNK pPt w5[K R@0# 80BaD$ 9T';gfff 6S-LP` 8SA  :$p 00Q8  X@#8 4/ 00Q`8X@   #8`4/|@@DHt \T0 R0C  (9T𩝨<p9L$ -LMp!0 0 @P  <# 0QPEuC q 0aR0 ` ( U2 0R" D ( R4 h 0X 60dP?`VPTT0 R0C6 l P0XU<T'49L$ -0L RxPx`x@0 $<< p0T㤮 0Ti蚮D$  0-@LP@X#40 00 @0@0\9T' p-0L M @RP+ 0`0 P PEdu)#KpUt 000\01KP01K01K0K 00PD$T'p9  -0LHMp$Kh`KD0 ZK P H(@"(D0#K0K"K0 0H00< 0 04P  "{ T' 9 -LTMl p _l p@lç|?`  R  }  L/0 8?P  &XF?o*T ; D?TK E0CT >T >Tp0l.X >T [0CTp 0TE  p0l0X 4X0 X0S  x x\  . 0:0`埨(K>T !=T S=T =TlP  4XX l 6@ x +x x=T K 0CTp 0TlP@= R l 62 = R   =X 0X0)   l= XP#L#<@\   P x ,@N`K@&@@;@4KDK K$K HK l x62 0x,  np0X *EP l 6@h `; Rd XPN lP0pX lP$\: R 0p   0P*0004K?4K :$K NK &p X )cEPX 0 S> 9R  R 0CR : Xp0Xd)Ex9T 0T d9Tl 6 49 R  ,9X 0X <0x9 XPX 0 Sb8T 0Tyl 6 = S @SB 9 l0&8 ~x8T p8T h8T\l}Pp6X X080SLp  X LpX El^Po 卺p X Xl'DP+X0 \7Q~ 7Q s Q%  Q G0XPXP l 6l'P8 Vp X X&DPX.p@X l Pp 1S  4?X 0p 1X 0XPl 6 l6 l 6068&05 Rp 010   `,X X0/ 5 XPX0 85R p 101l㲾P4 R; ݹ5X 0X0, 45 R  (5 XPX 0Sm >0T0 p X 0T 00bY`p 0S\X 0 P\ d0 t U t0 `  @h  h t0 0$30 R0S   05 %<0 S  S  7S  nS  0t B02 R B000 C B0 2 R00 hSP000p0\  DPip0 T0 p0 X 0T 00b S[p 0d  Sd T:0B\0 pVX  3d2X 0X0, 2 X@PIX p0 $ 2X 0X0, (2 XP/X0 p0!@> Z;pX p0# >! CX U  㪸 P01   0 R 0 4K04K 1$K NK@X0 s 2 0T X 0=j 9ii i7i i i iiii .;T gfff9>##818i8i A i iii88?71B$##-%C, D$T'H0   0 R d0 4K04K !tX0 x xp  ! *Cx0RW 0RD 0CRL %P6 XDSI1>,0X lX 001007X0 T =X +00-#@? x xP X 00!0X 0S00 XD 1 RAX0 s 0X 0$2X 0000,2Q !0Q@2Q< `2Q4 h2Q, p2Q$ x2QC 2Qy\v2Q' D0CQ >0Ql2Q4 0Qe2 RX 2  ~2  U 3  3 @ 43  0dX0 Z3   33 R 3 XH1>,0? -L`帢9 @09Q<,RX&@ @0Ÿ00VK 5KKEK7 0\05K20K5K 0x2x"5K K%K 00D2K05K?5K 00^ ;CK5K]0HA5K 1!5K %KK01!#00 `1PL 0SI P @1@!5K 05K0%K 905K0K5K0)0 Qʀ0KK5K0 2T'.:486 > B>#_#<#0: J-F#؉99###D$*DH$! -`L@LtPs@D⯦to q䁟0 ( TbA 8R  #8X PR 8  #8X PR8  #8X 8#8 XJqz' pP 0@R0 ` (  0R  ( R4 h 0X Z𯝨9  0D <9 (<<(L$$99 -LMP,0 60  Pqa,0> R6 l F R6 l 0X @R6 l 0X 60 w@P R6 l (T0P R6 l ((0P(KL$4xV -L0M`P? QC @3P 43QX Fd0CQd  80;P/ @rR8 p 0X R8 p 0X\ RL8 p 0}F|2  0hP (K0S@2.`K0K2K02K$2Q9 0Q0SW2K?2K.`K02K00C SJ, $         0!02K0"K.`K2K 10S9 t10S- S08#[.`KK~H!TK0@20pPK& W?D  K5K 0 P@T0 R08#P 0H2K.`K0"K2KD      D$L$T'!,'#((D##. p-LM`80@_PPp440 R0C8 p 0EpL$ -3LM PR@v"0 0!P$ 800P4 娂 0rR8 p (0`P 0R8 p (0S (K`0\ RL8 p 09E0? SD 1 R 1R 1R 0R d0CR< 0RP P 0AS@Ѓ ؃ (1Q% 0Q0S? .PK2K"Kt0\ 0S40 00 000 .PK2K"KV<8# D$T'L$ #.,'(( -T5LTMLEP4K (5 R5 RF OG`P +gG1 F0 0@0@(KDp0p P <C4s2 D@F Q0@00P@ @4 R4 Rw FDppx0KP7[㺖[F`P +G1  00C b bh3 R 7[* RQ  RO  RM $[Qt0# 0 0. P= R 6[  2 R 2 RxK P wS =Fg0 0S S} S2< @>z<@0 x<&FP D0 oQ$[P& JK  DK  6K  0  0D P 0 0@0@E&`E꼤[>0P 7[4E  xK 0 <0< P E9 <00 0xK bAM @ 0Ep GP 9 `sA= G$0 >I lCPV8T',8'.#9X94999t9 -(3L  9sc @SR2 d 0X R4 h 2X褢b r0R2 d X 0R0 ` ( RP4 h <2Xue 0R" D ( R4 h @0X1 Rf 9&  1 R0C4 h :X\\1 R0C2 d L1XU1S00 R0C4 h :CX0 R0C4 h 0Xn R4 h 0X R4 h 0X|S L$p -p8phLP$M}/ @1P8 #K3K 8KpP (k(K躟 4KP  -\h E 70P9$ # ! 01( ! #  >  7'p0C x'00p7 h' <0`7 pp0d H'00@7 8'87pp ?"K2K.K0P77"[   6Q Q2 Q +>2K t6"K P2[S&000 , , T l6F@K4K 04K6 P@6  [^(6ࠃp6  P şn@ 5ĥD 0@b0A @\ 0 x0sU0@ c  )  ( % 000"$0f104 4@ Q P4$H4}.  Ǭ42Q$0004Ql$0;0Lj4  ]T4^ʔ80\4\`0@  0D4\000(4F@  0܃@0 @0 0 @@ 0l@0 @0 430s@d 0 @0H @0lb Y20Y 0@0 @ 0?5 +0B 0@70 @ 0-0 @ 0#,2 Ÿh2 P0À 0P2 P 00 01 0( @d00  @\ 00 @T 00 @L0 @E00 @=00 @5o0l @.0e0P @&0[8 0@<0 @020 @0((T'99̋9:9+ 40682:FDJ#<D$ H0 ; -:9H$'j),'_eNa///////.` -LMP`p 0P@   "0T 0P  @0T 0P 0  T)40 T0DD @T0 T 0P  0T 0P 0P   0S 0  ?0 0 0 d@ܞ $@@T 0 d -L M@, 0 Pp 0 `  "0T 0 `0 T&40 T0  TJ40 T 0  0T0  00S ,0 `(Ko)?`0 ,04(K 0-LMCÐS3   PK0 -LMp#8#h\30 @#TăP, @aH,$H00  p@ e0d8dÕ#hp @,0  0p` U(K -LM8 c@ P80 PÜ 4 0   "0T  0P  @0T  0P 0 0  T0L40  T0DD  @T0  T  0P  0T 0P  8 3Sy 0X)0K*0K4 p 0S+  0PB@W0   0 p*0KRPE@R(  4*0K)Kx>p Pp 04Pn>W0*0KXW60 0 0 840dP 0(KPU  $  $0 0  0 V  $@@ U80| 8a 4 *0K)K'>XX R 04 d괍9ԍ9 -L4M3sēPL0 S  c$  0@ p 0  T0  0 0 4 !0T 0  $'!P @L03(K $  "0T00 0 @ƜdT  $@d  0T00 0  0T00 0  H0T 0T @0TtJP 0  P/HK 0  @ PHK P@/  I0T @0T 0TIP 0  PHK 0  @ P|XHK P[@00 0  0TL' ; -L(M#3s@ #S`< X SS *(KS 0@S4000T# 40U3ƅU#ƕYH0I0("V3$2#3"2̓3#@0PSPU0X`X+  @  0@  0T  0@ 3Sp13]P `00@S8K@ <0 P Y00( K#"0RP2@@  0@  "0T  0@  0T 0 @ ˠ@ <0  9 К "9 -3L $ 0-3PL@ $@0Õ00 T0 p-3LSp,_`Ð0@00 Tp -LMÐ@ \00 V8 W8-Ð0 \  V8 W8յ -L⊵ p-PL`᮵? 0$@(, p  0-3LS@0PÔ 0TÔ 0TPUÔ 0T0 -L@hG p- ML802"0 o@2" 0P  0 е”\  Kph: 04 $ Kph.l $ Ц "" -3L $ -LÐ0 T/ -LM 0 08(W80 `(W8* -Lݴ p-PL`? 0$@(, p 6 p- ML802"0 o2"@P 0 0 R”\  Kph 04 $ Kph8   "" -pQLPU@_X?0OOP$` 2>AB?`PP``0O?0@@ cAQaQ p- @L`0T 0TP$ U  $8P pp -0L040 T -,0L8l02 0;+c -,0L8l02 0 ;+c0 8/;0/ -1LMpQKP 0K 00`P 0@  T 0@`\ ڔ 0S 00 S R0Ġ T 0$ 04 000Ġ4;tgncxgZc `g/$0 R/0 R/tg4; -0L`4P0S@00 T 0T 0T 0T 0T 0T0S0'0 Tp0 T}N@T ؘ $  T 0pWdȘ}~@ $ pW 0@W}~ $0P0P@0T𩝨 l @09 0-@L w04 00P T0h詓 -0删S/0 4p 0  0LT&40S  $  0PT  0T  0T  0TdT@T T* 0  T0Sz S ꨷ @ L t 8 8 8 8 8 8 8 8  $ PE P%00<<0  T  $@P90  T  $P000  TP00@0S<< 0 T !0 T  $P  0T0  T  $P00|  $0`  T  $Z0P  T  $0@  TZTU000Z (i 0 0 S0 00  0T  $0@  T@0  T0@ 2P x"xŸ0 Si00 Sg QL- T@ <4 ( ᴍPlz 2 R0  0m  0 001 RY    Q 000 tQ  000zT wL 0@000pm  $y0 r0$ 0440 0Sy0 0 @0 0 m000 00 lg tgd9ncZc p9 ,  x9Ď9hg-:T99999T9899t?j4;lg'܎99 -PL `p@ᐐ 0T@DD0 @T0 T 0T 0T @0T0 T $i薑 -LMP@pP 0`P  0<<0< 80@` ,0 $ $0pdg<;t?jtg4;8;pg0; 0-LMdP`0`@ @0P <0S,00(0 00hq tg4;dgpg 0;9 -LM@`p}^PU  $  P50 T00 0 }^PU  $  PtP mPU ߕ $@  0T 0Thg N0 tgdg -LP `ᗏ0pP $  $@ $Ố 0Thg 0 tgdg -@Let0  0t0 -PPL 0R8pP@堀`T Q):W0  t0 oy0#tT(娠 ` x p0 0Rp0x  l0  2@ 0X<T.0040 T+cDW8 -L M80`S4P删  $8 , ;  $@P 0  0, "@0  , 0  , t0 0t0| R,0H, ,l0p"200SM  $Y  $p l@ 000 ɐ0Si 0屐x t0 0Rt0x ?  $p  $0T *p@0T@, 0 0 00 T@|0  `0`S  J0CT  $ (KT<o0t, l0 20,Pi 0 00  T^000 00<l0 20,P+c -L M@0pPtpx0p0t0V<<0W ``U 0p` K茕9:9 -LM"p00AP4`pt0  0*)$K|0Sʤ0 0 #H0S t00t0 RR 0G 0-H0S H@TPR10 5/00 T0S0 @ @T Г $@  0T 夠KR #H U1PP @ 0@ TT _00 T0   B0T; N -LM#p0`0Q(@l0P4,0 $0S T @(K0, R@pp  Rp  R*    p0p pYp# 0S $0R 0Y0! t@H"2d |@|@!|0@P0C|0 WApp0,00 T, 0T0 0Si $0KS00, T0000N 0N 00$0(  0 9S0&6R l0d!20P  0 00, T@n,0 T0  ,TI4,0 T,0 T0,00 T 00, T,0 T$0KS0!0, T0, T;9+c -LMŸa48@, l ሠpPP(K0 +P`2Wh T2W4 @0CW6 42W I1CWd ;1CWP 00#3000000000 , , T0 00 0 0 0H1WG 0W0 @00, , T1W 0W000 000 000000|0  @@0@@@,  @ LD ,0@$P@@a0 0;+c]t@yt ktzt lt -8pLW`4@P t0  0@"00C S  P P P P P P P P P 8 0@2Ÿ 0i @0TP 00 T0 TH40 T0 T0) 0KSpږ SpGpӌ0Sg p0 Td{ $ 0Tdn $0S@  0T0 T0S0  0Ti  0T 0T 0T 0T 0T 0Tr0 T $<<0 pT0;pg -04Pp008@L `T0 T0  00^  0Td $dސ0 T0@00C S P P           $0 T0 hs 0T 0T 0T 0T 0T0 T - LA8P4pt0`  0  l0 20 Kt0  [t0 0t0 }$000 T<I;+c - (LM$(" P4 80 W0qWS 8P@U5 Ot5% 0 pE   8㥣P뀀 0 X t0  05@(K4  0S 0)@\$%$5 ťt@P t  t0S ) 0t@́th#4 0 0@>K0 0!2010P/0S/0S/P/(0-#206S,0&,000a>000, R000000 /!2010P/(0S/(0S/,P///800="R$ //0 000// - 0p`L80@S@ l'X00090[,o驆hp@lP8Mo集=j99 0-L@MP0h腆 p-LM H`T < X@ 0 8b040 0bkKp 0K2#PPP @   ,0 0 ( (@ ^ 8L -LM800<0 08 =P}80s<0"0080<04 @0 ,04@\^j4 PL@&j, ;, p0 0, 4R0><ʅ0 S00,0 ,4 0PLCJ 3( 25 < ( 480, ^0, P80@ B00p*0 W!`<apP- ,#(0L",A P p4,80< 00 80< `劄(08 04p090(Ko迅(K<0$(Koc<  (Ko]감9 p-LMPjH`T 08 0$00kᗅKp 0K]"P   ,0 0  (0 ^ @8 -`80$ @RL0p4PP00x00$1`00< @0, 00 00C 00$@202LP00404 -LMD < @ b 0%  0 <0,  @,00 `,0R ' @"0F08 @ 80R64 80 p2 @@<`:#:zc>0PP4*3 S R OO`` `0F 08 XP"$> @ 00C 0 市8 0pDP2$00S (K0 0000 ,@ 10R0S 4O@P<P 80 00 0B$@Bp -L M80+p` ,P4@0Ppt ,0 Pp $ 0000 ,P  0,K D,0pP , j044080< % 108< 0, 0 00 P22$`D0L@0%0 P0,!,Q 100,0P,0, ,0 P, 02,0R, $` 00 p04lB pt2   lš0p \0S <2S ,p(Kl@`<   o ,l(0 p-LMP̂H`T 08 00Kp 0K P   ,0 0  (  ^ @8 -LM P=b@Vp  0S P1,0 P1,0P Y0F  P, < 4,0p 0P  4# 800 0pS0000Y `  0 1,0S @ Xጃ 80,  Q PP$ ,0S  P 4(p,` "k j( d0r,0 oH0,0o@ T;;;;; ; 0- 0LS@P ^P 0"P0 POP0-80=\  0 `\0d hP@ -LM=BT (KX20X2ˁ(8,X,H40 (HU'Y P$ $`V 0SS l/P80S 0C0b20000#s21Y P40S`  4P$0U00 W 0SSQ 3N 4 <00b<0 L, 0 倐3. 0 p#> 00Y R00`V,0@ 1@*C6"*0S8# 00V,00,0 3 YE 0L0>@)x0 R8SCX20CX2\$p0W80 @$0S 800 00lB pt2  B l˜0p \Z00 Z0 000@<90S@/N08=0 |g0 |g 0-L@PPQK4!0 -L0M80p="R =,+ )0*T d<0@ %0& $('$Ru *:R eR R R 0lB pt2  B l—p <\00㏀@zɁ$K Rk  R zD9R 0RU80 R S 9R RV8VUlB t2p  B l—!pP ,0 L#Ġ# (K 'K&K%@K(0K&R 2\8R 0R 0V8V!0NPPS񟗊X h $ 7R RqU000~|7Ry 0Rv 0wRr 0sl7R[VY8VV!0NP`SPx 0 < 8 ^ǕA 0AlB pt2  B l—p <\-lB pt2  B l—p 0\Pd =2P SlBpt2 l2p , UlB pt2  B l—p 0\lB pt2  B l—p 0\lB pt2  B l—p 6\l— pt2  B l2 p, H%lB pt2  B l—p 0\lB pt2  B l—p 0\lB pt2  B l—p 7\lB pt2  B l—p 7\lB pt2  B l—p 8\lB pt2  B l—p 8\U=  JN4S Sr S0.Ÿ@(U@1@# @8 C4  02^/ 00l— pt2   l2pH ,O`K@' 8 M0K$40#  $<@L KJ0KK@Kl— pt2   l2L p,P 0  @P !0 0R@1@!  O0KSU00U0 0 U 0R0* R# R   U`1 `#@f TP1 P#p@e #T@# xl P P z .u# #8;c;̐9J;S;\;А9 -L@P0hC -LMplBP t2  B l2pP ,Z <0 @1pCWp!W"@T`l• pt2  B l2 p,/.00 b` T!0,!@W 0 0 m 0-=2LSP0}$@0h~ -LMPP "R pWR 0``b00v0=2 VlB pt2  B l•A0p \4` X2\"0 X2\"wnhR@EX2V0CX2 lB pt2  B l•p 0\4 04 @l• pt2   l2p ,` "pl• pt2  B l2 p,"`$=@` lB pt2  B l•p 0\l `P80P8P`~ $P(`0P8v<9999 0-LMlBP pt2  B l•p ,40 0h -LM`0Vp0P`VJ"=2 SlBt2p l•p ,4 0S`VZ00h -80L="R <2S 0-LP0P@0xT0 -LM80P=b0V   , 4@pP $`D00%0  00Q  170<0@ ,, 00C 00 2p$PL@C|004p090{}<2S a0( -L@P0h -LM8 P`p=2S  $K0 0 0 4@ 0(K(P060( 060(202( 0(0 $L@{(0T   $P(0 S00( 4090lBpt2 l–0p \0S <2S }<2S l@9 \ -L@UP0h 0-80P@L="R 0.P0<2S00 -L@4P0h P =2S<2S / -LMp0  R0 0Q6  090dP4 1 0@9P02>U 0 <P@O0E?01P E 0R904 0 @RJ1?P5@TZ 4  8k~A ʏPP 4 @3 2 \!l—Ppt2 P l2p ,l—@pt2 P l2p4 ,l—pt2 `P l2pH ,, l—pt2 P l2pL , L0@ HdlBpt2 P l— 00p\dlBpt2 P l—p 0\@ 㗀l—pt2  l2p ,@ T$J@P@T 4 OlBpt2 P l—p 00\l—pt2  x2l— |,00 p\lBpt2  l—$0p \lBpt2  l— $0p( \lBpt2  l—p 3\lBpt2  l2p ,lRp t2O  0l—@00p \lBpt2  l2p8 ,l—Y %Ypt2@a  FN.B B c0l—#1A80p4 \lBpt2  X"`l—1p@ \lBpt2  ,l—:pH \lBpt2  l—P 8p\lBpt2  l—pH ,0\lBpt2  l— 0pL \,@ Pl—`pt2 ` l2pH ,@ T0@@ 004  HHDHlRpt2 ` l—4p1 \H 0@|gX9p;9@%I$̐;x!9 -LMl`ppt2 p l2p , H H81S[ l–pt2 p l2p ,lBpt2P p l–0p \@4l–ppt2 p l2p ,@dTP ,lBpt2p l–p 1\lBpt2 p l–p 1\  DlBpt2 p l–p 1\ꠑ9 p-LMPml• pt2  B l2p ,d B`0 @`0P ST <N0`2pV0`2p鴕::ȑ9ܑ99 -QLMp`G Q1 Q i<2l–0<2pt2 p l2p ,DHPT8 lBpt2 p l–0p \2}<20C<2lB pt2  B l–p 0\<2l0<2pt2  x2l– |,00 p\lBpt2  l–$0p \lBpt2  $l–0p( \H8SDHT lRpt2  l–@@ 0p\lRpt2  l–@0p \lBpt2  l2p8 ,l–LH pt2P  10CN>C 0C0b l–"!HQ0p4 \lBpt2  L8l! l–p1@ \lBpt2  l2pH ,lBPpt2  l–p:H \lBpt2  l–P 8p\lBpt2  l–0pH \2<2 0CD(<2L(H(il–pt2  l2p ,@@lBpt2  H(l–00p \+l–DXpt2 p l2p ,l–Hpt2 p l2p4 , L%I$ p-T0L@`TPp@T 9S  @Tp贪g/ -04 10@LP  >00t*R90 2/ q0@-P( HT L) 0!"4# 8̓ t\0S \0S  RJTPP \0SX00 -LML9 @壀妠᧐Č Ȍ89p:`< =P 8 ;>@4 ?$(Y0 , 8K00K0S@d !0 K 'Cc`(KX P P/p0: p0C*:/p0: _0C*:/0p3/0 P / 0 0/ 0-LP@@T08.:  0-@LPu 0 0 9@)0hw -@4LP R00080 0 4P0,0 0$0(0 0-PLuIT R0009 0  v0 -LtɐP@`pP/ 0 0@0=00000090000L)04 8<@0@t0x@<08H04@:< |0l10,0\  D ` \ H00H0=j' 0-9L@| -0.@L 0P h3%!9 -L M0 4 L, 04 8 P , 0S ,0 S Sm SP p0l (Kp0P 08< 04P`40`L),0-./4 8<4@&"40@00 ,40 `0`p`0p`pL998< =>@ $?:P(; W , 0480P`40`V0 :0*:1 0C*:, 0@ p,H`P0@pDP0` p0@ L#D <P`0@(!(D#Lp4P40``}7|9X9D9 0-L ML@! 0Y"4#8 0 K00SPtɔ0X R1X R0K! 00P000SU\p 0(ɄK0p 0뼒99 0-PL@_00P0@T09 p-@LP`"tP0S @ 0 0 0 8 80P8 phPu9 0-PL@tP0S @u@ 00@0@0  0,9 0-LMP~@# 00  0   l (00(0 ,00,0$00$0K0@t  ol9L9 0 -L4 8<S_렓9 0-0LHPT JT LL  aP00 -*LR@ TQX0X0X0:TX0*R*R TQX0X0X0 :TX0*R*R TQX0X0X0:TX0*R P\ R`0`0`09\ `0 PP /Q00090)R  ؇ -L@h| R/0S0S P/P 0S00 㴇 00괪g p-`PL `R@ 0Sp0Sp R  ӇP00p贪g -LXM@ %ć,  0D P`p0 %4 8 < @ @0 4P `p$8, (<4@,@0D8j,(K9 0-LP,0U@  % 0hCꘐ:-:9 -L@E0 ?0 <@ <0  -LXMt@KpP`c| ~+K -LM@p`yrt91XPU UV st)1L)p 08`X`p 0di+ Kis9f8$ 0R/1H < p-L@PEr`Qph|s 0-0PSL S 0T0 *TX :P P0S 4@0TP0 t@T0P00T RX0X0X0:T X0   D9 -`Lpr Q9 Q7 Q3 Q@ : Q, @00S"  0R& 0000S 00S0`T0:X0*T`L:PJ 0@L:PJ 0SX0 Qis 0RX0 Qh\9 p- 0"# "L@Pq0``9H:UH D0 20lδ#PP0`9rpPꔔ9; -*ML 0`V 0S/R !T -0LMPU. $@KA /P$ xW! \iV`V P0 48<S@T (< P@  KzWꀪgg -LMp)(0!@ *P 4"`+#8 < m 21C0a1 @8K < `0004 8\ > o  P0 48Q Q| Q>  Å0 $ (,   048 < 8  P[0 48<@(0) *4+8<S(KO0 0 PP0   z0 $ (, Bs 048<#,##Ƞ 00 $(,0"̠""N 800PPPW00PPPĔ99 -LM Ly@W ßX9 "10 0 0 &P $̠$$$H  @ 0 P$ (< L  "\!4!!̠""HP 0@0 0 !" 4#`8`P jVX ",0( 4;2( +>$0"` T405 6478`:p ?;P L<$+4"2L)540674 8<2L)! 0"#4 8L)405647 8p.pS!.!!D>!P!"!X5!<#!4!\2!1!)!=!m! -`PL`:pS 3/t  XL  TP  P\YU  I ETP1S10 $8S :S V*R:::8*:  h" -pQL@T `0X`STP l!vol1` ?m`V U@00=j p-@PLPp9`S'U1Vl0P9᤮`9S d9S 0 3 1Cu#PQH P *iphqm090 @ ]9SU  0Oꤕ9;9 -D0L@8 P8 P耪g -pILTp@T `hP P  08 w@pTWmuꬕ9 -0LgMl`pPm/K0\@lP K @]KB K0 SRK0P `@0 @Qd&V <0@0@T0@!U=jedA(0 S-$0@L%@`9SH:Shۭ p- L0410T`Ut@n h9S L)p ^:S0(0phX00`00%SE 5S< '(S *SPp*M0(00 %S S SP PS S SS S SPPPP9̕9 -@LC`9SH:ShJ -@`LPjVp (0S0(0(0:S 3/P# :S"T0S TT RX0X0X0 :T X0 0P (0S 00 0:S 3/hk Lfs0 0 9D p-@PLn`l0T0*TX PH:ʄ0CH:phl p-n`PLlJT TQX0X0X0:TX H:0H:xlp -yPLHzgl> ,0 W9 * Ʌʅʅʅ ` @\9\`0)40@ 480<$P^`WO! 0-@PL YU 09 Ac 0 r)> 0 9Y @9l@) S P080S880E --LM K00,8 01- K -dL@{P , P  89X9 -@QLp` d:S3/HT +^L p kP JT +^p9 p-PQL` L)@0h 0@ @@4pXU OL p AP ZU pOp9 -@L`p  PL~PL \ X)RxG  0~p)t R t9 RX9"100PVp #Ppt9^ 0 S0 S RQ  PUp)R t9 Rp 2L!   }PP  ;99 --LM K00,8 0F, K --LM K00,8 06, K<0 0-PL @P0}P0g -LMS8# 0 ,K GVPaXI 0ĐK:0 . 0l0 0, 0l!0 P` Lp 0|0 H D P P P H0 0H00 rk 40 , 0 S ?04X@ `p XP1X#\ b  ]?04X@@,P R5(K 00P@K00Q@K@=j9ܖ9 -L(M`Q* 0K $$5@T +^@T  pPP (0( >@ D @D |@ |(KhV +^L p P jV  P0@0 D0 @@  P  @ Lɖ0 48 S l(KL)! 0"4# 8  t@X RpX0S pW`  p`X R AX0S  R m h0   L K 0 ,KRP 87,ğ@, l1ePl.K,0lfP  l1,e,NO0 (0K 1RS L K'SK 0 P @1   K0@  " "  !Lɚ 0  Q~?K0S@T1 A AT !Qwr ,0- .4/8<S * L K|y L0Kh 1PP 0P0Q0S?L)000000000K "LK\ ,0 `0L 1002@3 48 0123456!"#![8 1[ <01[,0[-[@.1[/0!1H0p!X &wLyB`XII8  \Iwt @pɆP  9PE l1,b,ILp`Q P!U0p`Pq O :!! ! J |3F (t@ t  0! $0@Ĝ9=jedAmarc9CRAM\999 -LM0  80 tpX "10!PP4 piV0` * 0㨀00 ,0 40 \ P0\X0048 L1 $(T\ `V X0S\`V)_t4 [t0(K0U \ 40P,0S \ 00\000  zt. 8cL  u0,0 000 ;marcCRAM -RL,MT `M Lp0@P0  TtT0p900p APt0\@X0+ LK 0,KLP. ,l1 `P, h,0 `0 0S @00$@S 3/p P0sP T0pW@P(KP0P 0P0 (90P0 ,MI0P0 =j;9 -L0MOp QT0 P `= sYP A  s0p\9 %PH r ? Pg/0p #18#hV*PP@VP$ KP@ H@K 0 `?P ps m(K PP` P 1pX 9 "  9PP02 P P P p@ P! L)540647/8 <S `````?  I2Tʚ0\T9 x9|I @ *0 8\`P@( L 0 4 80P 0#,##8  0L" 048 <  " "4"Ƞ 0 @ p9S 3 #P9@0Lp @ T T0U T * 1A NA`P `TQ CPhYT9aV L)p 8L)0f\IT x: S 3/P  @TXʚ\n  T0 Ȍ?; ,H  P $#LK09=8< >:; $? (H3 L \(@,P$ 09=@8<>Č?:;P|H Ȍl0`4p$H3 8HLH H0sLHO0X0%qL"RD 0SH0L202*q(XP( s48 2K0s0S   P 00h0  CR <#00@3  @0 QPZ.S8A8L 0L@0<X 1 @ 0rD3 ! 0` @ $P(V|: $Z% <L@K|L 0D D30@PpČ@嚀Ȍ`,@ $Z 80R L O<K0p 16K   ` 0CSr PL#0@tpL382K0 L p88 XYV4cPPXpU $@ n nTP n`W0#R P$@ n nTP,PU $@ n nTP,3S ,@ ,C nT<*n@*n8(K0Q @  P0h0 $@T  PP X@0S?*ML#@s :p.$?P;Č (/@ȌL  0T@ &`P0\@K0@P\@ XP 0%SB S (KP@K X,̠h X@\ XPd l $Dt ,|T x@ X0 @t%,XT", ,,$#8h[p0 PKp[$4OKx[| X 0 @ ȌA 9@8們 墠崑弡 DxA :x儡 壐 1đ 倡帑 ἡ̌ ɯᘑ 唡 唑0OxO;Oᄑ刡 đ ᰡ 刡\ t >Kp ` O]K< Ps `|ƒ@]K t p! 奣S ̊Q `P]Kpq 夁 Kh d jKY਑ 夡 |d Vpl l!p P, ( $눣̊`q \ sP $q T `hPK @Xp4A K0@`1 \A dA$ V9|L9L) 0!"4# 8̓ t 0X Rc 1X R]  Q|~P5P(K\dP|1lQL)p DhqU`hP\!d1R夑 !""4 ",<1 4 0 8! l  0P|lL)p lA|1xAlQ0p dil!X}hU_V| l|P ꔡ9,989\99ȡ9 9@-L)@ 0!"#48 <29 -LHM` 00K\0 @l#X@ P\ L)! 0"#4 8<4  L H  ?< 80 ,00 H@4;T$P0 T U\0P@t 0 dkVTb 0D @0 TpKP0 SOK \D0t !XQG {iHLp# !]P„0@pPqIT P R 080\@T#phdq\! -2L@P 2S P P ti"`pP P")i0S0 (  R(Y00P2 L -LMP0h0p 0d0 ` Sd 00000 ,@ $ bR00Sd0d80 ,"?110AOHL( 0V4p 0 0$00,0 008PU `(40,0  0 0$ 0K  00K0 @00 ,@ dP`U(K d0 d  0-L0P  (Q S@V0h-U}0 <00h肄`! -LMKd @P 0 d40 @<0iP0(K̢9! -LqMP@P K 0p0@ ,@ PP``[0K*A@P^b0 l1^TP( 0=`,PU  /h +hTP)$h0@V@P00S X"l1 IT0= (Kl0,y/K0T@P `02( K01SS^  7h  0`P \`P KU`P KM0  @P`405 6478<s; h\p0 0@0@` \ , K,@T+S @T 0 48<S P Kt`a  `YP K8`R)gn=jedA\99ܢ999 0-L \P@  S  L) 0!"#4 8<90q P02 Q " RGP0#2  P  00-P0 L'0 0) 0@ QH8LH@0@ \:*808 X:T*000 `:d*(0( x:*0 9!!!H!ا!о!$!! -LMpL K 0@PPP,K?Pğ, l1SP ,o< f.f f(KL K|Bl$,lh.K0cSP 02( K01SS L K$* f.f fC,l1 R,.<L K f\@,0`0LK h@00@L)LK5406748 < 000 40( ,0 uL 8H0 D Xfm0a 0 0 0 /0C B0 @0C B0 @ 嘐噐嚐囐圐坐垐埐 L= B`0 71235640 00  !"#89:;<=>?@$!1H:0!X5 \f(8P0LiXԙ   \Mf t ᜐp$ Bf @ 8`?< L#?1SDOpPU! 3! (00  l0 ~`PP0 HLp !]P0@pPqx(sqo98989P9\! -LzM@`TpP@K z K肏K,WPU @ @~YU@ -LM@Ph9ij`4k 8Xp @P<K  (K  [dP 0! "#ČȌ̌h  ;p7 @8p80<@(Koꤢ9 0- @0L,[(0 :0 9 0X*T:謣94!D!H!@-L)@ 0!"#48 <9 -,0`S0P@L(00  L pP0S ppP 0 (0L p,j 0 (0 '봣99أ9 -L M0K!`!P. .  8   0LIPty40 !0 "# 00P1X R#T0 ty 1X R02I )(KLI 0! "#48Q8 02A  000 K  jP  80Y! 0"4#4 8<S 4 L)p  9,99 0-L MLI! 0Y"4#8 0 K00SPtɞ0X RO1X RK0K! 00P000S/ S 0S$0S,0S= U!(!!h!L!!\0<' \Ɏ$ K0\0<&p 0D\0<\0< p 0(.$0K0h %d99f8L9 -LMP@`fKt)q0X@T& T 8!!H!!!H!x!V V Lt)0L)p 0PV0X`p` 0d9+ʛ KisL0FSV ViV V꘤9f8 M-L0R TKL9',&&Ƞ&'D'X? 9:;=@>P8`]@?P (4\N8Č0@;p^`d0 `@ _@Ȍ d K  `t@0@P$`(4 L8d l:N pLW<GdkᣤT+45L VV\T P0 T K \ XP Xl h Q=tP l h XPh U\l Z `0dP ច@ 0 D @0l0 ,  h@0 Ph<,, 唕.h8 4 lK | x < 4 pL tPt<t8 K <@H@PYʠH8 K @ Pp J 00 0 0  00Pd K |KFTKPT  2.  @   0@ 0@?HpTTt*X :PtI( 00"] 0 ttt&L)&&̠''<'H0@`ptPLP 0\K@0@| S[ tPNLP t9SX0|K@DK| x 8K\0K 0K ` pP8 4 SxZPtL9L) 0!"4# 8<P`Uttɐ0X RI  0X RA 0@P1QtL)p xTt9S t6P} tL)p (Ko}t 0 x 徊b l h0 tt@0L)p <g\Pt lSꔡ9,989\9ȡ9 -LM00K0 @%@ P0P`L9P]!\ "@ $#`(^ _` L ZP 0`KP PP0@U0@ 0Hh d 嘀dP0H 0c0C  x t h R 0 8@Qᄛ4X T0 x0K0 @ H0 D@ X0K0S@80 4@ h@K0@P@@ p80<@ KiP9 0- @0Ldm`0 p: 0 B9)D0D X:T*<0< t:|*404 :*,0, :l*t9!!!!!!! !! /@-BA0 0#^0E-Bl pA`P (  0 8 , 40<`. VP踱g-\0\   0"  P1 0<0丮gg 1 0c/Ḫgg-1 0 个gg -l`@QLU   YP@0p0 10!  \긱ggg -LM`, V@Pp)   0` t@P# 0 0 Y  XP 0,(K P `P    - 0@ P`L,0S(0  L pp彾 0 (0L pD屾ppP 0 (0ؤ99 -`@LPCp0S  U R P H8 P H8 0 *X000 H8 0H0,iD - 0L00T0 *TX : 4@T @T -LM 00K0 @L-@ P0PL9娐]!\ "@ $#( ^_尐 T ZX 0`KP X 崐0@R0@ 0Hp l l0L 0c0C   p R 开0 HQ<㣔4ˉ|0 0K0 @P0 L@ p0K0 @ pKH0 D@ 0K0S@8 4 @0 <@ 凔ˉd ` 开>@ XBP K QHQPK  p K `KK`VpX ?Wgd p K H K h d  8`K`Vp `80K`0 \@ \d Qʏ 0hK@h d dW 0hK@h d A \1K8BL0 @4+ 0 " | 0##@ K D0@S(ڨ 0tx t0 @ 1X R02 V `0S hY x t @D0 SG  J  .)90hK+T  jDP @PhY K  V T@ˠD @PD@_Y X@ @TX@  0OᘀK 唐 T T HX  v  PPq  Pl 7h@Pe T 50T > K Kh @PPL` K  @P> K @ PP1Th K  wP  `@ K  @fP0P @ K VPo 0S` |(KW@$ `0S\X@ hYd R@d\K V>W<FV`| @0##ഀ` \ H\2 @x t hT K  HX@x t P   0 0 0h V{`0h@SsjhKThD@0 T: K @@ @T@ˠ@PqDX0@V & `^( h\+ T;  #0} K PND0O\ʷH^V W `^\P h\d^t@hKx0@堻Ÿhx 0@$? D PTѰ K  TK@_P` K @ PRPD\I0@V* `P, h R/ x^2 T+0 !00 0  K  +PD0O\=H^:VW `P\Q h Rd\ x^tP"HQH^H\5-@\ 0 0@ 00T 0*TX : QA(|9999g9ĥ99 -L MLɐP! 0i"4#8L8 K00STt 0X RM1X RI0K! 00T08 R- 0DR࠳ 0S,pWT4V !!!! !!^0>& p 0_^0>' K^0> ^0>p 0H@@vT `t9`X lT/뼒99(9<9H9 -LMP@`o?t9q0X@T% T !!$!T!$!$!T!V V @t)0L)p 0PPVX`p0 0d9+ԏ Ki}@V9f8 -L9@] \L^_  pH-L) 0!"#4 8<0S039蘣9 M-L0Rp`  KL)0_^0\]LɐpG] \0^_48<4@s ǏP`7"@$#$##\$d$x?9 :;P=`>p80<@ Ki\9 -L@F00 TZP0  H p:09X*808 T:t*000 :*(0( :l*|9!@!D!!!!!!/// -LM  0TT#l" -LM) 0TT#l" -eL`PpU< (00p04S80,0d0804p 400 ., 0@07< w &((0"4#220&$ 04 @ 0i譐;99WEVl" -P L d&@ ]pP` 1TJ x1T) *`ጒX1T* P1Te/`010S ` 0 "`P >`P0T% 0 00" 0`0 eR@ 0be/Ŭe/R 0T %40$ ( `(crdAhdsd edAk~gdl" -DL!88#!P1 p" D0020p(P00`t004Q!80@aT@!0   Hq800d<0=@ > o0 8+0@00 <=@ o>H R(c;; 8 8-#TLH%pᏗ`P0@r #jᾑ(c 8 8-#L@(rPPp 0`WpP ᥑ0S  0ԖpB0 pP(c -L@›04"0L00I - ؀L`p0pcRP$  Q@P P00 `(pPp 0ᡷP,p0X@P00 @( i呸司(ccc9g99///800S SP 0S//<c -0L -L@\p`\h蔷# 10 0 P 0*W hܦ99 0-PL@`0 00h -- LM K00, 0 K -- LM K00, 0 K -- LM K00, 0 K 0-@0L@PT@T ⢬P0<c 0-d0LP\0T 0@ST0 00 @PT0<c 0-PL@ PP 0( @ P00S0 0<c p-1LMQ@P 0Q 20Q 0Q @ 0Q 0Q 0QP@Kp0CQ*0Q(`K 0@P|P  @40Q ,0Q @ B&B"B!B$$B%BB*B(B -L0LP800S$ 40àL@ct?jZc -T0LPp<0P 40à L  @ct?jZc/ -d0LPp 40#@"B ,0S 3/0P @cZct?j - 0L0St?j 0-HPL0@S0P0 T00  0t?j 0-p0L @R0PXT0LP0C00S T0000T0000t?jHc/ 0-<0L0PS@0\0 0008#8S0C0S00`7>p 0` T30#T 0` 60C00 #T0$#T'4(#T 0` T30#T0 08#8R000 0)/0Qq0 01(K 3 p,0 P @0T @,t`pPUuDjn9 -3 ML /003c )@  0@ T30 #T0@   V3 H#T 8#0T <#0TU3 0 @#T0 D#TP3SB0 #T0 #T #3T L#0T@ ,#0T @ 0 T3A0 #T @ 0 p P @#2 TXP@80PK@0#0@ TTpt! 0 08#800,#@DT  0@ T30 #T  0@ 9U#  00 @#T0 D#T3S 3/ @ 0 T3# 0T9 @0!9T(K H#H0T9 4#0TNjn -PL@p`5T1T% 0CT/  08⏁@4T 61T 1T0/`@4T6@ @66 @" \6@`@P608#8@6@@ B6@06'@F@Pi 7i 8i8 0-L@'5P*0h^6 -L38 KM@ p@0@  0@ T3B0 #T0  @ ,#$R< 0S  0@ T30 #T @ 0 D , K+[ 0AH1P07#0C220 T1< R 1× d b$\C c $,K $+K $P $TRK0 0@0@88K{(K0 800 @0@'dW89 -L M38 S0 (K@  0@ T30 #T  0@ ,#$pP 9  @4 Ru f 0 0@0@3S 3/0@  0@ T30 #T @ 0 % ,#$pP4 0 ,#T40  ,#T ,#0T ,#$ 0 D#$ H#$ L#$ ,#$pPn0 0@0@ z $#$Pv  #$00 @0@P`1  B("( R0 9!` !C0S0 07>0`,0 0` T30#T 0` <1 60C00 #T, 0$#T, "4(#T 0` T30#T 0 B08#8 Q000 )  #$ UP` P`0 0@0@ jn -@L 0㎮  0 0h\9 -9p@T  L×0#T3#$ A?@(0,@×# 0TL0@(0,@×(#$@ ,(0P`(P,` -9T@  LÐp#0TC0#T×$#$2?0@S, ×0$#T3(#$2,P`0@0×@000(#TC#0T×#0TT -LMÐP0 T3 $3@ @$@T* "T|Õ 0T_ 0媀x`@0@ 0ā T iځT TA@pp""pW8 -LG-@0 084 0<0   0 0 84 0M<0   R0 P ` p@  l0 P ` p08 40< 00 (0$ ,$  084 0<(00 ( 0$0 ,, 08 40<0 (0$ , 0 8 40<0  (0$ , ЍW8W8R@- @0 08 40<00 ($0 ,4 08 40<80 (0$ ,< G-SkM0@   0 0@0@P@P`P`p`p堀p 堠Ԁ$ؠ(,@0 408 <0@0P?UU[ [`00p R0@10XHA0崀0㸠P @h1X100 (H1@,00 0#00 c80`1*dH`n`1lȠppp0P,& #'a0 ` P0eZ@1P1 (@#@0b*,0c̠0 c<00*0$10n010dLp$1'P#1  #P1\0T1@1,0D100(0T1`#D1&@#0nc80`$1dH0(1101(1 &#1` P#T1eZ0X1D1 0H1b*0 *lȠ0(0pX1'a#H1 @# *0l̠c<p`q0(q1andL`p1& #1P'#h1,0Sh1 \U0000 d`X张0 HȠ 0\LĀ8! P `p蠝0@?@ Q$Pa(` q,p048<p@@pGp?PP@4P`0`kߍP h 000QhP@4P`0`G-Q0`Pp 0e01 Fjjf>0:-: 3*f?*0A :  :**   P0!V!" Z!P 0 `PеglgȫcW8//1s s0@0/ 0@0/Xchc/@-;@ 0$@/@-:@ 0$@/P/კ$0 -L~h}}f8cg 0-LM}00!@0SP  0  \0KgTj0T00S USU00 , B21C F0K0|LcԵghgg -!LM0p8 e 04 ,0*CU(0 0c b"HS0c aR bX00S0!((R08  C4 C2  C1 0  R1`0 0ࠟP``0̀"#100 00c4 J, L:P "80p`pV!F`p800S ,/(K4KuK|ԵggLchgg -`LMKOKp*tႜN\PK*gL{N( t(f2@Kcȫc p-@PL` ;@U (V1(#Q 0 0#0PXP,XHH ( ,呝00+ 劝 0 pȧccc,cj0c p-L4ML@K`$PKMu 00#0 QV 8^/($F/(㍛Kp(xc -LP`p  APP  P@1J# fpP  @00$!PPpX Q*A -L 00 0  儝 x0t0 R h0 iP LezS@@ h^z !ghT8;ga0cA"gԵg B" -TqLPL`.@T? 8!0V0f0056*V .; U,| !( 㵜?V0 0pS PV@1@!c S` ᠜0`d0dS0 VLmv.D<,L 4, 10cxc0c,cȧcccȫc p-LM@` Q@KpF_K@P㏚@ -LhM@pTK  @ T`P10KS "  S@1J#U0  e@P Ub*@Q e@P0SU@ K@KD@KPK(:,$K w(8P -L MKLpm0   K0cȫc -PQL M 2K0pQ 0 K0c 0-LMQ-@T1 !0S0C0(P0S; U,| !( 㵛?0@ aK[ `ਛ0X0C0-0D<,Y 4, 10cxc0c,cȧcccȫc P0-PL0e@T0C-0 dpR 00P`U%  \00 N @ l3)^Q<0PU TX 0> n1 ^2p* K<0PlD"[0R  >X X R h@X0O|0 x@ 4`S< ph P26B 0bC  R7AQT7Ry 0P 0K |K0Ph `@800 j H0l0 |K48d R 0@@PSPT00S40,00@8V` w0<S t0X@l(4 K0T0@0~TV ^<t+D06040H0D 0  H0t0P `D@0 :@^^ `P`p4P8`2@8P 8< d UL 0.S!#@DP@ L T pX 8L PF=8jHt TM8jt0<tl+D060<t X@(0T04 K,@P>V UF40H0`1@0P 04 P0t t H y\@ ;pl0PL! Pl0*0 t04PXP 4h 0K 0Px T0Sm*7t< +PD0\@ 60 < t+@PD060pXX 4\@ pP<pg  R/0S  0/G-0 Mv~h1 pW000@  Ѝ1 P1@ENa$!0.@OBdg@ eg  0\n0R LABA21C 0#!B0 031C dQ *V2S/00@0 S\l"hl"l"l"k"l"l"l"00@0 S9!000Q0CV@ @ 0)0[ P 00CV@ dU )@K0 0)[.P ;P`a0@0S 0@a𯝙aP0 g)0[;S -LM00 \=0P` p0pP@ )K 0 K0@S)0[)0[;S V0Pp00p(K.XpG/-//d 00  \00/ 0-L\P  @ P004  0 0 0-LM0KP/@P00d0(R @F@0 -LM`< @0 \@><PU00K h$P{P :6@p@Q700dp0 @ `P 0c Y (K<P R,   @Q 063@\0`@,P ,K 0z@P,0H00 0P X0TP\oLPP` 0  8 40<@T0X@/ \` 00 Ra 0D040 4 ]4  4P I,P E8p"#600APXw"v"v"v"v"v"Hw"400 0^ @P 00d d 00"d00 0 0k 0@ @0L @_R. 00<0j R 0a4K/0/ -Y0T-0& P -06AT 0 F?P0S0 0000P!0 S80 0 8˛F* A 0/,K:@P, H@00S#0 ,P  0LછF 0 ,,ᡛcd9.cc0cp99Ш99 0-RLM@PS 00 9 p-L\P `  04P8`O 0@P`P `$P(`,P0` /p -LM\BP`p0S00 ` -Lp  `PP\BX  T0P S#0 ! m 9 4$0\R:$0 -L8MT`$, PD p(KpPn Pڸ5 Up #(!0kpa"W@ 0 pPh0 l0S00 H < L @ 8 0,K/;UpP,0H@ ⰎP#0SL S S@ ,P 0,0 dY,P 0,0 < R 0 DD Q0DT0 X d pT R00,P HQR  " 0x !Yt 9 =40\2mLQ, <@ L ,p H0Sh0,8@ H ,p X@X O@ P @ < G@0P0$ @0 ?8@0P@ 0 K0@0p  Pc 0p a ^" 914,@<P 0P84<  0< 4 P 0P" 444 08 40<040  ( 0$ , X00 T00!@L\D  0 $ *00$ D0`0 Ph 3 0000# Q00000@SQ 8 P@" ύ08 40<0  ( 0$ ,@0 0H\ T0`4 0 0C,K0/0Pp,0 HPh0h0  ãh h ,h 0,0 g ,94989<9c -LM`$@p(KK p 㷽pP$0 \RP K Z 0UpPc@ 0#pP@0S ( pP  KpT d 0 #40S p8P $0; 0SP  p N!0(!(P / ep @ZA_PZ ȎZ N Z Z Z 㹎 op  (z 0PPc nc p- 1LtM1la PP0@ PP Kp K PP 0K$P PP 0   B e  {20h@P0 00( 5O nc=jLgcg@9h9p9h -LM@ pUPD@`00@<000   ;tx 800 7/ P H@aP 0S S 0P@`UVP00 ;00y0 $B Q0BP( :8 6 0^07<@`0@p P:0p0`007\0 (Piᾋp 0 @, u, P,9WEV T0s 0s0s40s@0s 0s l0 0s P//0/"/$0s P///E///00CS"0"0"8"0"0"""0"0"0"0"0"0"0"0"0"0"0"0"" 00/ H00//0d 0S  0%000/ʚ; 1s s s /40@0Dl00l /0@0 0@0Tc4cDcDl R0l0/ 0S00/@-D0@Qd0 < T0P0 $ /00 000! 001@Q@- 0@ 0$@/!00100000@Q 0 S /1 91/0d@1 - L5|9 -LMPp0d0CS<l0tS q T ` 0D0 | Kp0S@t0@}`Pt0s8Ht<`@sK`00@`;00@f>宗똩9 -0Ld@10 d@1 -L@ -L@ -L MHd@P0S p K0 C1 0(K pP (( H 00S@ 0S0 S%*Ό0" KP 0S0  R*寎(}p(y0S0 S*[  Up<嚎"[00b0"[000"[00b0h -L@ h! `p0PS`3l58` p`#TPdchs -L 00 ,0 ^nP`U TR*A1 @f0P  0004  (K 0,n`0lV40 8 T2*. A.0P@ @0 0Y  e8 00< 0S0c>0 a00 , 9@@u@>00l0, 00 $@H"̹"P" -L M(p`@P K00` pP 0SK -MLM@,4  0z+2` 僒 0PP?22 VL* 1RI 1RE \@ @ T;*0S P 0P: *p 0PP  0R0 S, ╄P P p* l*(K$0  (1 0(1"" V:@p1(0SBNK@D+0{P@  ,006P ,0.Pۣe:9 -L0>0 1! `c9chۣe" -L}McPKp 2 0pD @00 @ `P P@T `@ r(,00(K(!0`P@D(0$ (!0`P @0(!hPK 40b`P5P5[S `0  [(3[@RL 0PI`P[P a %a  ^ 0S!!(0K"  1R01  0>. 00b>01 !  x *10A0 a01 1S" H S(K10!   " 0 !.  . a0 S2Q>222>30300 5X*  ! 1 0K,P PH  ! 00\ . 0C0b"001 0H1 0! 1 1Sʼ#[Rp  1Q8   R `0 4 Q!RQ  0 c, 0K4K ,0KP\:00\,%* , b 00b$1 #[0,0 0,! R:0Q*"!B00  0 001#[c `0 1 , oۣe" -LHM8QH1U@$0 p DaV $K 0rP3P 0 0` Ȍ. qΌ@P 00 `Kp -LM pR`$K0.>0 0`. 0 @P`0 `P@(  0P``0 `P  . . 0`` -LM @R`@" 0:#:S%0:#:S z'zW P @  @ Ȍ PqΌ00p q@P K0@ 0-LQ@ P21C 0 P  QP P0\0 0 "!B?l$00P0 -0LS`@ p2PC@0 0 000 p@P00R00S p-@PL? 0$2AC `l~ 0P  ?$$`p p-T1!!1@@Q0!L00>0>0 1 R70P/*"`!B ` 10a 0`0PP PPP0P:"!B00` 1 0 10a0P PPp00C>!00 cc!X$cP"00l=j0lp=j 0-LpMx@KdPc@ 0PP P $K0\949 9 -L8MB 0R<0 0 !!R0S 0`0  a 0, (K01 :0 0*@P0 `EPUh1PU,Kr0@c 00 Z0`Cp0K 8@ 0p QX/@F 8KJ80 PKD KP0 L@ Hp ~P& P 卉PU 0- ,04 Kj 4K1@K@``ds0 30K2K0@ "<` `F<K (K,h(-$+gT9 4c9g99`9 -6堖LMl|0[bmLUgyqź)-`*'1 녜(HP( Q 06 R0 06 00  !!D 0(D  !!` R0Pa 0 40E00S 00400 4 0S00t0 0 `0  0  !!$ 0,$  !!0)0C 5 T81~ L[D4 00<Ԅ80 0A R4@4@@ P  kp@P0@0`d @0FP`pP`pX@\Ph@lPp`tpT@`d*1@@@3 @!

!1 P5 tt1 P, ``1 P# LL1 P 881 @P\a(!00.OÀ !0HP僈偈}{ywu=jg4X8:g ggggggc9$$g(g$;iPg0Ajp?j ;"g$gg̪9L%ch9ħcԪ9hhgt.9g"9"09"H9<.\9/x9g9999h9P989$9 90X00X  / P/X0S0 /0SX0X00/P/0@-@PT! x0tS X R x0S\ RX0X 0X0t0St0SX@0X0X@0 0-L@PX0PS00 0U 0S0e00 -0LS@ ^ x x0Rڭ00C0 0X0 X0 0t t0S - LR@ X0S0@ R0SX0X0 0/0S/0S/  -L P 0 0  -L  P00 0-dL \0PU @ 0$0$ N PU 00N0h #c#cg p-P@L` 0$ 0CR0 S 0S  0R: 0\0p M 0\0pM 0-PL@ ,0@ 0 p-`@LP ,0phs  0-PL@ ,0 @e 0 - L M, l (@,V  T3 Qb0epP + ,\ (0 S@0P 4`  "100 0c4 0 @8/X 0eP00e0,0p(,( 40 0b0(KX8 p-LM)  00t t0@Tp P 0 S$ `D0 O0S @Tp#cg#cȫ9 -LM`@p $0S $PP0 N$0S\@000,0h Ы9 p-LM0@Sp P⎑  0R: `  40N 0 BQ *ph ث9 p-L` 00 ;@ 00 @  PPp 0-LM@,0P00x 0S h0XX N0SD R00 0S000hd g#c9#c -QLME hp0OO$ Bb!R^V )ڀP@p? 21C Pp, (P! PF 0S 0xx =N0Sd X00  RPpPpU 崅岅hX8g#c9#c99 -LMZ, $ , 00R00SZ0PZ 0O Y `, P@hPY `0Xs 嚃(,0P`0BOP`?P0Y;;@Bc p-L Mt0Ϡ`Bl31C0Q$P `  D0 R 0P@`$ $P `   $KKpMb?B p-\0LM`PP0PHH0@^ ,0K(P $@ ,` KDKp;g; ;g -HbHP0 LS@lQ RP L M 2T00S- U 0D  DL00CSL0Ȕ1SGUx00x040 0@408@0UL0D0!0D00S000ih[pD0 7L0,0CSL0p00p0T!R/$0 0@$0(@0@!0HL00CSL0ȴU T0S t00t0,00 @L,00@Hׄ0 0@0 @<0 0@<0@@=j4cggg 0-D0L 00  !D D !T00CS00@P0S0 ,0, @0h gg4c8c 0-L 0P! P@#!B20bcp0p l0@@`0`0QS@@0 R@0hM((2$g;g8c4cgg ;g9 -qLlQU $0"  0`0SR G?0$1S1 R2 H00CSH04ژN!000#VPh1@P `Q 0S& i8 <1&QP0  !$ $ !00 RH00CSH0ʨ[000 0@@0 A?0 1S d0PP0  !$ $ !0=jggg;0g -D0L 0  !D D !\00S0H0 R 404 @,0(  hgggg4c8c-A" J1S 1 0<S RZ020CQ^1S100S^0Q:/0P/$0/ -L@P00 p-0 !L$ Q$b1@sP 0<!0 ! 0U 00C0p0 #  1 0 10 0C0p8 2028/ (("8/00/ 0-0LS@P P R000 ! 00C0+z0|gg p-LM0`P~@P P \-P Kp 00 0 0 ( $ 1K0 , $01KP K$00$00 00K~ P 00CS 0 00Kn P01K$00 $0 -LM`Pp Q B  Q D00BS 0 K0S@ @P K40K,@ (P 4@ 0P K7  ` -pL2`0C8#8S2 P@U R 00 0 PU@Z@@0S'020"R !'  "  !'P P 4 8!@ <hZy! '0020"Rg - LdSw`@,H00000C400 20  2$gL9 -LM8,0,0 !@,w`H tP P ,0 2b 0SKH0 PPp@0 0 0  Pt t t t,  0@SPPS@ R 0s 0S  0I 0PS@40s 040< 8 @ PcUڃ ?PcUU0' 02@r 0W ' 0@' 0q A0 qAgL9 -LM` 1R/2P 0 p!, 0' @A *t dxu@  t dnu0SY02, 0R0(K000 02Q0p, ' 0,{P0' t@p@B@BA  s,0! d7u@@B@@A Qs d(u0020"R !'  "  !'p! 'y0 -`LpXPP ` 0 S  S0S<0 ``0BS 0-` @0  ,`  -LlMPp!@P ` 0匀K0 0  0`0CS 0 V  K`VP0` l ` -L Pq1@` 0 0qW 00 000   Q%  0R0W0S 0WP40U  1 2 1 1s 0U0 P00 1 21 0-@ MLLPHP 0 @x00, @x0@K0T9g\9gg -Ppl` LD0@04{P  00R  0s 0` 0 0  00 0101 1s 0U0 P001 21+ R 80R =j -LM0 0000p0$\ 1! Y 01 0!,0 X0 R4 8 \C:0BF  c03P? s2@`v`  V1@K0 SSBC  c03P< ts2@pI000!0$ P1! Y 01 0!,0 X0 R4 U Y(K@020Tp 10 pR@ @Tp 10 pR@ ڷ2,^  1 @2 1 1s1 21 0$ ^ 40R00$8 0 0$; -L8MP Px'pP1 t`PP  0 S","D""",""|","X""`"HK PpPx3[Sw #[R R R. p0AS 0P(KP p00!0@X0 T@ 0T`6 W*,@P, KpP8 0CQ  WAP1 000 ,@0  000000  8C80C 0(B80 0t%8#8  0 008#80 0@K("( 0 ( P0pP 08C8S Ss P00 K00p0c0 |P&pP0S, 0HK L0 QpP3[S #[8C8SS S R^@L H0KpPHK 㳡 pP@P&pP0S5  pEP0 8C(R` 00 p808C8SI S? P0`0,P p' 41  \ P0 pX S+ 0D 08#8@000  P0pPo 0"8#8 0 00  P0  0D  0<  < P (1 @ P@(1 D 0P{ p0 0  !D D ! H0K4 pV# @@P H0K@@ Tg p-@LT`Pp@0 @Tp0!8 00CS 0/^qg p-P `Ll ^n0*O  D0H@T p -@ L0pS`<\4 0@ #4#0 1000p,04P0U\S*0 \4 8!@l4 `!$n4 8!4P8@08 1000p,0@ <07<@ - 0L@ h#0 0 @ 0 0 0h胆 0-@L P00  0@,00,0   0h p-@LT`p@Up@0P P ,00,0@Up 0-0L@@P 0h&,00,0/ -LM, 4 pQ8 1@0T `0PS`, U@4Q<Q q @ 1@0T `0PS`" U@<0S,0@ @ 00 0]@0< 00CS 0 <NpP@0EpP <Tg -L P @pA@ `V I⫅ 00 0?@ -QLM`   d S+ @5 ?L3c 4 0 ,0 OT00 K㤠  0PA @pTKQE 0F0 00 %? 0S/4 00 ,0S @KC@pK40KW T R40KLK80D LK cPRL H D H0SL4L$ 4@KDP  0(K0唀K0 P Z0K0K $P  , 00C0Z@ @ R 0 0 00  0X l , 1= 1H 0> ,0 $ 0,000C0YJP ؛ =00Qp0 ZP圐 R00 000 gY40j@0 P,00,0  B 00 0 @,00,0  B E@0 g p70Z2 4  @"!B$ℛ0 j[00SDx1x! @KB4pK@0K,8 pD!Q4p 0 , 0p=)A@ -B4p 0 , 0@40 0@ , S X8 ,0R  L 0R 0@=9 =L H D0 4 `0R 00 k_s e 0#SP a@ ^Mbt9;Q?B -LM0`A8@sZsqJ D3Zl 0S QqpPm 00 040PP#P*80QUKPUH 0S!0S 0,0 T Ub 000 48 0(0 =@0@ P5r  ,0 +,00,0f  ,0 ,0@ R0,0/ UW 00CS 0 p0    ,00,02  @0  S, lP  0p `DaD <D0 Q@P 0`P3 D[ (K D٦>00,KD0 @P0` PX |`@,t Dg0@X 4,0>00a#6x0`! . `1\!0>0>00a#6 |0 P1'K>0#60X10T! Px"0@xd A (W,Q h8P 4!M l\h" 0pE|<(<8奸h"l?<  0  !x DD !r?P[ p  @\t@ H 00 L@Kb'K |2<$P x"< `Px _,$ax0@x1|AaxC_SP eT0XS0# 00 (dx2Z/6x004@p)p1xT40 @0!!x0D  D !!xD @ 0!!x0D @ D  !x" 0 !D 0 D  !x2 ^7 R 0  !x D D !@0!!x0D &D !!x 1 0  !x DD ! 0R 0R u (0 0 x"2P 000;x"D0 s0@ 0@|`$0@0@0@D4姷@\g"p 0:x@ <,0S 'K3/P< 2'K (x<Px"D0  )h"l? x28!R PQ <1R 1/H!0+0 @1S+0  D06D0<1H R 'K 2/<1x810  !x DD ! #p( Bx2@eBx21C0 \  jq 0R 0R0R0!!x0D D !! P' 0!!x0D 0 D !! 1  (1`0 1 1"0, 040 pP4  `V, < K4K V@@PX/~8KQP%" 0!8P'X8 00040@4 00408 40 4$00$04  00CS 04 <G4 , <=4 8Igc(84Y88hX$c/c 0S/$ R(0(0(0 , R$0(0,0$ (0,/ -L@( f 00C04gp$c 0-L@P] $ R(0(0(0   f40P40 dP * h8pf0  if 00C00hggl$c -P@\LP` j pP 0  !D D !@\@ &hi5@ @00$S$0#@0.00hl R 0 0 0 ,h -`Qp04!L`a ,@T ,0S 41 r $@T{ DP v|< S# )0SD  $0 0  !$ $ !Y1, 00Sn P bH R )0S$0"0  !D D !, Y% H.0400 $0  0  !D D ! ,Y.04000S" P b\ 0| 5Pj ,0 Y0>  0S hP (a   @9 p-L\M0@ S`  K\0lK`,PP0SQ K 㸑P 0S Q lKP 㭑PKpP 0-@L8,4P,0S00 0040@4P0hN4\$ch$c 0-LMP@T  0 6@T 0 R404040 Ხ$0  @ᡮD0 `M0  !D D !  Z% 4h$c\$c9 -0Lp@P , !$ $, !`0S T  T   R0000 0 $ s hX $0 s!} 008!P0S 3/0 0R)0404040  R 0 0 0 $ : R 0 0 0 D  P0S0 0 0` ,@T% $3W@ $pD0? S=C  !D D !H R   $W@$0 3h = 10CS1N P#000D<l1S@02#@41SD0 | @ye{?4 @0S  00 p 0  !D D !b lBLD0 ^'$0 10CS1!30S.,0Su 0!!D 0 D !!("(> D@ 0!!D 0@ D  ! 0 !D 0 D  ! 2 5$@,r6 (!  ah0Sh ch0 @2 R 0Tp 004h|0S  % 圄Pp pP '$ kggiĬ99g9 -L  -LM@Q K00  ƏP u Z% l 00/!S  = S (!888xP @U@0AS00S  7P# j#(KQ0Y077 0AS00S 7P0#0C0P4 1Y 0 0C0d}jD'00C0Q(00T  01p0QPs 0 B0C#0 _P0 )0$ 8^B8 Bs](!L0t00 0<YR 0  !$ $ !1 @01800< D0 0  !$ $ ! <  0  !D @D !.!D  D  !@0Y@0 81L0S 3/\5^4@ @0Z8 <   |0 000D0  8 R000 1ğ, R0 0 t ,p  P100S!00400 0Q,0 010Y400S0 00, 0R0$0(0D0$  , @( ,@ 0  , Q\  F8^ 0dd0d 0 d ,00d ,00D R ,0(K=9 =0 D QPY | 0Q  *EY@ ,"<0S000000000^P<Q  D0 a R ,0X"Y  0  ,"00D000  0PH R L0L  !$ $ !    |0 000) * 0 +  4!000K  @  |0 000]" Y"i 0@)00|0nR`b1Z/000  !D D !I ;p$cPct$cج9;l$cDc94g$ȉ1(ggggi@B9 -LM  0  K -LM@`0,(  0@ @K<# p-LMP0L S`@Kp0 $K0 $0 0 ˋ@P($  0 @P`@<# p-X`X0@ TL p04PSP0 '@Tp$cHg p-`0L@`TP 6/p  MP $ `P@0phHg$c9 @P-0 Ã-L0 -QL@M'0S S -$K0`@KA< Z \<  0&@T   0&P P pp0 0[`P@05f@ ^fY\PU`V0 0 Cg$cLg@9 -LM`y@08 K !6P$ K @| 0$@|0 @听```0pCADǾ0@P@$U<`KHc$c\cg$cggg -PPL0 aAᰀ0(B(2 SpN`< b|0  %0#.i{@9F T`ڲ $0&ṩikggg$c -1L$MP`(!31Cp Y>00, Ã0ʃQ #0@S00'0,A0T0a(K %[ f!>0 C6 00 6P@40  04 0P @@@<PP" ,  Z0 0cC61᱀00@4 0jj00S00#00!P0_fgD9Hc$cgg|9 QP3-L@P`p:P 0U hf  9f렭900/0 0 l10S /0S/=j 0- PL@Z0h0 Q0B0R/,00 l R 00CS0 /=j -0L,!,M10 `l  P@p0 T  0S (Ku,@ D 0@0 8pK 0+ < 0T@ D00+<0S  ,#,P =j,Y8 -H0L l  R@0 00P00=j0 Sl1 000/=j  0R00/  ]0R/  T0R0B0/80S880/ -LMbp<0 P @2Pp8 lp (K)0  @Z2`00Dp00@P,P0Sppp4P 4 10S 00<000 00*  4, 0 tx00S88080<1/0 8PR00,K  圦pP@,0SH0O 803/G00@ 0L!p,00  00000u,P1 0  =00; @pWpW<8  `0b 0R0@ b0 @  0@S DT&\fγ,0H040S4 q=j$h!Ce9P Q 0, R//H0 @0 P/,0 S/,0 S/0P/ggT0 L0 P 0P ,0 S$0//ggH0 @0 P/0 S/0 S/P/gg@0P/0, R/0, R/P/g -@LT)0S0) R Q  @T - 0L41@SPp ` 0S ,@T$@T 4P 0SD0W00000CS0$@TR00000CS0 - 0L @R |0S0|0 R000 00CS0 3[ h/[`gg - @R0L00 40S 041041 -LPp`=@P' 41T\ V [[ u 4q R000 40SL 4A0S0 00P@VA 00 @P@41  V0  !D D ! `00!@ R00!p  q0 0100V 8Z0ZS41 000`gggg p-0L 0 !@PT`@T 0Sp) .@T P0@0S0`p@T 0S) p0gg -L@ 0@T @bȭ9 p-1L M`P ```) l1@F dAdQ0S 0C) D1: 0 0S 0S 0S .P`@\ _R0S PP PP@0 , !D D, !Z P # 0U 0U -@tL`(Q N 0SK 0S 0S 0S Pv 0S 0S 0S PpP\ Qt@v`t 0S2 @P0 , !D D, !t P xv 0S tt 0Sv 00Qv 0`S -PuL`(A D 0SA 0S 0S 0S dPv 0S 0S 0S TP@p@\ QuPv`u 0S( P@0 , !D D, ! v 0S uu 0Sv00Qv0`S -PuLp(A` P 0SM 0S 0S 0S Pv 0S 0S 0S Pw 0S 0S 0S P@\  QuPv`wp@0 , !D D, ! v 0S uw 0S -PuLp(A` Z 0SW 0S 0S 0S Pv 0S 0S 0S |Pw 0S 0S 0S lPX@\ PuPv`w p@0 , !D D, !u P hev 0S uw 0S@- 0p 0^0@p   p0 @  P`t0@P`P`x0@  ɚ;6e -l@L 0 0xpt -LM` @08@ 4P @P@ P@0 , < @0  S0 @ @@ @(K 1 R1! ` 0ᆰ 0@Pၰ  0ჰ84 8H$ 0q 0@Pl<0  0m@@0G$S:X#`###`#`##`##`#`###`#`#`#`#`##`#`#`#`#`#`#`#`#`#`#`#`###`#`#`##82W, (2W 0W ![_`0@0Y @ 0G)^$W *W W^ )^WW @ 0GvW 'X10S 0@0 0  G_0G=S#`#`#`#`##`#`####`#`#`#`#`#`#`#`#`#`#`#`#`#`#`#`#`#`#`#`#`###`#`#`#`#`#`#`#`#`#`#`#`#`#`#`#`#`#`#`#`#`#`#`##`#`###!E-D0u 4Qtڀ4Qo 0xW 0S  [_`0@0 44\ L(4\ 4\O 4\W00CSK 0@0 3\ 3\` 3\  0@0 3\g0C\=3\: ʈ3\0 3\  0@0 `3\: /T3\6 0C\2 +0E$3\ 3\ 3\W603 0CQ2Q 0@0 W0 2\ ^ʜ2\ 2\WW0ST h 0#40#"B L2P82\#2\ 2\ 1\2\ E1\zWx0SR SsT  0#40"!B 0Sh0C\k0C\ T0\t@ 0@0F WDWA0T!Q<D1\ 0\m,1\ 0\f1\ 1\81\ 0\10\ 0\@s 0@09 XT | 0#40#"B $0SQf f@oB@i$wt@m"Bwd gdt,`trtti$i m @t,@ht@~fli@Ni48i8Zc"{t sd !B$DPc'"i !i B)BedAvtgtp- D0 [_`!0@0\ @ 0pp/ -LMDPj S  0(Ko [o0@0] 0@0 ^ ^  0@0 ^? ^ ^p ^s  0@0 ^ ^r $ 0@0 ^  0@0 ^ ^X ^ ^> ^ p `@C, 0p `@*S  0(KoCX7Z 0SS(K0NS^9 ^XZ0S 0SS S0S0 SXZpWE `VC@TXNZX X X Z XZ0SX`Z^0S[ 0SS SU0SRXY.Z Z KZ (ZQX4 X X X XxZ p `@uZ ZZkZXKZIXNZL0SI 0SS SC0S@oXZk Zi Zg Ze Zc Za Z_ Z] Z[ ZY ZW $ZU ZS XXGZKXBZF Z CXFZC0S@0S=5-Z2Z/X ``9p@- D0 X`[0@0 0S S (0p@K 0 R p 0p@@p@- D0 W`[0@0 0S S '0p@% 0 R p 0p@ -MLM6D0S ,$ ,(KQ  RW`p00@ [0@0BKA+P, p[0@0 PW PP` BK@, }GP P`!P &Pk :P Up 0[_`PC 0p[_`@00 , UpVBK@dFP pWXBK@8FPJ[`[0@  0, { P`0@0s!Pʹ0@00  [0@0  0@0k U1 p[_`UpV0  [_`0@0 BK@FP? 0p[_`BK@FP3 P`VsBK@FP'V 0@0K  0@0h 0@0/BK@T FP pWMXKBK@ ZFP BK@FP [0@0( BK@CFP P`[BK@7FPE0A[_` lp!BK@\'FP,T  BK@D FP BK@0FP BK@FP 0Sw0St0[BK@FP BK@EP BK@EP 0S P`=BK@ EFP 0SM0SJu0S0[h99999Į9l9T9Ю9ܮ9999$909@9 -LM0`SpP@ Q@ 0@lp D06D0  %+,0Kv@P0Z7 0S P1  C@P 0 S00 R 0# T 0PS+  D0 [?S  @ +T @ +@//=j/=j///0 , !  !/ -@L 0@c\g0 , !  !/-| !X0"0CX0 R 0 00d  0  ` R0>X!00X1X!R|dg/ -|LX0 0,X0!00 @dd0$@d@X1 P T8@C0( N000K0OЮ#gcl9`9 0- LP1`00@ Qd0`@ T@dAK 0h9#pg -,`L lq'@+0)0|`P0  !$ $ !r%0K`1SBX1S?X1S Lp`1S 0@)0R%.\!R 0Q404040\!R=j`gX0 R 0S P 0S  R/ //$c p-LM@KP`Pp0p R R 80S@0S pp 0-8P@L000h p-8P@L`V  03/ph!@ ph0$#g -@L0pSP` @ FP@ @``   $P "8D ,y#P 0  g##|9t9f8 0-PL @Cl0p 0CRl00p0 0S008 @!00CQ 0hg -L@ "D D00CQ0000S00hNg$c p-PL @l0`S 0 R0@p00p@810@ S00l00l0ph'p8 8R P8  R P@ @0@0 @80S@@00nS 0-PL@ ^x 00@000hT0 R 00aS0 @ 0@0g$cp@-(`@V0P S ^ R D0 T $00Sp0 Sp S V Vp4!4 0S D0 0S Vpf0 $10$1/ 0 /-@0!0Q0""!A0 !!Q0 1$c-10 P P P0  !   !0  "! !  "!10/!@-L!0 .!$ $@.!,0l4!/,10!0cS#3/=j/04 Sl1Б 01<@ 00 @/=j<@ R0@0/ 0S00/@-  3R $0  / 0 0@ 0$@ -`0H0Lp0 , !D D, !@T@T T $0 0  !$ $ ! )0PS @T$0H0S0)0Q$ -pP0 GbL 0@a01 1    (,0W K 01100110@1100110 1 100 1 10110011Q 1! 101 R101 m[Q0  !  !W1011010%0  !    !0 0Q 0 0S 0  !    !0  !    !0  !    !n$cg 0-L0LS@0LP02 L0S0脰9 -0L0@J 0P 茰9 -PLH0`Sp! PD0  0)0@!H0S WL00CSL0LD0   D0    -Lp`PPMWj W0  !D D !.!D *D  !@0TL0H`%WT @T T $0  )0 !$ '$  !)  BRꌿ##h#####W L $0 W0)0ĕ"L00L0:W 5L0 0L0t0 ,0  !D D ! )0S"L00L00g p-0L`P , !$ $@.!Z0l 08#801  Pa0S  HP` ph0S$c -1LMlA @0P40 0r4 00` !! ! !P!0CR80 \!X, T1, 80 YP r$0100  0  !$ $ !L!0 ! 0 , !  ! 1U01 0!10101zP!0R000T1P1X1\14  818  ,0 00  0T`@00 V𨝈06p0 0 -L M@1P @8p^@ K?(KP 0 0 0 mPT (`K lPW  0 41$0 SK?"(( 3 K -L MP0 ER@0`@V U U; T* !1, 0 $ ( 1$  1$00$0 1$00$0 1$0@0$0 U $0,K0$0 0 0 (0 $m@PV@ ,pK l@P @ K 1$00$0  1$0 0$0  -0L)0p0 .!D D@.!PP%!D )D @.! , !$ $ !0 Wh`0@P `T0S <W000 0@@0,tgg -$0`3P0#DLp!0@3PN = @@0  "! !  "!0 1D D + = SN !(2R.,0S>? D 41 R8#8.W0m @` D  D  !0@3P@R 0  !  !GD D8#8.0.B1W) @ D  >P  @0@h0  "! !  "!0 |DM$c9 -LMpPD`R0 An Z @ D5 Az 0  !  !,  0  ! 3 !0  0  !  !.!$ %$  !$00Z00S @T T @T,0Ss )0@S Sd S`n #V (Ko1 Q005; H0QP  !  !(K0 110,0 1,   T1S0T1Dž 41 R 0,0 0  !  !i$3l!R 0S  RFP RB $ 1 P82 (KoY )0S$0 D  `h,p3Y00Sk0P00S`U @0  "! ! !("(0 D0 V* YT 0!!$ 0%$ !! , !$0 3$0!!,0SD ,P` H0S` 0)0Y60  !$ $ !` 12S20 1Ņ$0 j1gP0  "! !  "!k00SH0Se $0b  _ 00#!001 00#!$c=j0g - L lN h Pp-L`Pp@TpU  D0 U@Tp P-L@P h S-pL $1@T P,0SD0 h 0S  P X*@TZR% P@T @T P,0SD0h P X   04 g -LPp`P}PU 0 R Q 0S U U U hl{P@T0P \ 0S U U U @TU @T p-P` UL@0P PQ $1S p= @ @P  0S ppUp ~p@B -(a@LTPp? U𨝈T$T = D @@P  0S  @P $0c P UJt T 0h d0h 0hP @B -0L`P U`TpP@pP` @ P` 0U0T0S t T 0i  0i d0i0$10CS$1/000`<g 0-LP e:0J/@ 80$10g 0-00L$!PR0@0@0 -L M88 0@ $J 0=Ktg#9g -`L00@P" p8 0@#P1 ^1010  !!!0 ! !!0P1K| 1P 0R 10P0$c -$0L@S ?0D  10 P Q$0 0  !$ $ !L1Q1$0  1| 1 !D Q 0D  10 hP0  !$ $ !0 , !$ $, !$0 -LM 00 0K 0 8PPp 4K bg`PF, 42 RpPX 1HL *`Q5 0D  10. P +  @0 & e01 A0 !   ! 0 Q` K g`(K00 U`0Q0  #`V+J 0 ` 0Aᇓ004P/1,pǏp@Xw0SPpPvQ`PqyAɚ;c9;; -0L@TD0  0!!D 0)D !! 0 1  @T/ g -LM@PDA ~`01X\TPaD0  1! 11  (Ko!0 008 @ 04/! 0 , !  ! !00V1 0!10101(K$c p-L`P0Sp@ T0p @T R0000 0 @Tp R0000 0  -pL@` PPW` P 00  00S00@ P0-LPP@@@T: 0P0T 01 R0D00aB배9 0-LM0PS Q@ R  R 0A@S0@ 00SK`  fP  0 B0 00 0@@ 0 @0S0  -0LQp1p!WP4 0 0CW , @ R W`1`!P$0 70S( e\ 0 f0 0 0pf0@ fW0 @  P0S  3f 4e 'f=j -L M@P0 x#0S l3@T ,  0P0S 6P@PTP,P  3Pc c  }#pP 좟  sBP` 0PP) 32C0  2PpWR 0S@ P D"0L"S0\,  h,"R@`K62P P+6, X 000@8 @0$0(@H,0 P0408@<d0Hp0TPp`WX00pC!000(KT 0pW 00 P`P5v, X 000@8 @0$0(@H,0 P0408@<d0Hp0TP?p`W@o\%c ggd%cgh%cg(g:İ9-P  0S 34\^ dQ/0S /0 (=j -@LPp`5T  0R 𨝈UT hsd M-PL0 0S R K P \d -PLM0  0S R P KFd -PL`p @ 0S 38PVPR00SP0 @ (dP00 hc -LMP p, $5U`$,0 SR00 SU0 0S @V  cP00` ,  pc000V R S  DcP` @A cP00ꘐ: -L MP K -L MP K p-PLP`  0S p@U@R00SpP 0 cP00p phc p-PLP`  0S p@U@R00SpP 0 tcP00p phb@-R @Q\ 0@- 0-LMPR@@ KP0T30%K00 p-LMP PQ`&0@S(#@#$# ####l#(# #########t#<# ##20S K3/P 0Kp20S6- 2p2 RxŸ 0`Ÿ 0H2H"@ 0@cFP0 Pk2@FP0 P`10S  <10S-10S-10S- 0V P`1`!à0L  P$10S 1 :0~ 0 0b 6%s 0 6k 0e 0^ h0X$ QggOcgl%ccocigggg(gh%cd%c:cx?j -LMQP@` E 0B@S񟗗#\#\#\#\#\#\#\#\#\#\#\#\#\#\#\#\#\#\#\#\#\#\##\#\#\#\##\#\#\#\##\##\#\#\##\#\#\#\#\#####\##\###\##\##\#\#\#\####0BRS ###l#L#,#|#`###l#T#0#0#0#0#8####8#########l#0###l#l#l#l#d##8###D#l#L####(##0#0#0##0###p#L#0#0#0#0#0#0#0##0##,###0#####0#0#0#0#d##p K 0?p 08p 01p pP 0R0909^ 9R4 p 9pA 0}2pȟ 0p&R88\ 8R 0ptȟ p 0p<ȟ L@j pP00R00S870Bn  #>K0B ,R ( hpvǟ pn 7~pg|ǟ 0p_`ǟ lpWA 0RpLǟ YpDϠ 6-p;Ɵ 0}p3Ɵ 0up+Ɵ 0mp#Ɵ 0p  \6p` <6p #~K >1 000Q@嫌@T0 @pA  0pE K, pP R 0S$2S 0 ,Qp 7pğ p 4p40S0000 00  00KpD@ PpP0S 5-p <4p p|D0(K ( (0p0nß L@; pP00R00S3ZC,K , dpPO,0 CRS0FpDHß 0p<A 0Sp1ß 0sp)Ÿ 0kp!A 0pŸ #pPhl xŸ p\Ÿ p 42 p 28pŸ 00p pA@ pP00CUSp%0S OP`d 0!<l1l! QrUp #NK S_pP. p  0p$~g ga0 T8 hH%cgggMb-cT8p$c ;.c h<h h|g)c(ghh=jcg$;T8t?jL)cigggX$c(cl$c<;(;;@hhT8h-c4;Oc8;Xh4j -L@M0PS( p$ 0B S@$KX`K!o^@P 0@PX00C S #$#,#4##<#D###L#@P -@Ha P (K J^@PP$ @P1( H  a R*V @`````` 0F|@P (0 (K0 A pTK06/@Q  {8*T Q  ^@#T%cii.&$%#1С& 00  R/gH0S/ RC40, 0100 0 H /g00/0 , !  !/-0  ! @, !p3 0-LM@P0 Q PK ]P000 0 ^0 ^0p%c -Pl`LlA @ plH4< 010dp `Hl`  @@=jg 0-@L S 1 1PQ ! 1R 1Q !0)0000y0 0-Q0  S  0RLPlAQ 1| D0a0  !$ $ !0A0 0) 0l=j -LMPp0  ! A !Q ,`K 0r@TK -`L P߽F4 01pPU H0@S  PUiT0H00000 0PE ) Rg -L@Ph -U0L0 u 0@T `@T <0S`<0V<0V0 00c 0-@L xH0PS )0S 0  !$ $ !0h螾? p-@0PLlQ`p`P PQ 0D  10 P  @00  ``p `p=j 0-0QlALP00  !$ $ ! H0S H0S :0 )0 0Q D0 10 P HP0=j -\ Ll$0K 0  !$ $ !#LQ =jQ/0lLa =j p-LM`\P0 R 㻼0@Kp(@K0 0zjPAP00U00SOch$oc -LMD `X@ p@ V0<0 E 8 Kq@P08KTg Q OPL R @<@P#@(K00@TP c ZSp!0h!OS"AJ`ZyD <@<@PP ,K E[P,0S@ D 0<0 D <0S xD0|<x 0t E@tD 0@<0U 00R  0@k ;;c29 -L M0@SpP (`K [P K`I -LMP\pP 0`  ֽL @ K߽`0@K: 孻ẽn`E @ ܼ0t03V0S@᷽Och$oc 0/c0@-,P@@40T @0S0%c0@-,P@@(0T @0S0%c0 /%c -X0X@0LSL }?’D0?< A3c 0 0 ;t%cMbcp@-RRP` ڔP`0Q @0p$0@p rP`<0Q*0P`Q 0Qgt%cx@-P,0$\ $0(@t%c -L(M@Pp Pp 00@PT x0H`K  d 5 ;+ @D0T  0  @d(K%c:9@/: -L(MĐHKP@`p D+  0PP (K*P X0@T @T *P@Pt%c%c-Q00CS$$$$- L0 80q0 0 ^cc -"LMp`D@ @0<0 @`+)@匒P0l^@`  @   1 P` A$ 0@ V 0$@ 8K0K00@R00 ,@  8PK`U0 0@0@Q08PK`@P`8P 4` P`8P 4` (0@cT@PTP@DT8PK`(P,`,P50@8PK`4P8`,P`5<@0Ā^@  0OO$[P`% H FX%`q-(`< @P0L 0 @P@08 0 0(K%ct%cc@Bʚ;x%c%c$$ 00S0/008cc 0-0@SL  021C 0`0Q U! 0 0@ R0P0R0 :@0 0R0 0R0000 $B4?4;%ct%c09 9@-HpDP@0$ 5^0`@0 @0S%cʚ;@-HpDP@0$ 5^0`@0 @0S%c@B -LM @0,0 @ P`p0 c5F$0@X0 @  , R @0SW0@ %c -LT0; DKPPpK8 PP4V4eO8KjD @0 <0S ឫ'D0K8PK`< 0P `QDP @` < 0P@`=9ADP @` =C<0 0$K0<号N @ p0?B(c -LM 8 "P&Y  4Ky% 002 `p04` 0p t P, #4K  TPZ 8P (K 4K =TPXP400,0%"O04@`00@=)@ -40 0@ , g@B -LM@pTP $`K0P K T0PU0 0P$@K S0P0 p-L M`U $@K $ bTPV   ZTKp; -L$ -@L-h)`>$(c(c -LMx`lQ@pp'!$ $p p'!`0!!$ 0 $ !!=j -LM 0P A0pK 0l , !$ $, !@0pK `P $(0  ~ `P@y0@C@a 0 X0l , !$ $, !T Q $=j@$00/0/// -@0L3/hgl9 p-@RL`P Y PpphJ -Lˁ -L@P@0T! 0 |0S0# Q !|D0S 000/=j0g\ 0C  !L !!(0)0|Kl0S|0 S|(l D0 !R 55030505蠲9=j0g T*p 0!R30,00Q0S Q0!R 0S S0 R 0Sʵ! ٽ8$4$0$($$0T  $ 999Գ9p9D9<9L9 -PQL 0 Qp0S`0S 0C8S 08J@08 J 5RZ 8/08Z `0SE; -0LS@`p80S)0S  3/0PS-0U 0S P  ePp0S iZ00S0hi$0\#0S D#p0  ##)c99<9Դ99 -QLM0P0 4 ,0 (  0 Qp0 $ R 0  `0S 0C8S  08J@ 5R 08Z `0S`0 R , R $0DS 000D#,K4Kd;#;)c99 -LMr@c0S 1 Z0S00?X] 0 QP @V ` 0,0 Q0S00P t@@00 PRXJ D "Y  9/$!0S  0S V 8CR0S00 S00 0S ,0 t00CS0T'P(K!P 8CR00"g)ct9g(9;9 -@PL` pP  0hZV6/ 0")c0: -LM08`, J|pP4 ( 0 $ 08JE00C8S0P4K08Z,K ;; p-`@L PP  0phB"p49820P#/! 00"8Q#(/p@-(0 S<3(057<@ @00@09780<S"p; @@0@008<<7P`@ +7P`@ :00;@0$TP7pE-`p0S S \^V P00@ @Q u00 0 0S`Ru00 0 -LM80PSD`= tpX98Y (@Ġ 00 ,0 s 00 ;@ 00<(K )rP020P`00 @$"X W Y 4POT 8SD4K80XW0  0 /(gg gQ S 8Q20 R  \  \ | 0 0/0|  /| 0!|  R  R | 00/010|  00/01| 0  0| 0/< P/0S/ 0 S/P/}c -LMP@P`p0( P@ P`p $Kcx9 - Lp3 0-LM@KP K0 -L#P<0 R 0P 0P R'g -LMp/`P@,P (KWP=; c0K   00B0 S=?( K Q02\0A0@T (0 0 S @ =P) @TX \ 00  P0.Sa0I0Sa0B0SW0BXg<9:9 -L MPp`+ ((0"4#220 $04 D,KⲒP 0 @(K, l1ߥPl ,0MP 0t ` ,l1 ٥,*0<  l1,ʥ, p갵9=jedA9Ե9 p-LM(PK |PKp(0[S  00C0 S00•0S@`Q @@Q &P10}c 0-0L~M@Kx Kd0kPP0^K0 @@0@0  K0XS QD0 Q<0 Q 0,03/K0K I 묧cH"l-D9ħ,0:(9 -PQL`. 00S`S%p0@T@T 0S (P00SxP020$ 0440apCWPE@g -L@P T7P0@T @T 0S$)@T$t9g9-: -LMpx`0  P@T $0s (0h @TU $1Pl RP 200''00000SЇh 0#4PP0 7@PK$88@#D0a'$B ,0KN@P VPPpT00S 0S V 0Sq 0S\ (K R 0S(0 @ &P0&0T0U0SV@T@T 8@P (0 `$0s0SZ @pPP000  " 40 $ 020$ 040 0 夥5 00aP5 0NW 0S  \|" 0#(("#4@!| ,40T,((0 "4#Q r  ؤ0R4  꼤p 4 "88 #$0a0""p X4 `"88 #$0a0""@GpK4V (0Sx  @gPg2HP 0u03V0STU(0K@E0^*S@ ,K0 PP 0S$ `X3\T#  L0 Ƣ@g|gP X,0S] S7 ,0@"x刢0VPPp0,K 0N@PwP  6PaHs 00K+P 0,S0 0\ ,@0 [@T@T $0s (0K@TlF? P , ((0"4#220 $ 04ă\0 l 0 "1KPpW (0 P @X5P @VPP,@ 0 k|g ggħcgcĘ9 9;9cc9ph$\9l9-:999.:9ж9:9ܶ9:999P99(㢷 0-P@L,00S,0 0hd -0LMp80 < ,00Cs,0a 4K4PK`d0,l PU`QMJx0pL1 Ppt x0@ =9@pt =Cx0d0Y*<0S /PP`P`80 0@80<@PPT`8団 *Ys(K /HP`P`00 0@004@HPL`@0 0@@0D@0=@P` M?B|9 -鰀L0`S Pp@0@S 0PSp0SP`p@00@S 0PS  06  00ncDPcncZc -|0L0@S 3/e/㸵 LR 0@00  0 $0 BR g(gg g9 -L~M@ 㖵(0 0 (0YEKd0K$t KP(00 Kr(00(0 -,@LP(00(0踷9 p-(0LP`E e 㙵PA X00  0@P 0 V P@$ ` P 020$ 044$0$0s  k@XP L0@00Sp3/p-g(g gw$f8g9 -LMPD 8|8#@<"p 4 `0 ,  "2,0 00"  24  @0 a0,*\< 0S!  0@  i0 0D cD0I  Y4  0LS@0!*P: 0E40R\!: d0 R00S,0R0#03P0S<08  , 8 0 00j0 @R , q 3P R] v @000@0!Pb (K@4< E>* W?: R e 00 R0S8,0R0#03P0S<08  , 8 0 0@ 0  i0 0D cD0I 0Y40\@ * W %0 :4 S R!*0 80@< @ <0@4@< 8 0 , @#40 8 , `9A-(p@p,@ P$`(p,A -LMpP`@P    0  K -LM` QPp@:0A @T;P  \@  T=: U 0  T: 0U Q ,  0 U: 0S)P0pe000 0P T T0S*@B0ep0 R000 g `#`9 0- LRP00 @P @T0@E00 0h蹪 -LMAPU^, p`C ZQ  6,0FS@0$P(` 0@ F,@ ,0 0 BS0 0R 0 0 ,0p0  0000 0 (KPP- p 0S00P0P00   0Z0 0    ኪP ,0@p @Z  <@c9,g P00/g - L dP 00  0 0 ga0? -L8MB`P 00 0_ R@1@#\0 .PK CT .0[<Sr "80KP@pX0 0U8 4` Tp D@ @p < P L0 H`  X K 0L2 R0 00CS 0_ (K.PK O4P 1 R X@K Y180 80K X0 0@P0 L@ @p H 4 Tp Dp < rYL1 R9@1P@T P5 V P@ P YH0@0CTH0 \, YT- [00B0 S  00B0 S Qzl0 巍>Rr0S`cm ᣩ P83P  \g@c9Dc -L@L R 00CS 0 $0$ 儍ggg p-DPL` 㛔 00bO 0$@ @@T@ϕp -@L ㈔4 R00 0S00h踕g -1Ls@000 @00 D0i 00@壕,)cgg 0- 0LS@P0 T0  R 0 QP R00 0S 0h|0 S000000a0 p-1LMQPL t1Q! l1Q d1Q` `p 1Q+ @1Q81`  p0`00(00  p㤭`P KQ`P@ R 00CS 0 00` 0 @a%T0` @@pPL H 00``0000p嫌}flvt~fwt@ggg -p0L R`@x0 D@00000 Y0ggg p- L@`ᚓA@P <0 S ϔp1Ȕ@pgg Qp-L@p`0 PAR  x0 0 PR0 R H0 p 0S0SU RUga0g -\1LHM p@PG`4\,,! 0Cj`P s K000^0^`@KA 0  ?P1?#`P`\  0Sb 0b Q@1 @!T `P0Q 0Q`#`gg9:99 -LLMp^` 0^P0`@K@ 0P ?P 1? #0KPDP0 00 Kcc:990@-P@ R( 0S%\ ) \ ^ \@ 0 0\0 S 0  0S R 0 000@ 0 0  R P,  R/ 0\ 00 S 0  0S0S 0P@ 0S@@0  @0@ 0 0 0S00S0@ 0\@@  @0@- R 0S^ 0Sk0 0R 0SI0SD \  R0 0 \0S0  0S R( ^ 0Sm R 0S 0R 00 S00 S0 0S    R00 000 0 \0S0  0SR 0S@0T 00 S @0  0 S 0R 00 S00 S0 0S    R0 R 0SP0U 00 S P0@  0 S@ y -LXp5 PU?P0S`X`V  0S@ W`RP 0WPP 0RPPV 00SZ  `X `V 0S` -@LP ((0S 5:\ R0P 0 \:0 0/P/((0S005:SP//P/( (0Q 0#03SP// P 0S/0S/P/0S/P/0S / P 0S/0S/P/0S/P/0S /P/Q00S/Q00S/00 / -(0@S0(0 L 0x R P, RQ000(0 0 , R 0S00CS0,Q R000 00 ,Q 0-L8MP@xP\00S 000$0  R00# 00$0$@ QA$P Q& L0 80C PL0 @T |1|!0t!040aSHᰎ0S @὎;᥎K00001Q 004 0$00  0'lLK$@ P# (0X 0T:d Q00000$00$ $$ d d )c;g9g8|9 0-L M 0@02P 00#^ 0#^002(3x0S K0,K0hDd (0P4g9g8 p-L?0`@T! @T 40RP 40R PU |0| t0 40 c R  @T#0%<phD)c<)c)c;gt)c p-LMP0 K 0  @T < 40`Rp00 V @@ @ <04 S`H0@ 00bS*᳍ P R0000  0 M PKp -4L⸡,0@T  @ThD)c<)c p-`PL@ᖍ00  0@@ phv 0-PL僡 00CQ0' Q U  0S冡@T0jR@T0 0S 0 008n@T0 0S0d@T0D)c,g<)c 0-@hLP(0h$ -L MR0  04 0  80 0 00BQ0V800S@ 8 0Sʠ0l,0 < V< 0f8S8pLpZpj < 0< 0 0 $80,, @\ 40@d08 0` 000 P00WX 0@@ @(@<@0@4@xpH@L@|@@@l@ 00fp0JV th @@@@@@@`Q孌᪌,0^@0# 8180巠0000T0 R? !0S 0 00000(Ko跠8pL < V< 80R D1 Sʠ\: \l 0l8 ,0 c\ \0 8 l, [8 @0ʠ8 ,0 U004g8D)c0g<)c,g9P)c\)ch)c9g8- \ 0Q|  @ 0Jg -L MtptP`@F ` 0 04 `V pPKcg98 0P \/|  @ 0g -1pPP0 ` U00SL@ 00S@P`0U00PWP$A WW V0 RUh0\0 R P0R PV  0U00h@c)cgg -RL\M !|  x pD D p h PH p%PP00mPu `0  @p d0 \ X0 l pp l 0AZS_$T$T$$T$T$T$T$T$T$$X$T$$$T$$$$$$$$$$$T$T$T$T$T$T$T$T$T$T$$T$T$T$T$T$T$T$T$T$T$$T$T$T$T$T$$T$T$X$T$T$T$T$T$T$T$T$T$,$$$T$T$T$$$T$T$l$T$$$$$T$$$$T$T$$T$@$p0Z0p0  D@W00 S} | z(K>| rd  d d0  `0X0  \@T \00dQ00(Kd h  R^ (0K2h0 5:Ra x ~pM\`Ph@ X0U  SL  L d@LL dt `L @bTZ D W00 S 00 |  @DTXQ Z  D W00 SX@@ |0  tP @eTZ DW00 S000 |   @Ddd d  ] 00` X d00d0 d  `Vz-@Pu`X@ u` @ b` p0dd dYd  Vd0@S 0@8CXo@1A h>0 ` l@Ph d(Kl 0Rh@h0000d( K(Kch@  d\`P\d1d .d @+ 0@8#X`@+dd d@ 0@8#X`@lP P?Kh LP ?K`@X` 9X Rp0p X p d00d0 {0\` p@rd) H `d 00d 0 d   X X0 pdd Up0+X Pp0lPdd p0 d d D@@0p d0 0d0 ;0\h0 h8\Q@h  \ QP h \0PbU\PL L őd0 m T P  `  0S S S`P@T0?K0(@+@?D Ru Zg D W00 S  | i @0P? K@h LP ?0K\pd @ d 0d ǟ@xX P` H d @l ]d\ǟ H bd d0 d@ 0@8#X`@Up d00d0 l00Lp!0000L Qp l `0 p*P 0@ \l \ p00P!0l 00A 0 \?\0 p 0@P`@0@Po@0@P`@ | @DAD@W00 S |  hh PU):h0Z| `L @bT:Z D W00 S000 |  @D0| @D%0| @Dd ` L0@cTZ D W00 S 00 |  @DTP | @Dd Z[ DW00 SF |  X| V U) Kh %(0Kh0 H  %2h >&BbP`h (0Kb1(@K 0U0 0dUQP` @Dh@ h (K00b0 P0@P`@]000D0S  Rl |@ . | 0Bl| =d d  d@ 0 8#8@T0 P@ 0 T P }|  @xQ pT0P@0w `Pj  P@ l@2A \@QTK<@00` !0@0^S!0@0^S^<,Z9 DW00 S |   !0@0^SD@W00 S |  !0@0^SZ| hUPL \P?L0 P@T0?K @I| PT0?K =^ Z DW00 S>00 | {p 0?@\0 p `9 9D9<9L9499 -L@MQ  K" 0( K 0 K(0 --0 L M0CQ0  0( K  K0 K( 0 0-LM@TPM 0P40@ R -0U(0)ch --LMP0 0 e,0@ R K5)ch -@L: -L: --LM 0 7 K --\0LMl!D0 41 Q @@ 41  0@K=j 0-LM@< +PK0@ U+[P @ P> K0.: -p-LM `各 0@PP Pą00 R0PP Kpg -p-LM@ `mP 0@@ @ៅ,0 R0@@ Kpg |9 --xpLM0PSd0 P `AO L&P 8 0,@ 0@Lh)c9-:&c -@0 L$ 00CS똺9)c9 -LM  0Ժ9@-0V0S  c1#88 0S$H($($4$D$D$4QT"(1 T0`!10 0 0c0C1 0S/0cd0[:i0h0h0h0 @dC"Qp0 Lz@@u8r)c;)c ; ;9 ;9t9Ⱦ99h999 -LM40p,S0 @h, 0' 00 @(r 0 P (r @BVW 0Rq,eQ sQ dQ ,-Y h00T 0 SX@@A)c)c; ;9 p-LM0P S S` S S S S 0 S S S S S STp@K!P @ {p0 S S p 9̻9 -LM R R00P R R P R R  08 R R# R R R R  P R 0S@8@!Cx`0 08#h(0BHTQP0  8P#800 08#h(0BHT0 8CHt Qs (K,`K!MPs eb)c;̻9,9 -<3L M `RB$SP93 P8CxnTNT @B@P 04 cP00 004 =Hv)c)c ;@9-: ;9 ;9t9; ;;`99h9t9P9 -L8cY(Cx02B  $"0`S/ @P 0PS( 0P0  PW WV W0S (B(00R0S xPc0ISF%%%%PQ0SD@0@S VPWc0ISD%,%%%cY0   0@00+|00SS P@~)c; ; ;9)c9 -LM`p (@0 S SPP S@S(K,K!P0, R ڜ?P QPqP |2p 0 P,00aZ<f 0ȿ9 h)ct9̻9;п9 -L0MȠLK8 LȠ`CxT #3 Q W ß0SأP @$0 @S P0  $0PPS @U ,PKpa 0Pk,@t H# T0(i PKtKW,0sq aT,",p RP 2"PP@ PE U @D2 |B@T`Ÿ 8C8s S<2 P(2\ 8C8s S1 PP!001 R$ @p 0S# 0P0  P0S S0WpT(KH@,@P0S @P 0S 0aP0  P0S S0UP p0@S 0S 0BP0  P0S S1pTA)c)c;T9x9;; ; ;4999 -LM0 S SPpp0 S S P S S S S  ` S S `0 S SPᄆ0S @@0S P [P@0S@ T T`` TPz1 0 L B*R%%%%%%%%%%%%%%%%%%%%%%8%%%%,%%h%%%%x%%%%%%%%%%%0 S 0` 0$KT ,K!P, 40 T ,K& K(0K@P,"[2[?0@ T ,K!Pt,  RR@@ R{P40 Tk ,`K!@P,D0@ Tb ,`K@P,d 0@ TT ,`Kq@P,e y0@ TB ,`K![@P,@0@ 000 T*0@ q$4000 T? C ^000 zß#00s03S0P000 lK000 gT0@ bA000 ]<0@ Y80@ U`20@ O.0@ Kt*0@ GQ000 B,`K!P0S ,0A0 0B0 RS 0B0 RS Rt R R R !P,00& K(0K@Pf"[2[,k0@ !@P,0@ !@P#,0@ & K(0K@Pc"[2[,G0@ & K(0K@Pre"[2[,70@ & K(0K@Pbd"[2[,'0@ )c9)c)c;09)cL99:P9l9̻999999 -LHX><(4P(P K>ht99h9///N/-// 21C/DPc 32C/Zcd0 $\/H0 \<0 | (0("404 /nc ocnc-0 $ Rl0\`0S  Q 1S0Ġ 8 8#$ $ nc ocnc/E/// -LP@p`PV `P@ -LMR,0 pP ' `0S` VP 0 S00űpq@P 0 0 00 0 00CS 0q,0 -LXM`Hğ0@0P!Pt x0 :R`Kl  0P ` Kl 1tl p0 Ph Z 0l 10 ("( P  0x0Sd0 p 4K@40Kx, 8#pQd 1#e(0@p6,d 0S d$| "0P  !$ @$ !0l Q0SHx R 4K4KQh X0a 00S7,0d Wc\@ < 8 e<0SY1! /x$0@@ !0S ey0  !| @ !!F 0Dh Nyh R 0  !| @ !h #R r2 Rt lh l P p 儌h(KW0R,0dP00Ӕ@ 0R@K,n0| @ @ < 8 0h0 tlPh l 0h0 P$;ɚ; h;Q9 hʚ; -LM0@S`p 0PK P K޿P P $PK P0p -LMq0 Qd0_BSeo0F$Hp/Q 7G$0P ,` (0 00K$KMb@B 0-,PLP@0PP0oP H 0R0000 h 0-@L yP008#ȠS0PP00 *wH 0@R" $0@ 0  !$ @$ !0hQx`` 0 00D \*0PP00)0S , h h -L M< @ D H 0 , 0 DH00Z8 40 782a070`0PpC @@# Z!PoPP . 0,0  0 P  <040 !<0 0! ! 00CS 0o Z,0  ^, 0 <0 (Kg8 -QL`MPt x |0 @c0t P0BZt [X@K L0KHKDK@ T`KPpK`0 d h x R   @P|0SU  z@PO 0  !$ @$ !t@ #T Tx0S ` P@ |\ d  P@P h P@ Y ! B (K  0x 0 0h X K ` p`0 d \  !@PP\ `p 4Kⰼ40K , `x"pQ\ 13e8\0 \0@`6̌p\ P Ҥ l 20p0 0  !$ @$ ! ` t0@Pd0S` R! 4Km4KVE W0> 00SO,0\ Vc\@ < 8 B<0S6(1(!l u$0@ p 0S v@J0  !$ @$ !F l0嫸@vT V0W,0\\00ӷ@ H0R@Kkl 04 @ @ < 8 ɚ; h;Q9 hʚ; -L M0@S`p 0PK XP K}PP $PK GPA p -L(M0@S`p 4PK -P KoP,04K#!B ( $ ! (K pb -LlM@Qp1 0 P  T  Tf 00CS 0 m (KT 0PK0  P< 0TpHP D@ 0 4 ,0 8 p8p 0S4W10p8p 0S+W) RP0  H KP80c(P`pǏP @0`0@(P,`@0D@00S  #80W pP PP #P -LM`@Pp lP  0 0 0P p_K -LMpP` l@P  $0 ( 0 0 0@(0KP@ = K -LM@p `lPP " 0S 0   PfLP 0( 0$@( ,04 ,00@4 80@ 80<@@ 0  0  - @`AL0LHPp  0SL0 p0u03R0SL0 pWQL0@0L0L0 p p 0 0b Sp!L0@0L0 -L0L@@  SsL0D00PhF@0L0L0蠆 0-@PL0L0P 0RL0 2L0 0L00T P0SHPU L00L00H0& 0h(9 h - 0@ @@L - @LPP2P0p0P0PL R*L0FPWB00dL  L !PPPP P00CSP0< X1RL0E 00b S=* 0R !0aR`1`! PP80 00S0P%0fSPP0pPU ǴP00CSP00L0ᚲL0  00L0ᒲ 00b S:-0L0ᅲ #Pn09T p-PL@PL L0.`P pz00`0 P00  p\88(8(c - 0LHPU L0P00P0 Zn P L   Zpp@bT0#02S .`PA 00cS$*Ly  0@bS00STv0@L 0 L "`PL0Z0 T@!pbW` >`P00W0#02SoVZ P00CSP0+ Q2 L0[V,Q A0S 0 S0S`PQ P00CSP0L0  (0L0±L0  (0L0ằQ0S V` P0 `0CSP0 `0L0ᣱ ݨ`Vp0 0S00g 0%0|@0L0ᇱg ¨``#`P000b%89 h p-@PL@ ?P@L@H@`P 8@|, 00D0p蠆 -LMP@ p"`@P@P (K, < ,K8 Kn@PO0 , S,0 ,0\! `,0 0K4 Kn@P400㸐0 0000 0 10 8 0004 000HH`, $00$0, 00CS 0' 0 $00$00 00CS 0 8K@ (@P <Ƅ8%g,g`<弄8n4n0Ug,Qg h*c 80S /j g -@ LP W"0 0 -LM `Ppl |90  P0S T00 0@0000   0K$ -L @P&nA`p L0SI 0SF ` `  H0S& `V$Fo000 s@~fs}ff@s@ -LM  0$ K -L M  0" K -0LS 3/0s0s S//-p0`0B!`R?R? 8#L0 0CRdR0d08#8>gfff-\  )0h SS\0  / h hR  Rx0x0'' Q Qx0x088 R/Aⷴ -0@L1  00 ( 00Qp00  (00H >1>1>1t00  |0S0 0 0l0$0(Q h h p-QL M@`@00CSI%I%I%I%I%000 P圧@Kp-@p0h0`0K KL0 20? @  h h h h h 0->PL U@:h0h `(h \Hh Xh00 \ @0H0 0@ȹ0 U;h00U:h0 h hTL% 0-LP 0N?P0.8CR0 -@L`^kVpH l10RUV hp t0`0t00H0U l10 XH m m=j;@9 0-@Lkt0P0t00hl p-LM@kP`H0St0t0# 0  0S 3/H0St t  0  0S 0t0H 0uPP lp*c p-`DLp 40l#"B PskH L00bO 0$@H >RPPӦlp1P91pZc 0-@DLp0 40#P"B PLk R00 0S000h}lZc 0-@DLp0 40#P"B P+k R00 0S000h\lZc 4 0p-#Ll"B @`!r rD0P@0pD`k00@>lp0P@0Zc*c+c -LDMP(Kl3"1L3"1  000c(0S |P @T ,Kp`@T 0KV P 0 ,0R:, p@`TD0l<0<K 0H K,`^4h2h0S40 <0K 0@@<0 8@ 4 @ 20S@0 iQr )0h SSP, Q )0h SS\0 H P ,0R:h0P,0 Q)0Sㄡ S| dt1Zl1l4<1@+%<> ,0ϠC/@nDlb  <@K00H@K0 @P` ZNP0 ~0 ,0Rzk:D0huP,0R:$0 hH0K 0@H0 D@ @ T2H.<*$jQL9@KLɚ;@ĸ999'k_k99\9x9 -@Lt0 | +hB -.H0LS@t0h0t0H0- -t0L@@0  P HWPt0@0t000S3/Pt0@0t0 - L X_ X X X - X00"# 0@d 0 d HPT#0?0S tW%U%W%U%W%U%lW%0r8#(.a0HS H0 `0HSs(X%W%W%W%W%W%W%W%W%W%W%W%W%W%W%W%W%W%W%W%W%W%W%W%W%W%W% X%X%0X%X% 0 .0Pc0>V0 H>{  0@d 0 d  H P 0>eHb 08#(08,!#8 Q0A8#(}zA0H\XSNP 0@d \ d Hp Pj ;^P!P(P'P)X)P0 l 0@d 0 d  LHN PH>SB > hg8: p-LP@ht0`   U nip0 ip 0-t0L   % P"20#0 P0S0 0@@T 0h@T00 P0S P ^T @^? -LMPP  Oh(`$pK @P $ @P` @P $ @Pt0:t0ii0>0> p-`QL@pPd aP]Up -LM2@0 SP50 ^ B?@0CS+1 ? R  t0 ! X0N>O2n @ :t0\ 8CRgt0 :t0>%`(pKⰎ >} PP ( M PP0t 5*0t h.8C8Ac Q.PPQJPUZg89 -LM0pP,2 8" `4r 0r wgt @ 0  82$$$4M0 h02S 42S K0(Kh#0l4 R VQӽ 0H0S8V` V(ڠ\#?0@ @V; .H j .` . 0O0@d P d `l pʨ0H0XVQӄ 0H0XgH0@X8"xt0p"0t0h2HN8P0`FpH0XfH0@Xha Qp1|#K  fP0 p!`04"R S4"  10S  p0R p>SW pѥ0B @Q Q Q P1LW pmD \ |0PY 0V @T00!P1FM0S-  ɛ 0@rP0 &&%g42S,"Q#0 g 0" g# 0" 4K 0" *c=jg8 h*c gt?jg*c -*c p-L@PIf` (Q+Q%t0 >;.t0.]6phpgp0t#40#"Bp0t HQHP p0 (- Q HP& Zc Q-L@ t00t0t0 0t0 0) P P 㒙 -Lt@  0R'0 t0! 0)P P nxQ  p0̌#40#"BH0t 0t0.hy h h -| @0S00L>0 Q>|  00CS0 tRt@c`g -`pLp60 㨀e@Qf  0@D  D 9@P ✠% !,t 00S s PWP|@ q 20P<j t zRxW  a @h0(PTg ?R\(0Sڜ0  P HJ Pt0@t0 0S 3/Pt@tt  p [ t|  0S- 0S  0S 0SI 0SW~ X3| 㶙t p 0@$  $ i0 t@0  th0@t t    0R50,50t o pG0 #Y!   A0GS p0S P 0S 0SM @T T   *t@(0 h0S&  .H0SXtp  0S 0SWt W W@ p p(0 S|PPyPY T 0S 0S 0S >08#8S>>>t  ^>0SpSn l >(B8CS@1@#Td@DT]0p  x t  (Wt{pp !W|pl 'W`pi -W XH0|S W 050;5(0 0S050,| 㯘tWtW   ^tɌt z Tx 0>(!PxW 0S -4tWW9 tl 0W6tW   >Rs kQe0>t>tW  |@ P0 P p p P P 0 @Pp0 P P W 0@0S ttt/* W   {t}\Wˌtx?op0̌#40#"B0t )W}p ^W~p % R @0SG&| ڗz h h hg8Zc p-LM4`K@P0t2Ɍ0tY Pt09t0Kp -4LMl1P40 p0 < @ 8p ,p 㨠fb@Zc0 4 0S\ Yb@x4$,$?Aas  R0S Rj8P ,\,0 8 0_t 0  @0#P30#pbc8\ 80#p  0S00SW#W00o㨠p b@ kCc0 4 0S00D |0P 000!4 1@@0S  |"2@pPt =(0S(Ÿc` _@P%0T: 0TT X<pP< 0S X` T 0T 0T 0T  T` ah1@/ b\)b8P 8 2v(KT =  S| ĖV  !1jpP 0RBʡ#W  \ 0%=0S8P+ =v 8 88 0R,0 80pb#ppbp=j;gfff*c*cg*cT% -0L@  (0 P0S0(   p-PDLp# 40#"B `a@ $Kb0  $0Spt0191p191pp 0SpZc 40 -LàLP@`Ap&0`  VW bt0`.H0S` fa _ tPʤ0  `t0`Zc -LxMP0 U`' J:U# :U 0U :U  F:U j:U :U 0Un :U' p(K:0S4 0 S D |0^ @001F0S *:@9pP 9U'9U 9U9UR @0CU 9UX 0U4`t @  5,0t dap0CU*0CU<9Ut 8U :80S`9 0S$0S@ap8UI p8U 8U 8UwH0p0t_t @p0,#40àLl8t  P Hh0S Z t0(0(SpS PKc@ 0P@A0x0 t@ ^@pPA pb(!0p`ppapZKW/7Up X7U((1 R 0A 41 R~D0{ l0D'20 p$7U 7U l0p0Q0CUU 0Ux_t0p;t0`\6U? 0Uv41 Q-D0* Pp 0Qp| pH&0Zp pp  &p41 R_ xP|pPp , p 6p ip%_t0p;t0_`@  P  | Ip@5@ p`Tp#*l0S _l0T20   pP   l0 (`npP f41 @T0S Rz\ 00CS0 4! 0004! 004!| 41 0 !D 0 D  !p841 QuD0r 0p ,*^x08x0 @8x0  x07x00@x08x00 x07x0d^0St0t000t0t0Y~^A? _pt^@ 1_p(0Se0S  3/pPyt  0    00C 0 00003!0 !00l # B,0 000-0S 0x 0 QR BP0R 0P R00c!0R#<0,c-H0P R 00c!0R#<0,c p-@L]`Q@# 0 R00B0C 0 0 0A00P0Q  00b0<^,00\00S0 0@(^p 0-@LP\0S US 0S\ a aR QPb0bU00S0 00h]000 0 -@L`\p^P V  0 PbU0Pb] 0 b PP 0eS0 1S00PS0eS0 0PS] p-@Ln\0`SP!  0P0Q  00b0<^,00\00 0S00000CS00 0]p -PL`;\V@.Q@*pQ% 0S a0 aR@@  L P 0ax0 0S00`dd0Vp@hQ  A] -@LP Q> pP 0SBD0 S B! >}p000 p-@`LP >pV`0 0 0P  pUB> p -pQLP@p1[ Q( Q* `0Q! 0P ` `0RPP x`P  0a 0 0S 00pe 0W\ R 0   p-LP@l[ `R4 R0S) 0 0 0P \  a 0 10 0 P000  0\p0 #0 00  V0q\p -LMp([0S" 0S 0R Z\p$K@@KP@K $Km=\00l! D0 41 P K\/=j@-D0@ 41 0S  0@%\@ p-LM`PD 4 @T Q Q0 S 0  !D D !Kp`[at -Pp LD0` 41 @T  8] 0[`\` -Pp LD0` 41 @T  8r] 0[`\` p- PD0L` 41 @T  8Q] 0 [`\p`p , P/0S/ P/X,c -L@PP*0S( BT4P: P0-LP@0P QT 4Q08C(R0S0T0SR\ 0 -h0LPpU`@T * \4@0 Z0 0-PL@IZ 00h.Z 0-LP00V Z V W@3=j! -P@L0S 3/ -LDM9P@@09P pL`dKD dD ᲼2[0980|0M0 00S H3/ K p-LMQ@P ` Q Q KpT $ 0l 0=j p-LM@`FL0P8#( x00 0 0 5@ T0 l 0@hMKp  =j9 -LQ@00S xPgh)h p-LMPK0`BP- 0K @S 0 0("8B?BS 0( 41 6F ! @P 0S 1l  0T@0,00LKp!@T @T  @TP0 l 0S@P E;,9=j49 -LMSX1lq0 @ e`VK 0SH 8CT)@ (K=`oK , 圼P0 0$ 尀 e P00(1   ( 0 ((,@p@ `@P 000,yL,vL00P+@=jh -<@ ML4  0P KhhX9 -QL00S;DD0p:0gHW   , 101G0@:00 @0S&LH'p`0+aX@1@!`dL>H9p#p9H7H p3H#p=jh@-<0  0 `0aR  $  1@91# 3S @ 0 00  80@S @0@ ?SR40S0 000/R33    00330(0 (, 0 /Q 0\ / 0\30C3(Q,0,0,00(, 000 /30C3Q P0 \540 R 0 Q00/0/-c0@-0PPL@ 1NT: PL31CPhP%: 2T0TD P0L20P000P00 hQ8 hc P-LP7 -LQ@ 00 0  c 1SS 00b00,C 1T00c0P0S0$0 0 -L P U`ppP U+1@ @   ᬴ 0 Pp`9 p-@LP`P`UPA QC0Pa0a0!RR 00b00,C 1T00c0jUP` R$  p1SS 00b00,C 1T00c0OP 0S ` R$  p0S$ pV ` 0e  000e0!RR00e09 -0LS@0S -L@000 -PL@`pP7PP 7h0 S0h00pS;0S\` p-`RL@PQ 0RU  0 R 0 `0aR RpP0S0  0 1SS 0001T00S 0 00!RR 0001T000$0S`` $`pz9 -@QLPp1 `0VXR 0SY !1RK WQ 1 V&@ @ 0p00!RR 0000!T000!0 !@TXW/ 101V!1R0 P 00 0 0  1SS0 00$0S0$0&@@W 0i>9Q-Q  1S. S' 000!RR 0000, 1T00000 0R$0Q ! !101 UQ RQ/ 000!RR 0000, 1T000$0S$0Q0 ! !101 $ -L @0$0Q/$ R 10S $ p-LP@C`(< 0<0 E0 p< phjy 0<0D0 p4IY -4L@  Q@4YYP#<00@<0 4Fņ90 00000 -0@0>L06Ӆh -0@080L06ąh -L MP L32C0bC^ (K a3#0Sʐ ~P 0@0 40  8 000WT400  0%000 00 ,K 4 0 *{pP,00  04 , 0 000$00$00  00CS 0 8000T86037 T00,4 K006*c~f -LMP I p0 < 4K3`P (K 8K0)`P 4P , S,KD K|=`P 8P S, 8#H@,0 ,0䁟4 ,00K @ Kb=`PL00@0 0000800 <   D 000@ 00048N`P(00S DK  `P<0 4, $00$0, 00CS 0& 0 $00$00 00CS 0 S84%`P @506080 D5,6040 06,6,@, 0080, 00,0! ,0@ PD PP00R00S(U Q4p4,5R@ #P5P,08 K0, $00$0, 00CS 0 40 000@,4 V9*c~f9 -LM 9@0 @K -LMP0  ʠ K p-LM@ K`WPP p0  P 00CS 0C4p -LMP Kp:@P K 0 `  0`@P  00CS 0  4 $K0/@P$ @$X0S / P 0 Q/t-c 0-@PLP0Q 1S 0 SD0 R0S0 0C#1S5/@T0P/h& p-`QLPp@1@S P4 (0 000(   ( TpphP 0S  0嫩 妩-c -QLp` O@` ╩ 0  @h>-cf8-c -L0S0p0W% 00 RP`@`TP 00 0Y P$00C$000C03 R! OpWPaPQ@0T0F (0 ( D@T@Tp; ( 00C0( 0 (0l5D@T ( 0S Q $0Q p( D@T0SW @T D@T (0 0Hl D@T000pS`h-clh-cph&h& -L M` 0PS4  2R `(K Q 00\l2 A d2!\/0@!b0S`0p1v N @+1j ` ᵨ pN  @lF@T X 00 `ӹ 0 0PCp0K! 0sO _b`P,K L,0\J , p 0PE0 0,@uP$0 !0@$00X00   u0420S,0 @ `W,pKP b, @D 00C 0,LP$0h0C$00T0C0h`f  N7``@ `@@`$;gffflh -LM< 040 2 P Ala 0@!#Z@ 4 Z 08 ,0 4PpZ @bPp, 0P Q 0S 0S S <P ,  0yN0 ,>O,0S^Z>40@,pP0 @0 pP!  000Z@  ?5P @WJ0 1P51@TZY(0,0 7 ,!OP @ P$0@0C$00Z0C0 A 80宧4  @@<0 @,O0 R  !^M,(K0,00 N( , Z4   F3=jlh00S S/ P/P/ 0- PLU00 00S S S0@@0@ @@0@0h R00 0S000000 0-@LP0S000F L 0hL -@ 0LR ) 0S S S 4 \Z00T9 -LtMp0`S/@ (K iQ0@0̗jQ@h ʦP PKcD 0P@ <x0 t@ @PpP0S&@ #"@(!08@PTX 0R)@ 0 / 0=@xP   P  0 (1( , (1 0 0 ,((04 ,0,(0( \@ʚ; -D LRH0@H0H0  R 0T00S# 0S 6*P 00 L *L0 R0hlhf8-c -LM0S@=0C hR8PU/@1KhP`/ j0p 0 =@ 0PK0c0 @P<t0 p@ @Pl@T hDKY9hP c!"d0@$K@\"@K 00 0 ˠˠhlKD K 7@Pl0 pT0(1( , (1  0 0 ,(4\9 0-0LSP X0S0S" S S 嫲0 P0L K@P70P8@]{P0SD0 D0H0@H0(0( P 09 .c.c-c.c.c - QLPp`6 @W@ Q00S0v03Q0SQ=!&!&!&d!&!&D!&!&!&"&"&"&!&"&X!&!&x!&D!&#&!&p!& 0S -W Z - 0Sm $& 7 V8R0 T0 02@P  80@ 0$@80<@,00@( @ 4 00 @5T'0(B8SH S& S$ ٱ0S S S б|z P P0` 0 \o弱Pj0 0 P= T@=RB P`0P 0 >@W@0Y0J GX 0S80 P  @QP 0P7X %@W@0Y0 P90 PPp P p,9dh$999-c00300/00#/00( 4000 %0 00300/8/p@-X0X (@HPP`X \ $,@LPT` (HPXphth0/thA-400 C6pǏ(#"B00 P' 0Q 0S@0@ R$0$0$00 $0 P`PU``0 0P`XP@`0d@00 0(P0S@0 @P0S@hhth -`VpL& 0V\% 40 C6OPU`` R$0$0$00 $0 0 0$ 00 $0$0$ $ `UU困89 -400 C6Lpȟ(-00#0"B005000 $0 (0 @0P`P `0 @ P` 0@0 0 $ 0p@@`0 0@`0d@hhth -3X!2CL0M,0 XG PQ0000 # D0s!rGp(0P` P ` 0 @ P`N0 0 $ 0,0 X 0 R! 00 Q, $0$0$0$0 $ 00(5000 40$C6Q0 ɯ(, (X(Kh P-Lp`P@P@DTPW -ph`L@jP(  P@ $PpWh 0-@L300P 0P 'w00  /500  00<00000 0@P0T9 -LM`@P3Kp<H@ DP @P 00 @ 5K00/00000 -00L@00000h00000q6 -L M!0 C6B6cO`p`VpࠁQ 000S @d _,00AS00L1P&O0d P(qP03! 00a&0S0@00R 5 .0@B4\ R00C10/0 @L Kd 00?2c, dS0d00Ocioc4;8;Xhhhh\9$h|hhhQ 0-LQ0@0 P 0@P0 0h1h$h p-@L300` 00;0000 A 0S `10S 3/0000000P <Lo00   0S10S 0 @_Q t0S'0 0uph40S*00800u00:00000 00800t00tp0Shh`hhh 0-00L PM00\<P00 &0S 10S 3/00 *   00  00  00 # 0 0@ 0$@00@ 00 0hU008000ht00@000|0008002(0 0@(0,@hhd9 -L2Ll!D2 72p4WC Y 2 0PoPVhe pP1 1 0PoPV2/ K300 90S 00t!0S  3/P2E4!0*1ypP !0S: !0uUt0SY00S0p R1007001 Ut0Sʓ40p R4 0S 00s=j hh|hhh`h\h09 0-00LP D0#4 R21C 0Q 0  0 00<000hv00000}1@2$ l0000hncDPc=j - LRpg 0ST0(0 P00S $0@RQ XE t0 0@t0x@4P `00 0@004@ $ 0@00<00011P!0l  0H  H b2008003\P [&X@  @Gd0 0@d0h@]@00h=j -LpL0PS` 4@8@ R @00 00;00C` R qE00 h00800hs -1L P@@00@ Dp@ `P 0 @_R 0 P0OT r m1p0 R$0S< gSt0S0p Rhh8;h|h\h -SL M40 0 @o0 , 圡`P CP0D0 @P40p800P  xPtxlp00 <P\@ PR00 @3`4 P00,400r1(K.02삟 , Po0PVFt0Sڴ22 RF4r>0#6Po ?QP@P8 P <_0OQ t0Sc!0 ?Q?A!0s,1pI )r11 RP@P0 ?Q-X1X!l0\ H1 \ ,r4A4!000@;00000Z 4`庢,0p^PUkP P0p R80p R^,0pC0 @%$h!Ce.ch|hXh8;hh9\h=jDh h`ht99 -L@ 0P  -LMp< 00 & 0 0PP>/K` Tp P ZPP 00 00 8000l ]r@g0T P(KD@0 0@@0D@0 0 P09h -LMp00  Z0ST0(P Z l0 0@l0p@$K|0 0@|0@00\9 000P(` 800@(, 80<@1 l000h=j -LMP @Pp, Z `@P` P U (Ko, 1 -LM@h -L(MP`@H v00 >0~pW t(K04KH ,@K@0PE,04 @r,@ TP<  0CPD < PR/J D1`PU'J0O U 00HP`F<@T D1P @00;00 < TD B0 <D0\ 1@ > D8 1P(`80 p0@80<@(, T10 /00040K tx dP`0`4p8p0H08 8 0O`0@8 <d0h@@ R0 40K)D t0x@0 0D|00LP(` 80X0@(, 80<@ 0@ l000600sK/h7&=j p-\0\` @T0TLP0 Q00cR0bc00cUpph8;hp-00H 0R00 P RT T0X0T0 P T0H pP` P`H0 0@H0L@pPt`p/hh 0-4 LRP@H00ahA4@00Aj -LMHPPp0 4 4U.d`40PP, d PL 4AƠ 40@CƠ /P00S@P0T@\- 0 vP`d0 `P044 S 0 ^:000 H0S 4AZ0 R00300,(K400P3A00/P0 PT `40dpP, 0AjhOc -LM40PC6/`0`,0 R0dp`0dPh`/Ƞ6@ ,00000@0 @0 x  P00@P0T@4 0P@B&`?S 00300R00300Qh - LM0@0@0 0P dP 0 0Pt*6@P`PP`0@P0T@P `00300$0 dph4` dhhOch9 0-PPQT0T x0T0 PT hp0 0@p0t@H@0H0L48(00 B0hh0Aj$h p-H`0VLPH0 00F4L`0S -Vp00H` 00000 R600500 RP P0P0T00PTp0 0@p0t@pP RT0T0T00P T0t 0p@ pt DH0 0@H0L@00 n 0Ajphhh -H0LSP 0H@ pHL Pp p`T 0@P0p P0^0pt 00000pm00000hhph -H0LS P @RT T01T0 P T0 1p0 pt l!H0\0 @H0L@DD1 Y$*(!p00 @p0t@40#6 vP`d0 `y 4 40CX:H`@圐XSnlQtp Uh 0 `U 0t\p^hhhlh0Aj=jDhph9 h00000z -0ML 0 08`p@P0ʠ @ @QPT0T` P'HH0P h@lP`p@tPKhr zHchhlhthhh90@-P@ R( 0S%\ ) \ ^ \@ 00\0 S 0  0S R 0000@00 R P,  R/ 0\00 S 0  0S0S 0P@ 0S@@0  @0@000S00S0@ 0\@@  @0@- R 0S^ 0Sk0 0R 0SI0SD \   R00 \0S0  0S R( ^ 0Sm R 0S 0R00S00 S0 0S    R000000 \0S0  0SR 0S@0T00 S @0  0 S 0R00S00 S0 0S    R0 R 0SP0U00 S P0@  0 S@ y -LXp5 PU?P0S`X`V 0S@ W`RP 0WPP 0RPPV 00SZ  `X `V 0S` P 0S/0S/P/0S/P/0S / P 0S/0S/P/0S/P/0S /P/Q00S/Q00S/ p-` ML<@ ,0@ P @ $ 0=j .chhhh p-@LT`P@P  R0T 0@ PPP@p0@0@@P -1`LPpP0Sȸ帡 0R1P 剗W0p$0@40$0 9,0(`8&X0S: XP 4mb(1PW,  W @0@00 0S 0Rؼ0Pm8 RR:0.S `0  $0@` TX p @0 0 0R 90.S .ch;hhh49dh@- R00 RP00//// 10S 0@0/$.c 00//@Q@- 0@ 0$@/!001 - L0; S Иh< -$1PlqL0 S TP @T 0P $0 $  Lk@$V T 0P P T 0S U00Q0S@kV<0<0 0h=j@9 p-P MLhh 0PP0nD0D `VPP@PO U$@KpX9h4.c8.c -@ LP( R,0,0,0,0$0 008g P -LMP,  @0=   0R 00P0 ^,0  0R q0 Y t/ W> X. WFʁ qp tq U<9 Xt0   0 0Su0000rtuXYTU0SVt0 TY t6 q: R Q W t0 009R XY V qrruuXuVzrQ`9 p-L M0PK0%@ `K0S 0S  0`%PKp  -LpP01 0101 P`u 0P@`PU`P `400v0@0 @ -@L0<00C0h+h 0-L@P<UT004(0P0T$0 0   R0h.c -0SL 0R& 08 pᰒ P` 0S@ 0@ 0p $0( 0S 0 0@ 0R0 @  -L M0P@T$pK `K$0   0`x@P ]0DS n&m&m&m&pm& 0 0 @K 0 @ 0@ 0$0 @ 0$  0@R  0S v 0 0$  @ 0R 0 0@ -L M0SPIJ@PN d @ 0@ 3 cHQ d0S\  0@  0S @ K  `V $ (0@(, P$0#06f0@S (Q,0, ,0, $ 00T 00F` pK'`@(K 0P ( `P \p&|p&|q&p&q&p&#@@T $0@P(  0S^ 00@T$0P( 0 0@(z@0SL P ( R,0,0,0,0$0 $0 ,0( P((0 $0PT& $ 0P( $0  q@ 0R:  0R& `P(0 @ 0@ ($ 7@(0$ (0S *(0S # 0R$0P( 0 0@.@'.c.c -LM40 1\l10 ,0 080 E\A0U@ p pppU2T 0 P9 ,Y(1; `PM@$ 0 p4  00 08 0@$0  8 0 ,0 ,0Y40% Y Y @\ @(K0@P(KoY0@1, (1+@ @T=j -L M$@ 8 0霖Kx9h@ 00< 0c8000/ -LM 80@ `$0 R[ 0 Z  "P|0P0C,P SP%0 ,0S 0 #xP  00W(0$  P IW(0$  0  R  0  ,0S (0$ ) #  99 -P804L0cS`p  508 @0<0@ 0` `0 <0@ 4 5400@;40 <80< 0800<@ 0 -LMHD 0 0<0 D000 R0 L`80  S P< 40  H #X0/S  ` 0S/S@ 0S/S aR\ p!00S $\ (@b$0/S HH0SɌH<0SɌHHɌHR H ! 0U E0U 0,P (0P ~ #0Sz 0Sw 0 H  00H P0 !P` RHZH($0 jbH$(`0HSɌHP0 ST@T#  ! PH",K0 p Wa ,PHP0 S SMt30 S *( X 00SXP 8 X ` 0S/S@Kp@\ P0/S Hgjnj$(@HW PPH  D00CSP  {80SHs @T $X 0.SK0.SʌHFGSHfR < @0 0 " RN T, 00 (K0/S $0 ab$X0S p0S 8 0p03R0SHPɌH p@\ ? p!yH4 R4 (0$ /  z4! 9 H n40S (0$ 8 Rr (0$ n p@$0( 0 j 0ȌQ$0( H  p h@9 -L(MLH0(! P pDP[ 0S_ T+$0`VH$ RD H0 T0C\0S/SA\0/S a0` $0 T0,0 Rl4   H`PH4D 0S- 04000T0`/V dq1 P04 3T$ ``T00(K#0TST+$0❿`t1S   3;<408`0@P(0Sz T0 PX0`P|H0X 0# RR ,0S0,0$0STL`0KP PP 0PK@4` H0 D@ 8 `TU4 02 I00-$ RlD$ `?`04 2H0 ;H0T$20PS0hh -LP`d @p' 0DPL0H`p00 0@-P@ R( 0S%\ ) \ ^ \@ 0 0\0 S 0  0S R 0 000@ 0 0  R P,  R/ 0\ 00 S 0  0S0S 0P@ 0S@@0  @0@ 0 0 0S00S0@ 0\@@  @0@- R 0S^ 0Sk0 0R 0SI0SD \  R0 0 \0S0  0S R( ^ 0Sm R 0S 0R 00 S00 S0 0S    R00 000 0 \0S0  0SR 0S@0T 00 S @0  0 S 0R 00 S00 S0 0S    R0 R 0SP0U 00 S P0@  0 S@ y -`LV@3 ^=0S`PVPU p` 0S`` TPR 0T 0RU 00SW `PV p PU` 0S``P p P 0S/0S/P/0S/P/0S / P 0S/0S/P/0S/P/0S /P/Q00S/Q00S/0-l@0l S0/ UTR p-@LTP `P`@@T@p 0-@LPT P@@T0 p-@LT`P@P  R0T 0 PPP@p0@ 0@@P0 /L0P/P 0S 0R/P/h -LM 0 `0p00Ġ R 00@4l 04 0Q$0 $PK @$00$0 08P#8@$00Kncch@-0@ d0h@0@ 0$@,00@80<@D0H@\0`@0l0X 0    ( 4 @ L P T /(0S 4 R808080 Q(/0S40 40808/000/0  R0S,PP000 D000 ,0 0,0 ,0 0 0 0/\h4h 0 0C 0/S/0S/,DP000 8000 ,0 0,0 ,0 0/4h\h -L@p`\(0S 4P7/PU (0S \ -L M0   K0 P K|&-2L?0\ \ T 0S0SLhT0S /0  0 R  R T 0\ 0R0S R/0@- P@P -0A0@n@P/ - pLt (0S0 (\`0h d0dt<0@@lP`|0LP T0X@DPH`Z AZ Z Neo i -pL@T P` 0 `@S ]PQ 00 R 0 QR08.c4.c p-0L@`T  P @T 2P p@0@Q @`0(0Sp3/p8.c4.c 0- @RL R000 00 @P D0S& 0S0 00@P00DP0S S t0d 0?T0 R <0< CL0Q0P0P0P0!CeL/cVUUU -LP  p R R000   D0S 00hjL0\0P0P0P0!Ce9 0-0LSP@0@00CST00 D0D @0S0@ 00@P@09 -@L*  tt0P \ 0,0 ,0 0@hQ0S,0 ,0,0000@04h\h -L@p`PHH\ 0 $\P  -L`pD@PT! 00  R 00@00$ ^ 0WSD@PTW 08 D0S Gh^99 -LPp` 0@!D0S  0 @PdH0@SD0S 3`|@ R% V@ p0S'PD @VP p0S00&00 X,00;00K@U@ RDP) V P @PP p0S00800` 0h[@P q 2 l g@VR ѓ999 P-LH00CsH0  S00Hh[Z帓49 p-`LV@P 00   R000   pH00H0!Ce@-Q @P-\ $0 R 0@SgD/c -1l!RL PpU. `PU 0 00S00` @4W`pGZ`V Z 'P0@X PU`(o l=j.cg'5 X9L9 p-LP`\@0^0$C I pp\ 0P @0  0S p@0@  0S p$3 0S p 0-L$@ P0R 0S  0Q !kP$0 0 0-@LTP0$ g +000\& - L@0 Ej1 + -LM@X `RP RL`0SIRGSE01 +딀PTX pPX 0S ` R,p  X`0,0 \pP  1c+(K` 0S 4!1pP0Sp R 0,palP00U0Sp0p00p$0 p40pP$0 P<$0"hP7p p-0L@P`  p P$0<$0pV$0<$00 p -L MQp@@ @-\ x1 R R 0\0,\ @@@A 00I00 p p p !P0 l 0 pp -LM c -LM @ -LM c -LppM0@0. ,( `PK0D @0x0 t@ :PPWp V ( "(K R "(0 `0 P@L@@@ (!0NPP y P 0R !(0 `0 -LM @ -LM c p-LpM`0@@ Kp|PK P@.@0h0 d@ @P `P 0 \@8K2 \P <:0S\@\P@R \8 K@\`8 K@ 0c0  0c -LM@px`+0㤧@P y$KPK0 @0t0 p@ j@Pl0S hDKhl0P lh@e@Kb0hlK ˠˠ0D K `@h0  c -LpMp@@5 PK@ 0@0p0 l@ "@P$h`0Q  @pm0p0 l@ @P h0S d@Kvdh0P h @ Kd@ K@ -LM@ @K -LM@c0 K -LMZ X@p`#z) PK 0`@2x0 t@ PPp@TP lHK lP *T (KPP0 R P\K 20:#:  D0娠 ;;0  X  X P-P X  X01 0lpKH K|P01 01 -LM0:#: :  -LM :#::cy -LM @o -LM cf -L M`P4P K<@K 㣤P0PF 04K K P (@(p 0P$048(0/ -LMp`@P KPT@ T P(K0 `Vk(P T@TP `[  -LM1, ΄ 0 P夣Up1$048(0, `P+PT @PW X*Y(`, 0P PTW X00`(K0`mk:h -0L p@T]@V 0 `WP$P@0$00(!@$0@0$0h -LM0`S T K0 P00PUp p@0S 0S PU@0S W @@@T  r 0p 0 l 0p0 f 0p0+}gh9 -$0@@0$0Lp`OP 00$0(!0PP3 0PP  $00#X00S% R0 00  0 P 0T0 00C0PU &. |h9 -LpM@KcpD 0Pp@PhP(1(` R @P$0  @ K0   iP@ 0f@ -LM@p`tPP (K蒠K0 Z ㍡PPKcD 0 p ZPP܀ 0<P[K(!0PP.(1`!R @PP$;P  .( `$0`(!0PP0S Px0T@x&.(x p $ t! -PP(1x Q PPP  t``xPPx!8$$x$x$"2 0x!$x 0 xp 0x$0xixx!0(  x 0PP xP x!0008K ㍠PPM10Sp1 Tp \p O p18KP pPTP|  P P &zx #px1  0x4$ 8$ Tpx(1$ |1t1 D^wx%ch8.c -LM0 0S- K3/ -L M0   <0S- K3/ K -LM   0 $0S- K3/ K -LM   0 @0S- K3/ K -LM   0 D0S- K3/ K -LM   0 0S- K3/ K -LM   0 0S- K3/ K -LM   0 ,0S- K3/ K -LM   0 x0S- K3/ K -LM   0 T0S- K3/ K -LM   0 0S- K3/ K -LM 0  0$  0  40S- $K3/ K -LM   0 L0S- K3/ K -LM0  0S- K3/ K -LM0  l0S- K3/ K -LM   0 (0S- K3/ K -L M0   d0S- K3/ K -L M0   80S- K3/ K -LM 0  0$  0  h0S- $K3/ K -LM   0 p0S- K3/ K -L M0   t0S- K3/ K -LM0 0   0 0S- K3/ K -LM   0 X0S- K3/ K -L M0   \0S- K3/ K -LM0  0S- K3/ K -LM0  00S- K3/ K -LM0  `0S- K3/ K -L M0   0S- K3/ K -LM0  0S- K3/ K -LM    0 0$ 0  0S- $K3/ K -LM0 P0S- K3/ -L M0AS@'0'''''''''''''''0   H0S- K3/00 K<0;0 -LM0 0   0 0S- K3/ K -LM  00S- K3/ -LM00 0 |0S- K3/00x9000/ -@ ML̠ 0 @PK Y p-L@P`D '@    0(Pp p9 0 % -L|M P@`\(  (0 pP00V00S 04! @PT a  T Q L00S pp$K(!KpP x00b0at f@ -LtM0(!KP|PC l l0K0 @  00CS6 ' ' ' ' ' ' '@0K4;DL0P@|0KpPK`D0H@dKX0K P$`80<@,0 0Dh\P@tPH`Lp 0(4@@TPX`\p (K   - pP LR1 ``(0S $0 0 @ 0 @2 0 V `00c@  H  0S` ` -L M p 40 R0 0,0 !P`Q VP , 0 @ RP 40  P000c@ ,(KUP -L(M`0 p0K@0 ,0 P L H0 D@ < P8p 4 @' W0 PKZ@ Y@00 (K0 PKZ@Y@00@0 S T R@ e -@0L0C0P`p, U0 @n -LM$0` p @PK 80K0@ ,P 8@ 4P K 0 K -@0L0Q00\0S  01 S ppW P`V  70RU0 ` b 0a0 -(0L$   R0 02&0 lP -LtMLp`@(a 20 S] ,< D00D H0^PP10S-PK S>PH K ` 0SP< PP8 0|PP1  0Sb  0NPP%0 H000(K  0H0@0H0DPP0S D 0P#  0 0l PPSPPK  00 000 @ 0 D PPk  0%PPd@;0  0d0 @KP 0@|@ xP (PP -LM`lq, W@P t 0000(KP$ 0 St @P00$00\ 00 0@P 00, @ =j -SLM 1 P  0K(!`P~ <(p0 \2@`0 0h t K\ t@ l0 d@ X@ G`Pp!PRP u 0 S  ` @K0p`(!@ P 4`KTK,0KL H T` , 4p 0 D < 8 LK `RP  1 P!D0 c\)ڰPH0S6  `\ ڰP<0S0S 0@b1S"`#(:00  (K ,0S `o000h@@0S0`h@`: -LM `PQ4 0 , p0o  44 @P#X04 00 R@080 r 0Sl0 )4 02 UT (0 4 40SO 4 @P 4 ,4 W000Q  4P (K8(!0@P*4 =80 04K,K 0 K0p@ T0Q0A/ 00  A0,0CUS4 0,@  PUl0P,,@ 0 K0`@,@0Q 0A/ 00  A, h -LM0 Sz`@S"`p?à@ S @( K0D0"D0P0`;`P   (K, ` ` - 0LS0ET0( 40àLZc -0LT , 40#"B ,0S-3/Zc 0-@L0DPS <00S 3/%40"!B 0hDPc00CS#''''''''''''''''''''' 00/ 00/ $00// 00/ 0-@LT 0 .$ àlL*PPT  ,88 #Č,$ T0 505m0Zc -L -LM`pT 0#((0"4S@(PP U$ !R0 U01 T(K "88#"$ 40@P T 101@ T ( 0T #40CBD * 0| @l`T (}( 090+ d00(  (0T `0d;0Zc -Lr9 0-LM0T  PQ%4@ Q Xr HL 0à L09DPcZc -L M @TP P@K - LT0$ "88" #$q(9 0  /T 0 p-P@0L  ` @ T04 T00@ p 0  /T 0 -LM@P T0R p  R cr0 O  00` ? V- (KP? *40bl f (0P0  0f 0`P 0 5  06/`(KoP0  *40"!B ` YW 041S 0 R04!0 0 06/ `9@9ZcDPc -PL0pS( +D@`T 00  R 00@00 P\ D@`T0S C 0qp9X9 -LMP`( T0R  $01 (4Rp R@% 1 W#*1 R 0s 0 2!1C0QX B@PBAD 0*T @D1 W:@0s 0 1P3!2C0$Q1 P5|p , KP ,0S$P3ᘐBC $0S000(0 @ * 0 @4q@@P ncgDPcncZc -LDMX @PP 0S S q 0S@:X@00 T2  $ R21C"0 @T P@ K04/PN 0C؀"(40 0ȁV000W 0P0d@`?L;c00尀,0尀h0T,\0S0 S0;Z1Lh\hQXhnmh8h8Thk_k0@-P\0  U0 @  R 0U 0  Q0a R.00  \@ R (0U 0 P 000k8i8E-@Mp 00 Q.\R00S .0Wࠃࠓ0ЍQR J \.\ 0 S.SQZ0.SR.0Wࠃࠓ00P^ J0 S .SU \ ^ZX \0d `h`cV 0 S  ^Q 0 0LV \00SQH\ᠡ'P0@ S  ^R 00A\  Q00SRQ 0S0C0^ Wࠃ~\_00W @0'!000c00 Q 0l T0#02SpRs  B0 S 00l bS0a  ~0 R0M 0 Q0F0 s R .R j80@-@0 S0C R .RN21CP 0 0 R 0e0@ 0  @@  ^@%J 0p 0 ^ BJ0r0 ^J0 BR0000@000  E- @@  0S ~? 21C0 CPbUP U`p@PEupG8 0`P0@Sw@pPUpG&J 0`Pᐠ0@SwPU@J 0P0SU@ J 0P0S 0S i8p@-@?0|03\0SP`@ 2 1C 0 0q  ? >1C0 0C 0S0 00n 0C0p 0S p/SN 0S~0S0 00n0C000Bp/SN V:0S~0S0 00b0C0/S 0S0S0  /S 0S 00L 03 0A0q/Q P@ R .RQ4 0?Ac/Q/ 0?Ac/ON -`PL@`@0`!0SXa, <P`DP@1 0!010QP !1>7 Q  0PP 00C0 ` 0>+%0à~pLR2 "`l B3!1C0 T  `00@0jdh`hh8nmh8QQ;9 R/0S  0/ 0-PLd@ P :0 0= !d0 -LM@p( $0P PK0`K3   , 00     K0  (0S K$ K PP@$ '^$H "^K $0 $0 L $0 $ 4$ #40$ 5$ #40$ 5$ #40$ 5$ #40$ 5$ #40X$ X0$ #40K$0\   K0$ \00#400K0$ \00#800K0$ _000, $x0sX00#800, $x0s[W |Pm z N PL0 s0VT K0 0K0e -U R -LM@0 pKP,` x0s  hiP(K 1\0WlW;X0 00 , XpdX01Y0\p$00W 0, r 00K6PPX0 G2#,h l0Q= x0000s7 /PdX0A1A ,0KPPdX0A1u\0080 Y `X ,0H `0Cd04K 墿PP 4- IPPX0` 70bd040dH80c\ 4尼4w(9 -LMd@@0S` (0S`Q@0S k( $00  &0`@0 -LM0P@, x0s` K0p`\ R#*d0X  B2!0C03r T0Q` 0V`P0$0\P0i0\ 0p]ih9 0-Lp c @SPQ0t `P2t0s H8UZ0<0P&x0ssb,l 40u@Ph0, Pg p@ X,0K@P4 Oh W0@t0x@4 , 4@ B9h9h -LMP p 02@$p  0 !P  0P:0RT0T$pH0 \1$^E   !T00T01 01$pP0S6:0lP`P00W0S W =( K,0K"($K ,0執PP$px~H 04 0 0, $pP K$ -LM,p`P4K(K 0<@P$,K(04KfP,(0H R:S 0S Q0S$KݲPڲ,Բ -LMQ@`PdX 032`DnP6"\050@0 0 P&pPX 0\ H `X H0N a 0PpP 囲00 -LM@,0   -LM0,`<0  <0BPD p,K8 K0PP40K,08K׶PP.0, H0P*0@SH0 @0S0S 0 TP 0, H0 @0S@p<(KUP04<\PP0,<00<0 -LM,p8K,K 0V@P80K,08K倶P30P,H0P *@,0PH0 @0S\ 0` \ SP d SP 0p(KT0ر99 -LM(0 0C,Pp(0 @4K,KX @D4 0`P1(K,04K&`P-(\0H0 R 0S  @000 A @D\0 0S (:`P 0\ 00T00S$K臱(儱 -L M, ( K0 K0 pi_(0S $KXX0\p \H ,`x0sA ,K`X H `0Ld0 õpPA,H0 @ 3  SP,0x 4qP0 40XX0S) U% q@0S (0Y,+ (0K,p pP(K0 X@0\p,p\ W,,p99 -L(M P\L ^p,:dX0  a<à  0, `PX0\ , #\ X4K>< K,0K`P ,0H S\00K H 40<K=`P00 \ H @@ RH RK0 0 L0 0$ 4#40% 5#40% 5#40% 5#40% 5#40X  X0#40K \K0\00#400K0\00#800K0_000,0x rX00#800,0x r[000$0SK`P0K40<K媴`P00\ H @\ 0n(K0%0ñ`PL R K0 X, x0s P0H0  H L0,`@0P,` H -LdM 8 t @0|0 P x d ` 00 ,x \ `K0p p(K|@ 0Pp |x :Pp | @0l@ ' KK0P Pb P0p0 X T  \X0 0R   S RX q P `m 0Y 0 S0C R .RY0h0 40 d0 p0K`d@ K,0KP?\8K00@K@P10P88PH 0@ s 3S00S9 X0S`hp R PP pcdd 7 X T UVX `hp V0fh2h Q 0\0"'p [ x | ӻ0p0 SX`X 0\`S  P} T0S08\ 0 0  80KK PP` p`0$0\0x 4r` ,0SPZ V,` PR8 v 3\x0s00 @`Rt P 00R00SP  N u | 0Pp `X0S  Z Rp \ ,40KPp l 40R x0 0;0|tX T `\ pX 0B$00.S  R R0.Sp`R ,` P `X0S  Z R= |u| x 0  x | P0  u | 0VPp `X0S  Z Ro |Q| x u0 40@hQ`N0p0 i8Lp@ eP p a\ ,40KPkl0S P t|06040x P   `(0S | 0 Pp :X` 0A$0h0 0l0\;0p ,|ti0 6p 0#t|`0\60 ,40K@P lQ P  %40 x0 p\ ,40KPp l0xS40 |t9060|t TP0p@ 6p@ 0t |(P060 40p  /d 00  00/ 0-L\P @{P004  0 0 -LM0K@\[P00 0  -LM"0K@\JP0   -LM\B`0$0 ,` (  h0PSp 0SX, KU H s 0P$ $K\z' 09 0-0LSP@d0 0< 0S A P  0P0D0S 0S -L\ d00dpLP` P`T0@0@TP`P `2,p0@$0(@4p8 -L  pY`P\Rx T0`@0Q < ; $0\b:$0 -L4MT0Pp V@P (KPt7 U@d `(!0``@ T$0040  0o@P(K@ H H : @P% T R00,P  4 0R ^V P < !; 0\2,0; KH@P 0 4 !0 4 !0 4 "0 4 "0 4080 0$02 0$`08  24 \ 8#8R$402@SQP  0 400 0,0 0 @400 0002SL0 $PP80S 0 40S0 x0 0 40,0080 0$ 00020Yt 8 0Bp \n:0L k0Qh 8@Te 40R<0 @ _<<,0! <@x D 0,8<@@0r000 L 2B!?04 H @D000H0`T T80D 4t0LP QT 2R 0D 0 D x 2tQ0 08l0l050P S0CP0l0 4p0N0@4 C`\ d0Nd @0RX O@@0 40,0P 0 R,g0,0 |QHP0 0B P< 0P P@P$00104P0010h0 0\b儠 T0h"0# !B$$ 40,00@0H@&0%< 40| l0  x040+H#13 倯@Pt,0H@ LP 0|0,00 +0 ,0,0 yX LPD LP, LP g H9P9l8 -LMVKp\  x |`P$0 \R RB-` R3XP K Z 0~`P (KKX Z 0~P`P KZ 07p cK@ 0妿I`P0S`' M <Pw010 0$00(!$00  $0`P ! $0T x 0 #40S`P $0 <LMb0(!<`V$0F 0S`V\R0 0  00A?x0s: ,K@P)  `bU/K`\ KZ Kj@ (! 0``Vv E 0"`,0@dP,0 0@00A_ZKP\Z }MZKNKZ uMZK Z nM ox Knc //E//0 d B,0R+̈'('(''('('̈''('('('('('('('('('('('('' 00/0   / 00/ 00//5w-`| @!0P#@`$dd!!X \r 0' @(?0# O $ Y `@&0#@/8^nCCX좙N 1s s s /40@0Dl00l /0@0 0@02c1c1cDl R0l0/ 0S00/0-D0@Qd0 \0<@P@TP0 @$P @0/00 000! 001@Q@- 0@ 0$@/!00100000@Q 0 S /1 91/ 0-L M Pd\ @0 00髹K0 p-0Ld@`X 0DVPX4%(P%(P 0 0"$VpX99:9 -LMd\@80 P(,p  00P 0dL@Y! 0 8 P4 Y`` 0 0 KP ` X080b3@_00@PS P0F04(K,0S`Y -LM0 d0Q 0 00S  -LMPp 0d0CS<ltP `q" T ` 0D0 |p0S 0t o`P 0@t0x@8H Jt0<0r,@Ꭸft0sx0sV90d4 -0Ld40 d4 -L@- -L@- -0 LR@d`dPp pl .0l )V z -LMPdPdpWjpP 0@ BpT l l pPᢲ 0 pᖲ p-L M0d@SPP Kp$`K0 00 , 0 00 000VT :K0 0K0L0PN 100R+0 -0@,LkMl0 _h -LM Pd@pX0S  \0R`#:MMG$K謠K xHl K`P 0 !0 0,4Ka0K00  T` P` }0 00 ,0 "0.00 ( K0`P0  l0 8( 0\K^ K`0K0DL0VKX Ka0[ 0a0K0 ZK0h -LM0d`X ,pR  \0R#:L(K@0K 0@PKx<@KoH00 p 0 00 0  000 `X 00H `0Cd0 PPP"d@HJHH@ IH0 H 00#40&[ 6[#40&[ 6[#40h [ [6[#40%[ 5[#40&[ 6[#40x Xr= !4 0 0 &[ 6[#40&[ 6[#40h [ [6[#40%[ 5[#40&[ 6[#40x r ủP t KP) 0 g00#80- [ X0#80[  @0S 000y dKf Kh0Kr0^K` Ki0[ 0i0Ke@ P0K, K 0X iK\ @ P P0  l0 ., 0'0 bK0Kh1c -L`M@ PP', 0 `((0l!(^x \p ,0U ,P M0K (KP (0^\ x P0dd t K0\ P  0S t0Q 0 0 t0@t @0\ 0P l d0,l0 Pdlp 0` l$0 6x0d dXX0P PQ  | X  Zp0S ,^ltPf0 J ,K ሶP],dPdl Pp p  | X l sp R K0jP\\pl2PW,l0 ^,)p d? KnPE00 0 0 XQU  0KK0PR dt T d\h 0d0 T P\Qp0l .0x &t 0@000z-wx0 .R?x  pQ ,b00 X0 |0 xPB \0S ᮯxP RH0S7Ct @@? JKeF?K aFl0 $0` 0 tl ipP JK PF0S0th(0d 0 (0htpP 0S x0x0c\\X`0t3 l0~@P Q x0pgt `0S\0 00TQS x| RN T0X@T9 `X H `0Dd04K 僨pP'4 $4H0@x0lsX 40  0x0s $,$8  04啥pP 0!@0S 040 RRRR=j 9999 0-P@QLdQ0hM -LM@p0d`SP,0s0s0s (K0s(0sX0s\0s`0sP0sTq (0$  0R JPT!88S(-K0 0K00 00 y (0$ y0  ,0 s 0,0 0S "P0 S 0, S p 0S S  0Pl0 (0$  0R P l0  0P0S 0  40s 0,00R0@0s 0800VT 0K0 0 K0 0s (0$ X 0S PQ0S 0 K0K000K0K0K0 0K0 0l I(KomK0 0K0cYw 0, S~ nPrm(0$ ~ quPT@0sLf40sy@0sv -L M0,pKdP,@`20 00, 0 0{ 0000K XS Pi I?0K0P20K0  )<@00 !!   ,0 p0 0 ,08@  ,0 Xp \0 $_,0 H,0DTK0P 8T0, d0(0,\ \0 00@\0`@ 00 K\0S0S`X H a0C0"@(2"(@1x0s@00!~ L0PN 0w ,0 L D0T 0VK0, 0K00 0_0R0 0-LMPd0K ,d0I <@00 !!  0 @@mK0 -L@ML X d 0T S,0P0  P`V` T@K00H0 T\0 0S `(KRPX05s cr SVqQV8p 4 dL0,  d `0 \@H\@ dQL@ T D \ < LP@0X 0@@b b3a R`Q<RZ2/ 00K X`0PVd <0Kd0c<@D \S0! lS0!@  lHSP1P!L  `0\V%L@0SU P`Y 00K Xĥ`,KT8 K0}`PP00K8K,0妥`H\yX(0$  T000p'n -L]M 0t d0x1 K ,  UKFBt1tA l! h1 @`VA a { [?K0@stq`1x2X 8#8R1 hAT@ 0\! X1 @| t1\ xql|!\0ba[_K`W?KPU`X@X\0d A ՞50pa `2 PV1Q 0d! `1 0 W p!p1 x< K00K,@K@P 4K,0<K#P 4, <0X! cQ!H! 0P>* PR `[?Kp`p Q { la hq d `! p! H!A0 P0S 0@ `pR Rl h d ` la hq p H!A0 P0S _ta\u x!|alA\0fa[_K`W/K PU`XX\0d 50pa `2 PV1Q W p!z`!rt1W_K`PX`t1[K Aq 0t0g0x\ PQڌ1 00(Kx0s | \ X &0x p40 40Ȍ< \ p@0T P 0B1KpPR OK {AKA[ 0($0(@K0La Hq t(K0Sl:UKt!z P x0 4d! `1 0la hq p1 G01 la hq A04 00,0S00SX `H a0C"0n2O@  0@ T1 PA B!KppPA[(0K 01Bp!UKp 0@44[Kd ` @A i ᆟ[_K`WKt1PU`GPW0 0V@0RY|4odq- tAWKY_K`PU`YKl h! )4]W_K`tAPX` V lqRU'^0OK,A1KB [oKA1[  L H! 0!0(pK0t(K\%:UKt! P (PUSKl h! 7x0s 0@T1 PA 0UB1K U0OK,A1KB@0@T1 PA ?P[K`P` ! t1?P[K`P`la?V taWK[_K`PU`4|a 0O[_K`PU`[_K`WKPU` :: -LLMh hX h@\ d 0T ,PSPP P Sr M\T\0 0TcP` Tb Q 0@TZW X \ ,0KPNT \ L Q0@MJ PppXdP RPPd`0@X0@031@ a< QT>QL @P0C T0PP@ E P\P@> \< T& L< 0Td0l@Q  ,0@00(KSP TfP@ T0\0L0 @ P L@d0X0C03<P@P 0C`P @PH@ DP \PPpW` -LM0@ KP00![04"48# -LM0@ KP00< 4("4!  - @L! h0  00- LPo1@s0P0D@@0cX0` 0X0 0`Ps $0S0 $ 0<2cg -0 @LTpP ` @T 0S0S`   0V*nP `` h -L@ tP$h@0Sl0 l0p0ph 88 #0-PL@ P  00 0H00C 0X0 0 X002c -@L   000 -LMP P- K@K00, PQT0 Q8@K00, P0S02c2c -QLMP`p@  K0HSP@P 0@%L2c -0L@T- W@( 0pS0pQ!ڔ 0SP00S PU`h ^. P0 W@0L0P`hncZcX' -L`p P@P  <` p0 0@  e00 Ihh9 0-X0L@CTPX@0    ( $ ,t 0h02c p-@DPL` `R0`0 0S00ph& -@L`PPPp Hp ( 0` 2c(2c$2c -pRLPP` U @W@1 <pWP`[It98 }<0  0- L@pPP@ A`@0S @:0S 0S 0s $0S0 $ \Vg -0R,(SL@ P U 0`P q slP  PU   ,F@#P    `$/@i 02c -80LSP@ p@@P0`P x03/ d TP0 008fP PP H 2c$2c9 p- L 0`S t0 PUPU 0S 0S@ pph -0L@pTP* `0S8 =PV 0R`@TV 0S 0@S S urh0  0- L@`;0pS, 6T| 6T <6T 5T% 5T 5T P5T <5T& g5T= 5T* 5TL0P0P 5T :0CT ,h5T `5T X5T PH5T ^<5T ;T (5T0S i44T0P;0 44T 0T0P00 0CT0P04T t4T `4T P4T PP OPL4T 0T 0CT@0P00CTK 0Ty0Sv 80@SP m0CTt 0Tk 0CTc0P:0`3T 0T 3TV PL (1 P (1 T MiQ0PP 0 A i0 i+0P0S0<01@oP(H0P0$0PD0 0P0=0"0OS$,t2`!P 0S0P 0PP 0P00P0S0@0 QPH=0P0<0P00S i0S1 0R 0R 00 P 60@S0P@n@41 @P 宖 1 0 P 4000T :00SP0T L0T P@0T <0T P0dPP080kB @~fmB fB{BlB sB@f@oB@nB @wt@|B@vB fB@hB yB}BzBjB@xB@gBvt;;2cqB@pB -@L& D0S HQ\S0\0L v\S0\0 -LMS00 Sp p@`0\P, 00  R400403 0@0 @ @`0 h0 封 ,003/:0`S$P d 00S* P 0 0 $  (Ko(Kg -LMQ< I 81ZPD ` 0`P0S: @8 @0  !0 0 !=< (P YPP Y ,0pS 4K0 `^<08 S 8 P8(K080 4K' -RLM 0 0  0K K K -LL̠Č.Č M!̌K!00 K0} -PLM`8 @ P= P P0  !0 0 !=(8P 0@P Z 0pS \04@K8 @<0SP (K4K00  00- L@0PS ]l Rp0p0p0 U00  0- L@o0PS`  0R` _X0 0rpX0: $0S71 $ PQE :0S QH p P!$00S":`V. 0  0`  o `)0 @ 0  ^0$00 G pP` #P0SFP >`0 0 0 0 g9 - QLM`p Q -iQ Q pQ0 )*00@T_r i0TP,0 @P OpP q fr17p Q00Q0000 0T 0YY V  h7 0 0i 0   Kw`vp ,KS7, <4("4!<0 -0 LBM0 Pe@PP `62P PPK,"0P~K  K0ZPP l 0Sbq(Pt0(07 0D@ R 1[S01K- @ 0HPb000S00 ҇/0A S@-2*Qf 1@ 0S'''''' '''0@S 2S K S 0S0S Q0A0@S. )ڀS S) `S 0S0 S 0S @S00Q00Q`S pS SS SS S0S:00:PSS 10 S R2c -LDM@phK@l6TP@D`y @0S񟗻$''''''''H'H'H'H''H'H'H'H'H'H'H'''L'H'H'H'H'H''x'H'H'l'H'H'H'`'H'H'H'<'H'H'H'4' 'H'H''H'H'H'''H'H'H'H'H'H'''H'H''H'H'H'|'`'H'H' 'H'H'H'X'@'H'H''H'H'H''H'H'H'H'H'H'H''H'H'H'''H'H''H'H'H'H'H'H'H''H'H'H'H'H'H'H''H'H'H'H'H'H'H''H'H'H'''H'H''H'H''H'H'H'H'H'H'H'H'H'H'H'H'H'H'H'H'H'H'H'H'H'H'H'H'H'H'H'H'H'H'H'H'H'H'H'H'H'H'H'H'H'X'( K(0PS> P$K( K(0S0a/P-Pe+ `) P'5V%05S"V 0S0$ K10D`0$ K10DPP0P ( K(0PS P 01@P001@0P( K(0PS PU:01V P0U:01PU01x0U010U 01Pf0S 010PcP`P^01@0P0$ K10D`0$ K10DP`PPE -LM 0 0 Ki K\l8 -0LM0@ 0S K4![04"48 #  -0LM0@ 0S K4 <4( "4, ,, 00S0000/\2ch R000  B /h 0 /g hPP 0Q J@ @0?2cS/ 00c0/ hg;Q// -QL M &2 H00SH0<6 KH00CSH0ʲ64 8#8 & 6 1K, KTi 00  0/ R0000 0 /0 0cP/gh p- 0PL0cS@`%P  0P@ R#p(bP!00p 0 \%*0Q25 RP#:p R#:pg -L@9 0-L@6nPP X0 ! .   "! 0 040hh2c0@uf8 0-L@1nPP X0 ! .   "! 0 Y0 0hh2c 0-PL @l P0 p-`PL @40 P ` `pg -LM$pK@P `cP $0$@ T1!Q %dK2!  dP -L(MH`KPp( @4U  54K0 08 K-4 40, 0cS$ 000ghhh -L M@Gp8#(`@K+08#83K6 T0PU V 6 8#8 #K&x Ta KP +(d00@K03K6 Ti Kc 0-@LX1PS 3/0h5 0-@LX1PS &8S0B8#8S6 (08q0h0<i;f8 0-L@P00h 0-PL@P0h -0 LRh2_?9-Q 0P P P-0 0   p-0L@`T$@T 3P 0 RpP U 0T1 S 3/PUppT2ci$ 0-H0L@PT $@T 3P0000T2c 0-<0L@PT@T 83P02c -0LM@PT$@T ~3P0S P 00PK@`T SP,pK1 83 bPPE`@T UT2c -LM0S  Q 00QK @`T SP,pK1 d3 gbPPE`@T U -L$ML RP1P Q P 0 R BPQ PPL P (KL0D1YL RI8HK l1pW5PU $bP( 0Zp PEW  UHK`@0Sc8KP1HK bZ Y UL0 0eL 0` a8K,1HK aP PE 2c -LM0` V ! P0@T PPPU,pK@T PU 0 2 aP` Kh\2c -LPp0H0@T `(0S @3/A@@Th9X,c p- @LT`PC@T@ B2P R000$0 0 PP 0S R000 0 0 c00CS00$ R( (0@0(0 0 ($M IppT2c - @L <01 0- LP,m P@ @ 2 40$    0$ (0@ 0T2c -0LSPp! @T @T 1P  :`P%  4P" 1@E0/S109S@P  0@T$@T 1P000@p 00  $00$ `$T2c -1LSP c81i 00S0C p0 ` p0@0p /`i0050h00A 0-L@P ',0h -6@06L$0\ Q hh 0-1@SLP0 &/0 /0P/ -@L -<0L R@10@T 2c 0-41L0M@T$@T  0PP @zT$@KB/ $K00#K_@P `PP @@Khh )/@ 0GPP `@P QK0T2c98 Q0-LP0d00@T0@T0  .Pl0~\ 0 R bd0;d000 R \0hTh -@L]0P@ \ \0R@@D8 0-6P0L6@T e@T 0h 0-L MԿ0P@T@T 6 6T!8H#8 R84 K KT@TK02ci -pL#W`P,PU) PU7 0SXQ 60@^)*0 0# 0 0#^ 8.P Q  0.P PUP^ -L`0pPUPU t0W6 @T@T 0 R0S -P@2c -LPw0p`V`V t0W@T@T  0S -P@2c -LN1`V9 `V4 t0Z@T@T  0SPU 0 pR*0 0# 0 0# WY P  2c -0LSp 00C0 SP@ 00BR0 SQP@T`U 0S U0S; 0`V`V 3/P 7/P0gS"\ 00L0 S0gP ^0P@@00L\0 SL0!l/@!b00RPXP0S \2cgfff p-L@`PpPPp R-p62/p8@Cr 2/p p-LMK`j@PP PP pPPP  -PLpMUp`P tKU l;Ul [`;Ud 0U `C<;UC*4;0S^P ;岖U m;Uz k0CU0CU*0CU 0U 0CU \ `0 0`0 6 0#u0S 㻽@ `(KM`PUM R`:U?`P `^`E`.`P=P> P- P/`~t9@Ua  \9U KV0CU[0CU:*00CU (9U. 9UP``;` ` 1'`8UP@vqኾ9`8U R 0CU 0CU 0Ud`PT1S:  3/0`0 b08U % 0CUa 0CU 0UFe`[7U 0CU:l0`` 0C7U /70CU 60U+7U K7U 0U 71`` 0)`7U ^T7U 0U`P-P` 7`&w`P! Q`P T` f`P0` p00`` 0d0`0` 1R`PPPi @Tt0 R00  㛼6@e . m $ p˽  TP0`t0p0`` 0t0`` 0`PPK@ ,0K2]`P  00 `P d0   "d0 (0B8d0 z"00 `P6  $q][]PP ᳷ D0 _(Kl8l8 0-PL㞷t 0@0@ @( @吷4080@4 <@4@T  h0S<h00hl8((00 0- L0(MPK0 4 , < 8 0P <0S <K0S (@K00 0SK0%(\9HH-0#" A0: 0 A  AQ0A0AcDm80@-PR@00 0!\!""0"!0m8@-pR` @P@@ 0 ,>#!^ """!1# l8l8   p-@LT`P6 T T/p # #p0S 0S0S @T  # #p3000 00   00#p@T  l#d #p@0^  0@000X B00{#p2c3c2c2c -L M@ᑴ*PK0pK `P6hBT,@T)  6#P 0#P 00CS 0 R07004`  l20Cl2 #Pp2 0Cp2 ᔵ`$K Ꮅ -L M@pF*K0K` BPP*0[wP$Kq00[ hBT@T  "P  "P 00 0U7 @P  "  "0 0h" R h"00/hB l2 0l2"Pp20p2/4P+7P -\ \:6S0d0\-P0P0l040\0\ )r2i 1i i i -L@H 2h”\ ^0700 Bh”\(.( -L@0`2< D0Cb2a" @00/00 c2 edc p-`2L@"P0 `iH14 hp j`lP0SPX&0i C"0h20L phl0(2((.( -PpL`@Z0 6 & !P2  !P11<<110 0@0@1  % 04"48#HP1TD D1T <1TD 41T00S 0S 4\ T%& !P 6^0S 0R0SY ^PP  !@0T6`,cY2c5݆?cLc -L M`PAAPp 2@ [(K&R=L1(1(2(1(1(1(1(1(1(1(1(1(1(1(1(1(1(1(1(1(1(1(1(1(1(1(1(1(1(1(1(H1(@.K  f!뼀 }^PP7@ @ ἀ X!  T!C@8[-/@0.K @P␀ #T#@D.K 0da@P1  6  C0S , 0:^P  j9ʚ; 00S S/Va`R/\0S9\0/p0 Q-L0CQ:D0Q %0CQ6@06=0l02i i -L@ S d H00S h" [d0 3A-d9 -40\ @RL&.zh p- L`P&@P p 08w,9 l00&40 0T!H1 0Uh j0i L 0gp)\ 0 92(2(L3(h -$LP hC-3c90- @P@ P 00/Mp- 0\  P`P` \ 00S@TP \pЍ/@-xp`0 l0@U  0 @ RS0V 3c -LPp $0`&,RP0 Z w x\00000  Z S Z  -PQLMZ` V 2R. 2R@ 00St0S0@0(0,@0@0@ 0$@  0S 0S0\ ` @&0`p00 P<PC  0S 0S6 0 p p@P  p 0  Z p1 p!PW00` ! 0PW`P@ !0`0P @@! 4P@7i 8i8 -LP`@  p7P P `p0000  0,9 -LM00P4 0 P $KP`04K`@+4PK`< P`0@,0 (@ ,K0 P 0 ,K0,K0 PP+99 -LMpR`@P0PU@-0S  0 00Sp@- 0@PcUe\5*0   0`Q  ^ T 0SQ 0S p?R00S eQ 0SP 0S pr3p 0\à@-0@    @ @0 -P` Lp 0  0S0@Q :* 0 RQ /  \0R 000Q ^f 2 @ 0  @PP0S:  0   @ 0PP00R  0S 0 S /000S/ / -pL0S`0S 0@T  0 0S@0SP U 0PX 8/PU 0 p-L M`P^ 0S:Kp@  l 0&P `0` PP*00P8 40#a*cccc9 h 9 -\ LApd0 `<0@@ 0 0 @P0 `H cc 0-@PL@T0\ NP00h 0-0@SLP0P \ 50P000*<9 p-@ LTRP 0` 0S 0SX 0CS 0 p0R d)pT) Q R 0S0A 0 p)p 00CS 008C8S08C8J\0 S  P RP 0S T T  0SPv) 0 p4n)p0$0!p9999`9 h -L@ T@P0S R0U0U R0 0T p Q 0 S R 0U0S 0 S@R 0S 00 0 \ `P 00 00 0@000``p )` h09 -LMⰒ@0`T@!PRPT%Uㄢ||2 E8 e3Qk*0PSh 0RS BQ:`aU"0T`1 @q TL!``0@ 0  @@0S  P@TXppW0 P @ 0 ,1, K 0x,0@S2\P P Q0h 100 0  d 0 00d0 R 0h1000@V(  d0LSccc@;chXm8L9 -LM0 P`@ 0  @@0S  e^PVP  %P P 0S PU:P Pp^# UL 000Sp` 0 @ 0V@@0 @@ 00 0  @ T0@S@@Q 0S!0S   0S`V  0Vpp0 pp0pST@ Q T00S 0S ` 00CS 0000R 0  @'-0|99 h -L M` @ 0  @@0SPU00  Q *0 R 0R  Q 0@P(K0"0S  0S Bf100U40 PPU  0U 04 RPU10,0 @PUl04QlPUe 0 pP 0\ P  S 0 0 0R !\0, 0S0!Xp1Z0 0  "0 0p 0 0# ^P 0 R !P0  0R01p W|0  "0  0 0#\g TPcPac Q0-L@P+P0 0000 0P  @P00T00S P0P00T -PLUPp+  R/ U@`#0`S(  @R" R 0Z P  0R:PW  `  w 3 -`LV08CxW0 08C8J\0 S  P RP@T#@T 0W0P Y( 0.0PU% P  0R:1Pڌ P@P 0 0 0000P@ 0 R 00 0@ o%% h909 -LMQPp0`%( K0( @RV 0 0`  `( RR(a0 00@0 `P@ 0 P @ 0-@PPL] R000  0h蓾0 / p-@PTL`7pP0P dPpP 04 a!0S00@@pD;cH;ch0 /h/ - QLp@`0P0 S 0S-`%U`" 㴩T1`U(U(U(U(U(U(U(U(PU(U(V(U( 400hS P30 lP0  :PL咝@PV @%T V 0/PP/P@ U  P`0l!PqBK} K ,0K21C0b ?A1c0z,h(=jgfff -L M 0@0 S괌((X((`P,P E@P00SAX/ , @,@  ,Pp @Z `Q 0 70 0BR0`0 HPP*p W@00P0, 0 0(KP,P ^EU@@P00S +pE1@DP,P P,P D 0-40L@0PP XP 0XP D8000a0h 400400hNx;c;gfff -L`R@pP TU P Phd00C0 00C 0< N (00C0000=j܌( hx;c --LM0 pR,0 \d2@TX P@T3 0 !0R1S R SP  < P P  4 P` R5 0Q 02 0BSM꼒((((Ȓ(Ȓ(U d `X0P `0aR  R  40040hC(K 0P uWP MZC8p240`U  0FP0  d `X0P `0aR  R0P 0 NWP aMP8 r 0Rz 40040U0%CPoK0Pkhʚ; -l0L PRp`P@8U P s $$ $0 ph5 h;cx;ch;c p-0L PRp`Pp@5h07 060d,P$ $0 ph h;cx;ch;c -LP `^p @P0@  p帀 T 嶐$ 0 @0 0o h;cx;ch;c --LMP@ 0U40 ,@ 0@ @  0SIGPP 1 0S`V p B(KQ+p_V V(p P7p  0A8ȟl1P帀 0`, `00V PX0S c,@ 0S 0S 0C@P@,  K,0KpP, PK  000 ,0 rK5 ,0 `P 00 !, 40 60400   `]0 K`K0P ٬@P7p   㓬@  K02, 0d@(0,@, (n00 0, & ,H0 00S Sj SQ ,00P P0S KpP`Q ,-pPV,@ ,@40S ` , @4,04000, 4` 0, \`,@P d 00 0d0,@H ($<,060, n00 0, d00, `@, 4@T ,04,@,$0X 0 X ,8 $X0 0X0, n00 0BR? KpP;K 00KpP20 $H (0 n00 00 & 00d  0J 0S`lq=j;c hx;ch;cD9 -LM0`S@2 S5 PK@ 00 <K0 `nP 140 600 R^K 0t  `<0pS PU 0S K d0Q 'n0 0R@R 0Hl(0 ,d  n00 0h00C@0F @0帀 0Z6P00000n 0a0 S=j -0L@MP pR `K\@K@ 0D0 !0H P <0 zP 50 00  \0 0g` R0  0 0 h;cx;ch;c 0P 0CP>@t 0C!/` @#2// 40P 0CP$0PN=@ 0C!/ ̇ P P10/"10/4/ P PP10N / 0\ڿ20S?000S \/ -H8LS@0CSH8 06 H8S06p@-@P`0"U@Tpb0"PU0p0" ^" 0S0R  ^P0,0,P"p8H0P <0Q00P0S/ / /0 00S  00SLR@/ //R0@-X@P \ 0S 0S "0 !B 00m8 Q-L QQ/0@S0(8(P(X(`(h(@(H(7P  PP nPP,`0$ lHT9 Q-L QQV$P7PP: P6 0@*S0긧(((((((((((((((((((((((((((((((((((((((((((HP 0P `PlP`@ 7nT9 p-0P`@LP`RȨ((T(Ȩ((0@P`|\ 2 R0Sp<h0@P`0@P`pln8h9 p-LR4(((((((4(p,HLQ0O P`ph9 -0@p 0$@ (, 7LSI 7(P`S5 S6@ (, \!00CS l(H($(( (0P`(P,` (0P`(P,` (0P`(P,` (0P`(P,`0 R 4;0\U0@(0,@7S  0P` P$`y0@(0,@7 8L"R  -LdM}@ P'0 Ps 8K-x t -0x@S4t Rdx t0 0x t0 -0x@S4 3! P; @   0 Pi7 xQ ?0"0Q|0 |0S|  0px 0 K @P`; 0 0?7 Y8[P70[S 0S  8@KR0(K 0C8 K0P 80[S&P80[S!8@K0 P `p;@ 0 7  1@ 0 80[S= #pK HK P|1@x| (K\1@ 0 081@K  0Pg@0  @7 *PPMU! 1/R! 0;O `p0  7  6@ 0 PMU7470 0 @Pd 0P 0`p8@B/ R-L@\0TT 80@ 8, < 0Q0bC|99 --0LS1p`m Qm1_AP 0S   R_ V0 00Sr  0S .7 1.7 ^ V 00S  ^Q 1.GT@# P 1.'R! 1?0Q z1.GuT@n4$(0`58 o89T9 -7 P`0@0Lp- 008#QQ 0-0S1 p0Q`@WH0 Q0(0 @ FJ$ -에0`@ QL@PR  0\aP TU U    TU =P"  00@@T@=  ZZpP 1/R! 6@ 0@@ S  P4= 747 ZZ47# ? S7_4S (Gv74LSP @P Z   YPu ` 8 S74 XS/P`-0S6`V :pP ` -pLM -0`0P0P U` 1N0S NP 0 P8P# 0 U0`= 0R!   7p(7 17 = S-000 0S-000 0S-000  -0009 -@LI7>%t"}Rx2 x2x2 h, -@L &V0i H1 0s0000|0| Rd  d 10b\ 00St2 ?x2@x : 1061h)8;c<90 0000  /0@-1 @T^* T91T^  T00S00 0000p!00 B4;0s03S 0S00 000S1  :4;0C0C:4; @ @  00 T00S00 0S0:0   :S  R00|0  :4;00:4;:0s030 0 T00S0[04+0CR  ̫< 7.  0>. 0 ? 0/? 0 /? 0 2"/((@P&(((((((((((((((((((((((((((((((/ // //7 00SQ/="!B10b> 0/0 0 == p-NLTP`@@T 0R! kP V cPp -L\MP @p`QP)tK  m nKi BP!hK _ HK[x0xXX L00 0C 0 H )0CPP -LOM`d V p* 1@^K2K08 `V p#H d *K BK  ,K VL@K (K p-7L`P@9 0K 0 9 p 0R>:0 "#A10a> 0 00CS/(((((((((((((((((((((((((((((((0 0  0)S0 SCLR0S 6p0SQ/phphphphH  048# @(R"!B10b> 0 0 0C-LS(((((((((((((((((((((((((((((((L6h+h hh -0L0C@S (((((((((((((((((((((((((((((((zhI 00CS(((((((((((((((((((((((((((((((/Rkz -NLT` @ RD0D0D0>@ D0H  ?NT"]pW 21C! c. QpP@  W h -LDM 0\ 0C0@  p$@`P 0d `0 dPK`0@\l0 h@ ,l@#$0@`P H#H$8p0!,X Sp` : X  =0=c5h080S* @0PK  \ T K0 80RKS0K  LK FK8TK  B@@K6 pP 2\p唀 (KX@ =0=5 -L$M@p0 @00L K080 PJKK0K  DK >K LK  B B3P 5PC 0 0 L0P 0 0 B0  `!4 08@K040 "880 "4<0    Q  l 0 0  00 0@0@ (K= 0=4 -LP@  00 0-LP :@P 0_@0 -LLMP  d `0 Qp0SK\ S0K0 S G0R K QK @R0K KK EK0 0S 0? K>0K=pKz 0 S 0 0S00000p 05K 4K50K0h0 p0 d0`SKl#|t 0 t*d` *XdX"$#h*4`l WU 0~>N>,@*0,* 0 09g; -L(M@p`Q((((8K00S0,0K00S00,0KPPK0+0K)0K*0K1  0  g@ @T (K8K  2K 8K  2K 8K  2K  8K -LXMp l d t h p0P  0RSdP0 @R d 00S  P`| x x0|@$$,0@H p#H80@ L#D<P`t0x@ 0@xD p4R` \ *p0/@PT@ p -P 0 BiR 0 T 0S T dP JT00@00h@!!R @t` 0\@"X !8X8U$h"H ht E⠐0!1 0 Y`L@K8#8 h oTP0paXhp @PX  0@a0g T@! h0zX dXX pOP@ 0W 0pU` 9/P` iX , RPP l p=0=.T.0T0 T(KS lp=0= .x $T d@00Sd000+.1T  0pX0 @t`K0h !!p-VEh0t@E⠐K0S:`\.XX!h5T+;.1TT0 0l@p=0=-T-T p-@T@ p-T@ }p-T-l=0=`K T n -LP@  00 - @LIP0 1!  -L,MP T p L a.0PH0 T i,PH0 0 fR H 0S TH < < 00 @0@H#4<<_  0 03 00 "880 040 @ 40L !Rk 4 P`0@0LPCo` 8@K9 L T <0`YgH@`pD @ D@b 00gT@! @D @   dL0YL`p @D  0W0pD0  0 VP-P PfY P& P U`` P   PP T=0=,H,0H0 H(K L0CoP"88 L0 1+-1TP P0H@0 * P-P 0 0 0PLP0<!T @  @0L嗾 0@P 0$$$$ P @ L 0ㅾH 0 0 0 TL,+H,H1H T0 0 -L(MP pL P H P0` 0R<@K  9K  H)P "-0P@0 a P *+P\@0 0 BiR |@  0S @0 @0 @  fZPPVP@@ PD  0@a0h T@! H0D dZD 8P@ 0X 0Up `,Pp iZ  RPP`` LL =P0=+@+0@0 @(K+1,1T  D0P,@K 0 *0H ,0SP++@,@ 1@T0 0uP|+@ LL =P0= -LP@  ޖ00 - @LBP  -L$MH L ` D U,0P@0 L ]*P@0 0 R @ 0S L@@ P D0\ 2\20 ŠD01@, ,4008@K30  5K  DL 0eZT@@`0P<0  0@a0fT@! <<   dD0Z;P`@ 0V 0`Up +Pp Z  RPP  HL=0=*@* @ @(K+@+1T  @p< (P+P 0 0p<@ 0 #Ƞ#\#0PD0㽼@ 0 0 0 L*UV+@ +@1@ T0 07 0 S00RS/S / // -0h.0RL 9h>@0#200   N000N "" N04\0N7 2S 3/0S `= 0`=/0S `= 0`=/ - 0LS='0R=  - 0LS='0R=  -LM7@SP0  0S00 %>$   0<  - 0L S`𯝘 04#1@#"BP2Sp2S? t0202.2 S.  3/Q oc - 0LS@𨝘00 $("8{") 21C!Pc`5S2S  3/Zpu]5S@P5@q) T 053RC`2S2S  3/rh -@L h0: 0-LM@KP  P P P K0@K \ P00CSX(`(L(L(((r8r8 0-LM@KP  P 0S(((@(((K0@K | P0S(((@(((( r8r8 -@LAPp,P0 Y 0 0u: PPjYk:0 $("10Y_:`A8!#Z P`A @8# P 1 PI0SF  YA: 048#8! Y05:`C8 #X00 P `C@8#8P 1Y: 04Y1:0 $ 20Y :R0Y:2 P )(*0\ `=(0`=/ LZ0\ `=(0`=/ M -L4MPP L=0L=(K7S ^ 0$X 0  T  8 p0Y40 `: 0Y:0L D < P H @ 0-S@`  SP`  S `pY: 0Y*`=0`=P0S 0SL0P  =0=XT 804$H0D03 H0Qh> HyP"000@0S  z<P <0  U v$x2   A$X2 R 3 777 777$2Q3#5$20Sm Sg 767 !000 L6 1\A@08 #888 S,;0,;x=0x=2H` c=S<` _ S 2SL` XXR`=0`=R+@K  PGPE0SB0D S D ::L9r8 p-LM PQ ` đt=0@t= Kp ĆD ȠH,Ƞ$H@$ p-`LQP@ oP p  jp 0@S   -LpM #R0 (K8 p !0&`0 " $PT #0P0 tX :% 0X\ %p:\00 |0 ` 0 x0 t0 p0 l0 h0 d0 X0 0*S S P  5P 5:S S P`X: p0X*`=0`=Q 0S R 0` S`1.'R!d=0d= 7S `\ Qh=0h=`0/ @ 0P PP& hQ  d R  d0P0d0 TP'48R#x `4  x0S  P0$000GT 0S :Q ;@ :0   '0 0  -?0$0#sp0X t  |0' xP ]2S |P Y -S hP T 0SQ pP O=S dP K SHR`=0`=BR ` =R 0X0 7+@K O (P+0S lP ' R$S"0tSt 7 F> | ` x t p l h d X tP  DPj !000ipQ ?@l R ?P00]7SG8;SDt0X S l1 RO 7678XtdQ ,1   Ϡ 0 0R > 0 > 30'  0 Q'5! L KPp@HPH00@  <008  3[= L KP00l UPPXX0767< r8 -L M7P`p L2S V P 0R 0(@K>#K l0R =0=$L0 0@P0@  㡱ꈎr8 -`Lm"$ 04"48#xW;ھ 1R" 0PU2 %@P,  0S+ eH"` 0S,)`PH=0H=0S0S ,"pG0PUH=0H=mV$mS$ꪪ -LM` 0PSp :@00S )()4)\)(PPH=0H=)2K H1R0SC 0F0f8#8 $#$"K!  00@  @%@$T  $K2K  ,K  2K2K  ,K 2K  ,K 0SFK!ꪪ 0-@LzP#000h{ -LM`p!28#8N8 ,0 @P0M(K2>0Q 0, S PU @0 0@0@#`00 S0 00#  !P00  P4 U 8H!O# 000 @4``@tO@TtO @BPt,b#,o,N>@2M ` -LM` p@T!  PP |0 $Ap0 h080X  @@ 380$Km7S $Kr88s8|9(f8 -LM`pP80  PU$=0$= WP P  (Ko#@ =0 =I  Y4  U$=5, %02$=5<:0SP@0P @40 S00PY5@38 0/ 2 1C! c %``PR00SRP00S 08 (K&80  30 0@0@ 0 Y 7S 10 #2R8#0 <00 40.  0S,=0,=| 7S 80 0 00; 40Y V Y& YR0=00=7S[ 2 P TT[ TY 6d QPW@ 80|(KoQ"7SAR0=00=<7S ' P(=0(=06  0f7 < 1 60@8 0B <=0<=P=T0P= % 7 0@TPTL=0L=00@  pPC 80800@@=0@==  pPD=0D=4 P  Ѯx0 00"5 ,0 (Ko} `P4=04= ,0 (Ko< p-3@ 2L`\P0 0  "3"0?03 3*2"0\2"00C:2p - LM !0 b, ! l8 #= b 0*"*RZp @`]^020\0,>0 ,> B%02].0`0?0 V0, 0b! a0=Z.0 ಐ(Ko -PqbLg! lMŞ8\@# &80 00  =  - 00c:#: Sʔ 00h:#: S=0= g1b`Q - 00h:#: S  0mjZ<  -0` L p ^𨝘 048#N  10^80BPU@ 04 #2$8#8"&0EPU@ 04#28 #8hs< -LM$p  0 S 048#X< "!0 b i 1! b!@58 S4 z 7d"00 S2c>  0<0 &\ 0iA@cZ.4 5 , Zn505`u]N, @ %SX%X0E8?S-@ P <3008 B  0*0 8 ͊ s@ P ]>2S= 0 3/@P7 %>0>Q , = %04 040 0(KQ =  - 08 0b:#: S0 80(Kog k %%Z < l< l)!) 0S/00\ \/0S/0S *S/&-\" ڰ\ \ \0\ P\ \ =0=\00{ -`@PL0>00>kv2pSڰ02S0"R 2 0? :#2,. ,. P\20C0:ü2 hw -L Ll- 8Qp#@`,j ʠ,ʠ \*%02]= 0 Q? ` ]^020\ 0,>0,> -LM0 0p180  c1Pa1@#28#x0Q`40 {̈́00c:#: Sl 0Z.0g:#:  S, :>0> 0 b!QPz_> G*"*Q005580@ c10b 0_>p0  0(Ko > 0 >008#8: #:^ , 80 c1@b =0 ]^ b0*"* _>? 2S (>@P0 (> 0(Ko>00>(KoZN~0pr40  54p005"R 5,  (Ko$>_0$>  0]]K2 0-P@L !  '0:0; B0 [0C\%#53c0t0d D0u & 64 0&,0 l ,+p00;t 4+78;0 -@PL`! p' :0 0;pp0 0\4[BC$R(8-S0T 3535t0c0u 1d 0 6 0&06,+l 0;p04+t 8;7 |x 0 0|00|00|00|00|00|00|0dP0'008 S000'>08h008" ~ ->LMQ` $>Q ?>Q >Q >Q >QI@K! 7SL8 HKI0K4! psL>Q -@>Q \4>QH ,>Q9 $>Q\>lߍpP\80 T=Qc =Q! =Q =QA7p900A=Q @=Q =Q =Q.d=l屍pP.l=Pp Pj1.'R!d 1?008p87S7S  8p R 4p<Q <Q <Q  0p(K<Q <Q2 <Q`<lppP!<  R 7' 7 ;4p7P<Q H<QY @<Q}. 0p<Q 0Q 0CQ; @Rplp|;l7pPpP;l,pP@ <P7;77S7  ' +P4p:l pPǘ  0S774p4p77~+P  Upu7 :0 0?00? 000?00?000?000?000 ?S S S S00 0?00?000?0p06p47p#500)00+7SO' p!7"]<000=@00P`0S 8l双pP 0SS0p021Cc  spP`V@PpG/fp7@- 8p㳀ᴁ+Wp 8l[pP6A0AS2p'7 ' S' O7S  7{ 20C'ǵpd7l1pPIK! pPI0[ SN I [L(HKV4p75p0 00&l@P{ 00 p6lpP~7 0S7 <4p7r\6lpPl174p207b6lߋpP\0S 757 4pO5l̋pPI7 k 0S764p7=5l庋pP77@w 208S54p,n7SY7Sp p5l國pP@ Po Pc 0 7p2#>1PP D@P 0SKP000@P 0S:   WPpP┠E p7K  p8pHK:0; I0KI p757 4p7;7 f p00CS"M@P R2 0S/ R r0a ! c. Q 0S0000P0ac00  lpPq pPjYP@ 7 B<4p7-]00?0??0?S0?0 /0// /0 /0 /R0? 0S S S S ?0 ?0 ?0?00?0?0?00??S 0?74p67 p p0Q 8p Q4p m7S37 P`0@0*&7 ;4p7ii i4i i$i i i8iii<=jiiiiiiiii$i4i ii i8i8i8i8i r8:;90,8T T0T(8L L0 ($8 <0Q( 004(0/$0Q0/pL)HL)L)9);c 8(s0\ /7S4;0\ / /0@-P@ R( 0S%\ ) \ ^ \@ 0 0\0 S 0  0S R 0 000@ 0 0  R P,  R/ 0\ 00 S 0  0S0S 0P@ 0S@@0  @0@ 0 0 0S00S0@ 0\@@  @0@- R 0S^ 0Sk0 0R 0SI0SD \  R0 0 \0S0  0S R( ^ 0Sm R 0S 0R 00 S00 S0 0S    R00 000 0 \0S0  0SR 0S@0T 00 S @0  0 S 0R 00 S00 S0 0S    R0 R 0SP0U 00 S P0@  0 S@ y -`LV@3 ^=0S`PVPU p` 0S`` TPR 0T 0RU 00SW `PV p PU` 0S``P p P 0S/0S/P/0S/P/0S / P 0S/0S/P/0S/P/0S /P/Q00S/Q00S/!! ; p-@LTP `P`@@T@p 0-@LPT P@@T0 p-@LT`P@P  R0T 0 PPP@p0@ 0@@P 0-,HLPT ! P@@T0  R-@L0)2 "0/400 40   R0-LP@00'.40r |2t0|2 048#8+"+ RL05 102 $ 08 40<2 "0~ -@r L Ȕ\0p R< 0p0 -PL@ p[` \[ }V @[0S  r[00[0 mT= a0T=[@ -@L`Pmp @P 6/@Phn -LPp`7@P cmp0S  0S 3 #0S R@Ӕn:0S  p-@PL! "08;PAm` 08008phun -LPp@`505`VT@ 5S 5 21CcZ5 21Cc]@02@T0P 2S 2 @r 0-8LSP@  080C0809 -hP0L8l 8@PW@ Xp0(48R0V 0`S=W0=@ mm -0(48LR@0(48R p-L@`PPl=0l=  9 ''`8p p p p-L@`PPl=0l=   p 0-LP@P 40p0cl000m0d H 0 :9 -L`Olp @PU@ v8;PSDU@htm -LpP.l`+l@@D@fmT8;S h^m% -@LP@  㬀0@1h p-PLlN` @ hP8mQpph -LQ@ 08h] 0-@PL--0@1@P00h* -L@ hb-  㚀 0-H/0L000000/0P  7 00000S /000000000' 0=` 00000000 P  F[ 0<0< p-L`pP~p1.GyT@p(1@$R@ p0R@'d10@S9 9  L(@R :0R? @ 1# /0/0@@ @@#@@0SS S S@@/0-@@ 0 S@@7   P@@p @@@@ 0' P @;P@ -8\p`Lp P`Vo`1NGT@ 7 0  8p RhQNG8N p` -6LP 7! 87S7 07@PpAS,+:V@ ,;`S $PW 0RVp@W#   Hp'0( 0008; 7 {Ƭ07vP 7  '0S 707hT0C7{⥬9:9 -Lp=&0= d0d  \8%7 P`0@ ,0  0Tᴇi9:9 -`7 LSR R R 0SX  pj@PI&40`P0`S\Z&40`{&40`- =4"#400<00Pa7 R(K00P @`  00@`  00 (@"h  u08#h&4  0`@0P`  c00`P  X08  #hP00P00P| E? S0C0P 0 0F  5P /08  #hPx $00 (P"hjr8r89< 49 -"0L@M+pK0`P 8 00  0d0C0r8 0-00@0PL00C0d0C00 p-@ TL`PP T000p+1phT9 p-0L` P@Pp00%P  0#40 b p -L hP @P&x 0 .0"(0CT0;8#("4@& 0p 00b0 0 -L HP p`P$ 00$,0CQ0@p  9# #80   00b0 021CcP0 " 5/S 0C50%?R0 B)  -0Lp @H`PP00A0C0" 00 @"$ 2/S 0C50"?R0 B) 0#40 @b@ @ -R0 R S * S $SNȠN4 Ƞ,Ƞ0 6NȠN4 Ƞ,Ƞ0 V -L[ R`p p\L@:W 0<S "00PP^J 0 F 4%0\ 1 #      pP2 7P T7;8# 40 Z 0 #40M : ;[P{i[0S?7$1 ,' 00c0 00  R'  0  `d0  Cp0  08# '? < 8 p-Lp@?0`L(7QA 4%0Q   6PP L(0 S7 00c0 0p7  v -LM`Qp[ P0[ P / @L`PP0!P21    ' 7  XX)0, 0@006  w:06ᩬ$K PR 0"Q瑯p@d08 \0T 0X 6 (0 @ m r88s89< t9 -@LAAPP`p  2 P 0iSS0S 0  7  0S hX 0h蹱 -LM@` P 0iSS' 0 SF@P=0= 6K  = P=0= 7 L2S3"[R=0= o >00Swl)hl)l)hl)00;'80@0 p$ 0PU  PPP"[  @P=0= @0pS00P&(2 "!7Se 1 X 0@0(K1  "[1R vp < @ < !!0< S2 08#< 32C0"R`08#< 0<<0021  pPP 00;PpXc000dUk8 =0= 0' 0K {  w  $0  0@00ꈎ < l9 -LMpQP@`z }c000dT_ T: T" TI =@0=3 T @T T \P `0 2@PVHhF( 0P `P= @0=("(P 6 !0 8`F((8"(#8P 7S `("(P 6 !ĭ0 8`99t9 -L,M P` 0@lHP 0@p PD0p ` P` 0@`LD #D<P`0@ HD#H$8p!,,1 S@ *D  L !PL @=0= @=0=(K(1S:D L MP< D L,  04Sa b04S 0<4.J@"!BbH >@ 00. 40 0 H @0|HD0 0@808L08F E0@$@<`D0@A#DPC <  p  P0S8P  S4L4 4 HP=0=(KHp=0=(1S:8Q L )800  0R8PH`@@"!Bb> 00` <0 O`p|HL08008F E0@$@`D0@ApPLC #Dp<P`(B0@!(pD`#L4 (0  (H08@0 HL< P@ 4PUh 0S 00L H0H 0 $("H0D8S21CqpcH`凮  |HL08  4` 0@$P`@hP d` @P`h0K4P 0@@@4#D<P`  @  0@@@!( #L4P`  (H`~ pUHL PDp 8  0@,@pH`P 0@pDP0  ` p 0@#D <@ P`0@@@!(#Lp4L (,!H6 HL@ LLˆHtL !H0$8 0r8< h949 -LM01S /  0@,Hp` 0@PD0P`p  0@ L#D <P`0@(!(D#L,!p4Rp%*89  (K@ P0:̓! PK? P$ p@%P  @=0= =0=(1S:@ 48#8Z0 P a b0cP4epX:d d`0X: S 0PpX): `0X$:00S0S^ PP R+@K R +P0SP  SP7 P Q R 0S{ P  0S `@o @Q  0R  00 0  X  P^ P K%P L0S  @0S4[SD ?  0@p,H`P 0@pDP0  `p 0@ L#D <P`0@(!(D#Lp4 0(,!01& 噩 ,ş8$ 0 PPI  04S  |0Sp F E0@$@Ap`D0@ P #D<P`C B0@!(#Lp4pQO 0TqXH1PPQ yn  P3#  `VX q  0R@@"!Bb> 00 0  |H0(8008F E0@$@`D0@ApPL #D<P`C B0@(!(pD#L4 (  (0@    PbPU\ `0S[0 $("H0D8SR21Cqpc> 00 0 :|H08  0@`$P`P ` @P`0KP 0@L#D<P`  0@(!(D #L4P`  (`~ p  P@ 000  0 L  VP .@K t `P0S 0S P @@T@T@ PP =< r8t949r8 -L`Mt 01Sp 0  0@,Hp` 0@PD0P `p  0@ L#D <P`0@(t!(D#L,!p4Rq*a b0cP4epY0:d d`0Y# *)0PpY`: 0Y:0SR+@K   P0S0PpY`*X 0S (Kt 0SS<X  ptGP t0` t!p0:M  048#80\a0b $("(c Q00\0S 048#H 0B8S0SS"R 0Q1 !  /   8c. P=0=0S0S0S 0SR   0S  W P   #} p-@ TL`PP T0 00p+1ph|9 -LpP `PC @1 0! 0  00S00 00$(SS"(08#( 0S! 0S08#( "4 0 0  C Cq0CB#4Ac Ba0b i膣  08#(ꈎ M-LM0, 8 #X40 0@ yP( Z c @ ;8#(@#< 0 ,;1 08!"8 08!"4 08 8714 04!8"8804!8"4<04! M? 0@418A,@&,( ?$KkX400$D<@ #\#pT l#4<[@<8@ FEpDPCB040[A0!8 * $K9 -LM` pPL Pc V/1 0,!"8 0,!"4 0, ,+14 0(!,"880(!,"4<0(!!D 0S0 c 0 6 ?$Km!Ⱕ \80P 0#40  002<8#(#< $Kh99 -LMP pP> `c /1 0,!"8 0,!"4 0, ,+14 0(!,"880(!,"4<0(!!D 0S c0  0 0& ? Ki!R @804| K|@40t99 -LMP`Q<  RpP; @c 0 0  B: =0cS  >` d 6 0$KmG!P8 0@- `,@40 $Kt99Q7788772 S-L3/ 0-7l@6h 700!= PQ L0S 7 77707770>7S 2/7 / p@-0```= pWps2S>0>p7S   0 >0>p\0+ pM^ 1@0"R, ?S<>0>p< 7k S00R/k0ʔ -@Lw+yh( -L M4  8s4p4 ? 00 [`p, ZRi Vf P\X00@  X0T @ V 40 ( 0, 0T , = \G 0P2  0T, \00+ S+ 0F0Z[0[`٥ Y00[` 0 V0A 0Z\000S , 0r0300 (K\ Q 0S\P0P  P\@  -L0 Ƞ8^@pP,Ƞ#h7\S=0=7V 68S,;0,;x=0x=⩣ 08X  Ȑ0000(L80Q/9< p- Q` `VLP0 0C0^S@0 0C0^S@TtT`PP\UDphV 8Vp@@$Tp@,9:098.: -LMW`U@p TO갚) )К))|)U UF4+[0R68 '3R'C@+ 08X:;4;p0\@oK3  3# ?#l3@\ßh3 ` 0 T+7 0H80ES)),))0ESH)ܜ)ܜ)8)Up U 0707 ! 'p@ [h2  Uꠜ))))l)w 7S0C0 07S0C0 00H8w]y[wWD W00 06A!P,;0,;k'0 0rWp00 0g7d 00@ \~=P000 07I'98 PgHH*9999< :99999992c 949`9Ls8 -LMPp480 0@`W 2S  3/32C 0"h龥2S  3/21CA@cZP]Nu@⫥੥5S @5@L T k05 -32C@LM`p*> X 0 2夤1:%X 0? 8#O*@00P>  00  8|) -LM`@P4>04>VZ>@c40$A$,p ' 0bhX1 0 -LM`@P8>08>V 0pS0C 0 S hW*>( 0c  ' 0;ꫪ -@Lw y H0HH 0j0"<.007$ $0"|2 * lm),) )p@-P \S`0/ S0, S(p$ 00S 100 0P@J0Q@0SA PLZpV \0R*@p0 - @0 0000 L 0P H!D0P@ 40,0Bab/LP T耖C@B5010/   [0 R/!0S S01000 % !!/00 p-0`00@L@LPᩞPp0S S 0 [0Qp(0 QpR 20a0#20p -RL pP@pPT @t& 9/P E` -LM4@ ,Kt 0@ @ PKH)`s8 -L M0@ (KJ 0 @PK<){8D  tQ 0 S"0!B //`s8-<JQ !0 S0{80@-@ !X 0lS  1\0}>EN-E8 BS(00"S: 2 1C00 2 1C00x8GD  tQ 0 S"0!B //`s8if -LMP4  p  71@D0@' 2K=2K00<0<P&n900 P,K  0 4 K30K1<14 K 0H$K2c -LM@`,<  P p     6K 0K00 2K07 K80K 8 K<0CH(K -LM< @  P8   t0p(07@D@ 6KS0P2K<`0900  P`0KD  @< <@ 80 8 K70K1<18 K 0H(K2c0 $ $("( BR\bPX P@K,K0  X`d0 ` \0R  T ,0S P@K,K 0t  0`,000 j0KT 05`Pk ` \0Rg00 002c99 p-L M$`KL?ᇑ@P ,呑PPRKp#PxL0 S0S\ 0"j 0`0bT0S#P\, d0#P0d0,/P00@P0T@ X @H0@`@C@00C0<,P,9l}82cX9%c h(;(4TT 4T43T 3TJ@(XK0CT~6 D6u1<3T 0Tv0(0X0z3T 0TkTn66  ⍆aDJ50Sm @00S^& !0S %D@ &@@T@ !0SZ D 0SP(RK-J@ 0 FP; BK 0 <PI8KD`T1S  3/PB KT0X0@(00S#@4( ᚂ P  h^P400D 0T T0546DE p 80ZR@ec J zi i #i i@"i !i %i -`QRLMQP2P 1CP 1CP - $K0  0S?0S<1SS81SS40 S1X2U0 1CU- 1CU0 %d@K@* -TK )1FSY0 30K4 K0K  0!  d0pR  d@K0)t1U  p@T, d@T' 0 RP 00W1U PK@ݷ K44 ܷ6`K$T TԷ  0 t1 rDK!ȷ44 ÷6 FDD 強X0 0\8`KDD 宷F㣷ii@ii 9`àP  H0P 1CP R-/ 0\/R/ 0iiQ Q 0 R 0RQ// -L@ޟ0\\ t0P6 QQ 0 R80T H0T2c!Q Ƞ Q/:8 10: 0/0* 0/!h!Q Ƞ Q/ \ */ \:L0* 01/:$ 10: 02/bh -@HLP70H0 -Lp\@P` 0S s00S# !P.000  00@0 `ᱥ !0S 40S8001R CP t@-T *10S 0R0SQQ 0 R800 0-L@HΠPP HP0$ Hܷ@0 Q Q H0H嵢HP( R P0QP0 L MH00S 0S$0S(0S X0 Q0P  PL 2H0 p-@P` PL ᚷ00P30800p -LhMH@PT `xpKH`@ ჷd0P t H0 008Kp0 àl `n0d @@镭d0PKn 0凥 p-L@` 0 \ @P P O00P30(00pphV 0-@0P@LP1HP HPl0 $ 劅千F R 0 0 0 R000  R 0000 0  (00C(0"H0hFah p-@``LP  0P  $0P  (`phnl99 -<L48M,4pLPK`@!<%K 0 噐 0K`P0K @ @彐$001K -LM(@"xНP @T5 000 0,0 @T. 徝U3S l0  0S" 0S$0S(0`S`l0 (08 `S`Y R.`V  ,0VV!0@ 0(K`, P ,0S00S40S 0S0S0S 0S`,` 0@ Y`80S` -LM<0 l08 < 0 4 @ , B L1L!08!(#Rp!p1@g @g0!!!111 X`08V#X@! U00U03S 0@PpP`F0,4"48#H<0,4 80=P0@1(K   a_P (@喏$p0 <C pR 0 0 0 #z0S0 0 0P R000 l   nC3, @0S00PPKhKDXC38( @ -L@M` $0Kp !|(0KP |@P00U0S U  {WT  uW7 K$0( P @ 0$ P @T ]W YW -@0L @Q0(0 Q403`@0 hp8 -LM3 "KS@`@p /  00S S (K 0 00S80SVg 0PS0SD /|1 R1 ,0S00S40S80SVJ 0PS0S 0sSPPRKR[U% *K 0%PR[V 0 R080 R,S 0uP02K 0% P [P  :jbh -L M@0 0 P0`S@ l0 @ 0Sp0S/p0S1pK@ 8 KH0@pP @0 @CP0p80S 3SP0l!#1P 0 8 0(0`cqFRpd=j9 -L MA`^PY  Բ@P7E  |1 P@` l0P! A pQ5 R000 0@#P0S0 0 0@ Ř8 3 ( ,0S00@@B@ 0 Q<l0K( 00#R ( L40 *00Dc>c,c -LXM4`K@p ኯ0 30K4K0@ PhP* d 00S%t@K@ qp` 08 $0Kl D p勝P$HH@$PD0 8əP 5P K/P>c) p-PL@`Pp`k~P 04$48# X  O~phJQ':l0Q$\0Q(*\ \04"48# Q\00AQ d0 0QS 0QX 0X0\l S\}8 -0LP80`>c>c -QL M@`Pp@ $K>0S S *@$ ?` `z봀@P" PUP0S@|N @y@ 04pz@P`>c>cأhd>c p-L M$KS$KP 0 P`14 F$A`<(4"4 KpQMb -LM0Q  ! 00 <2  K  -LM@0 P`.P 0S BAFU(pS 0!08PBU0 0p1Z p, pPw 0`S S U0S S@  U@UT# DSSPd`     1Z<1 p(KQ 0 0 Q j 8K0 7 K80K0 8K40 oP˖P d0 4ῘY P 8Kӭ0 7 K80K 08K 40 TP\ T00T0Aᢘ!pP  0 0|4P唘g,h -LLMp@ `04"48#XdU&000(K 0$U$Q  0uP %000.`Pp%0000(S(l1 0  @AQ * *d******h*L*****$*5 R 4 R1  0004 R U000T@ڴ000T@ʲ1#U0 0U R 00S 0)SCU00U000}4 R1 001000,K 0 00Pd,`0 1|x3 RU l3 RQ T#U  10URPK `@K ٬pPK Ԭ Ь0 LKO0KPKo0K_0KpK`Kr \Kn  lKj(  00KS0P |2 R# ]Tk@pTf * * * * * * * * * * * * * * * * @[@Y@W@U1 (00PLU900 gd@@K k0 ?0K@ K0s S<0  0<0 X ~|P 00X  0SB2 HP0  09`P000  001@PK 30 @ K?0K0x<0  21C0` 10\ 0( cP>cL>c\>c>c`>c>c|)آhHc -L0h" P" 0 E0S`yl00 8Pl0l0`D@K  0*P`DpK G0 D0KC K\08# 0 K=K>K?K0DpK .0 D0KC K -L MQ` 0SP  K ŸA0`5vP 0B!S#******************** *H*`************-P(R 0 P`uPU 1 RP÷ x 0 Kiu X 0P KiZu 4 0$A 0 @u`PV, @0S0p 0 pwu뼀P0S~ i9@ƒ:u  0x0   Ki7tHp0Sb M9@:`:Y?c>cg>chh>c>c>cHh,h -LKMPLp`7P ,#(00(0J6(K0Sb8K G0 70K8 K040 (P ( –pP K 02(K  6P0H1 S 00C0\ `0S_ @`8"0( S0!0 @ K@p <  P@p$ !(00(0H1S P) $P @D! 0P  0 R  0@P!X$00$0 ,00,0(P< 7PH\} 0K81 $ $("(DRD #D! D4 $ H d00 0P 0 RYQ (UP4 (0$0Sd000``@@~L0@0L00 p|:,h>c>c p-` 0@01PC e BL' 0!0e 000e0 04"40e8#8  $#$ p -0L `RP pP 0S JPP 0@010 0  00  @@D0P 0P0 00>c -@L+T`p𩝈 4 PP ⻦0D#1 p0iI -LDMd  h \ 0( 01C\0X 0XP0 *\ @PT0T0 # Tp X"pW00W``VDTh =T gXP@TT0S 4 R(KW\0W`L:L@K ᴧ L K0\ K0K0X H0 4@ᐐP 4 8Nგ000T T$4 R ` V` LK  ᆧ K K\ LK0d  (H0 xP 0WF"*\0d P\0 W@c<K :[Q; [R 0S39 ["200 "S9 K :` N0HK K0KLKTf X  ̔@(P 4 8000H 00S0T0 \0 U,KA  ҥ90[0S Sa S+ \ 90K@b d 0"P00P0F:0[; [0SL@K  L KP h0K0KH wP! 8 㡥:0[0:0KX:0[0 0C0K 㖥:0[0:0KT @d  (MwP= P  8` 000dh 0]\0 @c\ 0@b :0[; [0SaL@K Ღd0 (0K0K,0L KH0 JwP :0[0:0K\  @b\0 @cd0 (awx@ws@r>c>c,h - @LTp l` Pt R0P00@ i0U0C0 $R000 hZ>cԦh\h -鐀L\p`00S 0CP\P1@0 00\00S 0CP@T褧h>c>c,h 0-0PLP0 @000P0褧h,h 0-L5d0PPT 0@0C0S0( 00 0T0h7ꤧh,h - 0p 01 cQL * 0  0Q  0q03R0S %000hͨd%00C0R R00 \ `0#$0$(!44"S @ D0 $!$("^:@T\3  04 !4$ $8(#8"8PnU#ڲ 04"48#U R !04"408#8 $#$  04"40a8#8 $#$ T0 `P $ 0 $4,.4("(8!(#8Rcڲ 04"48#(Q PI R0<00 ?,#@U00C0Y 0S00pp @T0` 0#$04  04"48#Ƞ\ 04"48Q#h0\s0010S c\hh -LM0@KP` pl0 00K/ K0( ,0 @IP@ d \1 R1<1@` \0R @31   0S 0S8 <#<R K4R(t@PTQQ 0 R80S, ^ 0\ 4S ^8 #8S8#8R>c -PL00`q0S 1I2@T @T 0S 0S 0S 0S 04"40g8#8 $#$(!"(  $ $)"(04"48#XQTF )딡C04"4R|!`00`0mO`PN PDq<@1  Q ; 㒤 Pd00d0 000 `P`P@00@0P0 0$q!$ ("(04"40ꀠ40040 x0t0 L 0  d00d0 00 0褧h,h>c>cԦhآhHc -L< 3P?c -LM pK $`K  @Ÿ 0@|Ÿ| 0@ P LŸL"0lC1@   R(2@Tl4T40 R0S 8CXU !L1ѓ4T41P 1RPUA)!"("(0Pdd210: P4A)[P "("(0P[P 210: P A = 9@ Kh|0t0lL}8}8x9Ԧh9\hHc>ch!h}8K}8obh9h9h9Hhc>c9 p-LM@0  Q0e ` PK  0S S S! S Kp !K 0S08# 0S  0K 08# 0S0![ 08# -LM"2P0Sp: 02K00a 04 @"48f#8!,# $8#$$. ,8#8!8S0@3l05l0#5l04l0#3l03l0#1l00l0xqR@ ƕ@ Rl0l0@0@0@@l0l0Rl0l000@@l0l0Rl0l000@@l0l0Rl0l000@@l0l0Rl0l000@@l0l00BS@x ƕrFd2@ x @q @Rl0l0;;@@l0l0Rl0l0;;@@l0l0Rl0l0<<@@l0l0 T T"TW 0S0PU PY P@l0@00l0\1T0 0 0@0g0 @zW] 0S @00r0S@ 0L  0@XD TTP0 0 l 00@. hl0@ 00l0?l0@0 0l09=j!>c -P p04 48`G#8SLE*0S010H fP<*@P5 0!0 0 @!400 0p000P p  P@ p 04"408#8 $#$  0 0  0 ʚph -LM`< 0p01 cX80 ((K 804"48#8P, @4 0 [0 408`04"4:18#( 0 :04 0 $#$("(Q0Ա40:0ı0c 8#8 $#$ 4 0P ,<0 S04"40 <0 P0SA "x000x0v4H00H04 04"48#8S-@PPL 1P80 @@S00!1,(D01(D0 @10 0 0z202, c(,8#8 $#$<0 S  <0 PP 8x00x0<\ <00<0 00p1W7- <00<0202#,hh -QL,M` pP0 L H  , K,0pH0 PP 001H0 0<# y VD KT O P 0Q 000 0 00(  0SB q@ P# d04@~ 5j \d0Yl 0 0ST80 0 0Sl r 0s V 0S d0 61P/ P0  P+ 0l $#$("Q(P3":1<10S iP 0lSQQ 0 R80 0DK3PT LT0S i(KDP f0 0@0@ 0 xH0L! 4  4 0 80080U`ir<!7 0\10000X ! 4  62 0S QQ 0 R80 0 R 0S [P0S 6 !P!< (0R 0S* 6S\"3PT00T01<1P0V0 0S X00@00 04"48#Y: 0 P0Sj !Hx00x0帿 0HPS 0@0@S) ‚P d0 X0l\0S\$!(PL00L06  MP APT00T0)D@K 㴙D`KT@ PPL@ W0HPpT 0U@ 0 & [U$ PD00D0202h,h p-RL@ P` P @p@pkS dS4S 0 PphmSnS(D1RP6 U0 0 0PP@ 0S60 Rl0l000l0l0P@ @T-@ +0 0 l00@0PP 0S@0 S [@ @@" --LM0 0 P@l0 p`-00S,* @P7( q0y0 ` x("(04"408 P  p0(0 0H  PAQ(KQ`0P 0S 04"48#8QS0S , "\00\004 40,hꨧh --LM@2pP( ,2U o PUE @0 l0l@(Ty R 0S8 RO( R 0RX"  !0!@P l t10S@0  (K 0@P0 (0TPC<(:0(0 PUX" l 00S@0   (K 0@P (02P @E$K (0R 0S 0 @004  B4 0 @#ꨧh @cʚ;,h - QL`P0@* 0t03Q0SQqt]*]*<]*d^*,^*d^*]*^*d^*]* ]*l^*$^*d^*d^*`]*t^*d^*p0^ Tx p i 0`S0SM 1ppTg0 p V+p{'|1@x *pP\pPK (0> V8p( ppp 0S0S/p0(0ep-pp9p0 P p P p8gP1pV 0 ,Ӣ^(0y`t̢0@c4@ch999 -L@`@81à PddUp!@0P0@AW 素ᶐp( tf/̕|Q QV% 4 #V 01tf㝕 (㙕4<㕕tiԧh@-@1M    QP> (19C8# ("(8S 0 Ӵ (B(R bA9C08#8(R00Ӱ0Ѡ =0 0S01AS0#!8#(B8 CP&8!̱P ü&,0 0 200viBN|1S(  S < t0b? S / -LM]0PS S, s/(K 0, 40 0 (0*0S`` @ @`pP7 0D 08 # R+1 I7( 0<, 40 0 0` ,`0(0 <]P P ``d ߔ ۔00%(@ 72 <(4"4!<0 <(4"4!<,0 0 0D ("(04"4 0 ;#40+ 00S  <4("4!<0: X2T"0X0 <(4"4!<0T <4("4!<0]0SQ S, 0b8#8#!<80 #80!010bB]0P|SB S, 0b8#8 $#$(0"0`0!"(0 ]0S8 S/C 4  0k`0@0| 0 0 % 71Y,0 c("(04"4 0!@]0^40h0x0 q 0  ]0]0D 0S;04 *h @c>c>c -@Q`RLMQp % 02K R RP VPU00U0SRF R R @00`eV00S RU 0BP U0 0 㵓<( 4"4!<0 㩓 <(4"4!<0 0 6S-t0`0@1A : 08#8:AQ00Q000@ H 0?0jqi$@ pp<@c0vi@c;n* -,$LM0P"1@4p", `V 0S䣟]0S S0P0\  0!0# 0 "7! 8 00#P P2C `L3H` Rv8#0SM $3* ! BR0 0R000@X "0?0pd10Sd!00dQ00   P0P00Lp R?@0@PH1LA 2 r3"10"0 R1,or#> 0@`1dA P@Z `F\ 7  800# "P@x o^? 0@x1|A @=#},,!0S   0M7P  0 "!B60 S0  000 S 'pj? 0@1A2 1CV0 @ Q!@ TV@Xuiui0viX@cT@c@c;n*P@c\@c P-L@ 1T T \,`TPl0'@(@C`<0T!Pl0<@C `0T!;@l@c -LM@P! X D! P0 1 dqK ` `f! BX.0S&  0 , KPP> cb? 0@X1A P 묀p0T0Pd @0 0@0d (K |2| t2RH (K  P! 0 0$ 1 P  NpPx  \  x0 Z 嬀\00b  ] +O 0a a|S0SD0Dp0T0P!= SA `0`S$ 000  帐@P  d @0 0@0d 0@P !0q [0 20   0 p0R0P000:0:XP!X} fY0vit@cti-c -0rLP|`@Pp `_P |!R2 R(0 p_X1ų10S S03V`!t@V@!@@3b/ R8 @D#h.8`#hx$ p10S; S AgL!0S01S 1 \P R8 0l@Cx9 l0 0lpCWp1`0%Tt h1l1 S 1% A5pg6R R @x0 R0! S 1 !T0 R l00l@C PNNl2@2:X_p`l@c2|@c9>c -|0GL`@p9PPU:Ep0R1tXP𨝘@z80PR1he>X@P𨝘-c -LMpP @0, K0`P 0 0R Y  (K 0aS0BD 0a0bS  0P @l0l <0 l0w 0x00w x000030S S,80S H 000 0PP 0 0 CP Po (D@D0t t 0S "2S1 `0 R!t0:t0=t0Px X0trX1T lRT!00 001006@2 4!0("?08m000;So: S7 100! 00&?0mD R1 0cS!`> 0@P1TA@/P  0(@0 @ Y 0@P !0 80P00@ H Bl0 PL 7K ;0vi@c<@c A-L@J 0\:@T 0c 0bS R@TH80D L1M0L1  l BT 00C 09 -6| 8SLP@p@T  0S  }V,  0@S&1 `0V 00000 U  | R l0 0 P FHGwP |0Hot04t0ut04t0yi -LM`0 EP P  00lSں 00lSpWP, $ 0! lPU0U0 P` 0O0@0@ M000e0     0/8 4 0 W  1QS P R0000 0$ ՐUp 0 0lQ0@ @,P尀U㲁 ,0S0,   0R (K R 0` 0R(Ko 0 Y  0R; $!0000 0a1 V0@ @,P尀U㲁,  0@_8@ 4P @P@P@ p 0,@ /8 4 0  s \ R0000 0  0R yi0vi --LMx00 4 x0KH 1 0#2S S  .(K 0R :Y 0@`jT,` TPP P  2 @10\1 \( ,09@T 0,#21S  S R0 000`n^,` P<` ,  H $0$$@X%4P,̂&.,%    R R B 0P0"!U00 Uq 101P=P LeP  ,`,``,` 0   (0 d w  80K}P 8 0R:0[000N  R 0S0sA 0S0S 0s7 R   0S0S0S+ @0S' PP <000  0R0% a:Y PPE UP  @@ R 0S PP M p;R  G  CH  <(4"4!< D0  <4("4!<@0 00 + ,0@ 0@\K d@Kc0K徊0xK @KK0K崊@GK0 ^  ^ ( ` 墊 <  㞊0, 0 R`02 J@TV \ 9PU 0R{ @#3Rd101 R |0@  @|1S SPx9A ,@@ow0 00(, 0PU Q Q D^ \ ` P1#  @ 0 0\41ʴ@T H0K0(  0 )PHQ @P PtȟX!0 b0b S0@ @0 \ P@dPX`P a1 n0dPR ?S0 0,1(1\ \ \| HQ 0T!R D00bS0c^/V !R0B" N1Ɂ ,0^@< 0O0@0@00 0, `n,` 1^0n Σ 1ɱɡ0,` ,`6VSʨ@ 00c0a0PU0U000O0@0@ RP 0R P Ut0 0t03 P @ 00cS10cS} U =% @ 0(P R 0S* R @0S*dK6K30S Sm 1P0P 1$0 ?008h70S @0dP`XPP0S#HQ D T10bS00dSڨ@{199000 0K { V101 00cS10cS0O0@0@e,``e ,` H0S DT10cS`!0bSHڤPL  `1R 0R 0R?6 S=&02 '+4 = #P 00 0C %  80KP_ 8@ 0R0% *d @Pt0PP t,0O0@0@t00@0d0Kc@K ` 0KK@K0|0 K  X1AQ T!D00bS;0 @PR00U0S% ^0S*Q `10cS 0\1D T!,0S0 P 00cS0`S 1S:6S  dP`XP 0vi@@cuiD@c viPPKc9zi-cuiH@cuiL@c8@czipui;zi\ui@cH?x@c (\PU (PVi U 00lSug00[_ 6S7 1Ũ@t0 @UAt@3 0 0bS.0004!0 p aX pʃd XXp M r0 S X RY0!0bS+0ODH0@)H0L@DpP `IX00S+1 0X0 0ᴹX0X0x ᶺ 00 0 10000x 0S0 (p  (t00t0ᮻpP lHX00S 0X0 0X0 0,0 x0S ڀx0 ` @B t0 1R B X40 <(4"4!<0p <4("4!<\06 X0`#P7P` 1Q!0\ a7`2 S 0S0S"("(\0 04"48#800 cQ0ՠ0 ڸ& 0Q 1("(" 0 0202r R 40 1 0cS!0|0 ( |1S S S ("(04"40| @x00| q0%00|S;0H l@ ft tQ5l1l\l@0\0@0t` 00 0t`P  10cS0``!t`dQO 0 S   4X0|0 T ,< $8 #$,,p.T0K,A  4TK 0T| p ,dd00d0Pğh00h0t0fh t`    Vt0 `t` 1 0cS 81!S3 <8!0000@ 0R #0?0h_40X?0S< 09406/20@(0C8#,("(#80 0l 0|'/|H 0Vt D0 p TKvp 0#10 " 0t0_Jx 0wPPJ7 t 1@0S0KT@K 04 4(KTK 0aH@=t` & T"R1p < 4("4!c ;N9zi0R1\R!/0  Q/ 0-LEM|0@)g Q 0S- J_K  ~K .|> .|< .|1S# |8 .|( ~.XK0X0T :0X!K0\L0DH g.00|, _.| Z.yi@xizi vi p-LD@P`P00T00Spd0phG -D@LPpTPg d0 X0 00h0W0!P7S -@ML0  0 @ @K*8zi -L Mp@Q` (K0S PPQ 0@SŸ3P8 PŸ. P+ U V' 001@0 @ 0Ln Pi @0S D^ < ,$ !$0,0cS10cS  01 RV @ 0@:P< DZ <,$!$0$L0cS10cS`F0l $#$("Y* @h1Y,*t05t0 p10dSupA0^/t10 00j3PAP @Pd8@K[} P8K@7K` 0cK4P Qt05t0<0X?c)X*zi8*>c* -L(M@PQp` (K0S0SJ UU 0ES៕LU UG 1 R VA 0S ]  0R:<K}  <0K⮶[#[P0pUB P3 @08S D^ < ,$ !$0,0cS10cS04 0S0S s嘐 0pP 0SL03PAP @P < K0APl5)Mc8*8zi -LD@@68C8S SX06Ph6S(0 R3QAQ@QN 0-@PTL0 R0000 0 ¶往@T0yi 0-L@ P宀 0000yi0vi p-|P@L@`t06xP 7t06t0 @[D@Kp0t0[ p-6| SL@P@`h 000<U8#L00S8C88#ph06 00 00viN - LP^~PPpN @p81@P0.@7 Za@@ ZT  Z 0-S00t00| " 0C18#8(BQQ/6ڀQ0ü6p0 $1 1h!l!l  00|1|1 @0@0  w x DPyil@c*}8<*t@cp@cB?Kc>c -L,MP@ PL0 P T ||0@ @ H0H0 Pd`X0`0lQ< DPO 8$0@ R RG T P  @0P0PP 0 0 0L0LP  ,<$4 !$ 4),%c>c @c -@xLP|P`F |P4 P@, _z [zp0:0`0#$#  #   0 )0(@# 0 0S 0 0 P P1 00 001@ &z0+ 0 80 0(  0@q`P |1S S(0 0 S0 0 0D 0 00(0S+ܴ1p`h 0-L M@PPf 0@@ 0@x0 h0zd$\ 0;S<00L 0<0S<;K0h (堆zi 9yi(9yi@czi hht*09d d0S=0T 0S00D 0S=00S/( (0?0c0/zizizizi;gfff -L 4@440 (0!nj h zi@czizi 0-@L t0P6 S `0P T 400aS0h , ,0 ?0PYzi@c;zi p-L M@x t0`V% 40040&(BP1 R|0@  0 ?08XKph <00<<0Kph Pʄ0^x0l 40`0Q*80 080x0LPP_ 00vizi;zizi@czi -@L t0p0 hS ,00,0&= R P0` p0r00r0p04h0a P * 8(C89H C1S01P:000<000viB@czi@c 0-@L t0P0t0i0h  -L0M` t# |^ p!0 RJ70cS608#8(R62 &$  $ 0S8<C@  Kr(0-0(00 h1C1 S01("(8C8S&ƱS0ü6 "0?0X2 R$ |@T! 6Sں6Q@0 R P d0 X0 |1S (PP X0Q ^d6Qʰ0 G P!P 8QPV$1 AD10D1|-0100tD [5t0K^?0 4KDK(0LK40 0@Kw|0 00K/ K(0T,0 (0D; _0X00viNB@c;>cz*zi 0-LP@@@\WT0 p-|0L@P@X`}P 0X V`!P h0R:0V`1VpGPPD[phJP0\ QX`X(!10bQ0 0`V`!@c@c-c -|0L@P`@BP! 0 T1!p00n `S0S0\10S0GD Wh00 \!0 `\!@c-c -LMp`WP P0SR@ Q㕏K"! * @P 0S:QR K/^@PS2[S S @(KUK6S[P P? C8K &PUK HK&@P  4 P4 P< P6P1 P, ǼP'M40 0 0r 44 0Pr0  PPm R 0S0S0S 0S R 0S0s  PUP p 0S gP P 87P-c0vi;<@c<9 p-L MQPP Kp0S S S S* 0PP? 0PKph?T `0 R TD4 0PKph?  0@AcAhgzi؂h -LM`Yp *S& 0S Pᷬᵬ(K(P  P0 S0 P:P P 00 RP:PQg 0S0 0S/P0 0S1P (0S8P@ 8,K0H0@2PP3SU  CPP7P @ r08#8 $#$  00S,0 5 0 00310 ("(104xq"400 R202,0H 0,0(@0 0 PP4Pt(0S9Pn 80,0 0 (00#!00@l!QP-UW4Aczi=j -LM Q@p`" , P0u03T0S"TN*** *H* ********* *`*(* * * * * * 0 Q  0o@, ϫ ͫኻ@  0o-@l0L{ 2@l0  0S 0S$0S(0S^ 8@0~l0 o 0S 0S$0S(0SI ,ᬿ0@00U1 @Px@Pl0 `1`1  w x l0L1 @Ჾ@,|-@l0 %   0o@,o,l@ ᇿ@v9@t@Tn4kg᛺c  0f@(0S 080(0S@H9p88Acc -QLM 0S K0S0S P0@ SAP T \  0 0HP;0P @0S   0~?c)0{i* -@0@L@@h --LPM000` 000 , 0@#2S S/ ᷪ,嵪(K0c0K 0 Sp p *:W 0S000 0V $#$("(8#X 0 dR' U00U0S 0000c0K 0 Sp `p * 40KlPZ 4 0R0%p *|b7HK0Y0 0S 0S0s 0SU 0Sl0 : 0Y0 0cP[Ut U d@Ko0d0KcPK06K1  7PU h l0  XX@(UXT< PU @0 Yl0 000c2  (0V0(0I  00S 000H0S 0sAY? R00d00dSPU`#0RYl R 0S:,0S00S40S 80S0SL 0SI$0SF(0SCh0S> %0㌬@P7 Y h0l 50Sh @0   h, K3V h0l 50Sh @0   h,K 0pdh0dK@ P,0妽P0Ꭹ,匩 00 00,0 @0 6 hP VY (@ 0@ŻPU Y R 0S:V R 0S:0Y,0 l X40S@0   , Kc3V l 40S@0   ,K 0Y l0  ,0S,@K @0S@ )0V l0  ,0S,@K @0S! 0p@dKP ,0'P 00 0Sh0S} Y h0l 20Sh @0   h, K 3V h0l 20Sh @0    h,K0Op᯦h0dK@ P,0P h @!dKn0d0KcPK &K 0`0 , \nPY  0B $0"!0Y$00L ( sPU70x00! 000YC l000 .(@  0 @ۻP000@屲 nPT#0RP R 0SI:8 R 0RC( R 0R=( h9Ph @凲HK00l  0 EhP ?zi90{iʚ; -Lm70{i -LlM@Qp PU (K`VP0@Sl iPe P 2 R W 0x S 0t0 p v L0KLK0 mKPKL`KDK| |x ,4 LK P2l0 Yd xt 0R:0@Kmh`K0 xt:@`PKm0 g0KhKmx ,WP XPXG ["[pLK l08bl pLKL KD0K |0 DKLK 5Px p uDKLK &P hLKD Kl  | tl pLK l \0T(Q[DK"[0(ĹP%)Mc*0{i8-Q@P P*R 000P9 0/:\{i\Ac -LMP)0Kp @ᛦ)0[ !#R)K R 6 (0/0(0(K%aVT 5,  , $001S %1S L5,  , 0701S1S1S ,1S Q ( ЩPk$700001S41S81S 0SN S 0SD S00S S000(1S 1S  ឩP @ @ 0 000 ("(04"4#0庐(1 0 ! 04 40)[Z Z ᣦp#(0/0(0l00S 00S0 0 0``000I(0C8#8 $#$("<8"( #8"000 B )@[T T` h"(0/0(01 00S Sv) +0KⰥ@0+ K*K*0K  0*[48( <"4!<#,## 0000 1S S0 R0 0(0C@0@0@0 R00C@  00C@0@0@ 1 00K(_00,<$"*)0+ K00(0C@   00KG00,<$"*)0+ K 0嶐0+ K*K*0K; *0[0 +0K0 0 * 04"48#89C40\{i>c -LAMxdp +0KP+ ["2S S (00(0娥(K 0S :"2S S 'x( 0S*IPP + ["2S0 * KR0S000 04 8<,<$"* * K90SWQ )W( 0S:W} )W@G ,;P 62 R z;KK,UlX 0 +1K,!K 0(1 KK( Y@P d0'W`;00jO0@W0@u )W,BY LP  017P 00 0n @ 04 8<̠<Č,ʠ*K) K)K: P>  048<!$!0!̠ 0)0[:("#! !4!(0 *K 0)0K  P  )0[R 0 0Q@m~PPc000 00 0彤00Ꮡ@X`@$00$0孤VTc 0IK +1K,KWjZ\{iT9\AcLc?c -\0LP1  0 ($ 00 0僤 \Ac\{i --\0LM R1   00 0 K 00 0a\Ac\{iG-@0 0P8< 0#40   0 ! 0 8<0# R M` *\\\s\`B0P3P .0.. " A1 "4 " "  " "0,`0 (V 0 Ѝ08 <0#40 (0, "V0```r``F0 0! #0 042P .0.. "1 A "4 " " "0" 0 `# V  08 <0#40 (0, " VHHHqH  41,!(1 !1! !!, ! !0,0 00 0 P 0.(. .A 1 ! 4 (  0 .,0!$0   !80R0!L`@ O88888 -LdM`AT0 2P 0P0 0000 0@DU 0 N0Q 4, 0@P.,4P l $( 4 #l!<` 8 < p !Lp @ L ,!T P T `!a$|,.X |` l ap#Xh P ` qp !8 #4P!01@P@,Ġ Q H0 .P0DP !XPd 1hQx !|$D@1\P `Qa@ 0#pq "t  D@\0  H0@dP!x0At0 Qt`p "`!0',p !0p  "0# W,p  0v0(K88}888G-Mhp`@ h@$ P` L$`\,` , .\ p &`PX  ,$,X. .  lH$p th $d0hx ̠|pPQ'l !a4PP<`, P#<`P|0$`p *L#x0!`@(0 $@ 0,@x0h@%D&T#d<0x!40p "0.Ƞ #4*q 0pp,(8! p "0.*4@P q T`A8`(P!0` 0# " !0# `l"p0t`pl@tl p!L"< ⤓! lT #3P Qa*̠ !pLDP`l@p$@$pp0@#t0 @0pP0l0t`#D0*Ƞ0%0T0  L0!D0&X "0P #Ē0 QPH$ @P !P&dp` " 0%pb@Pp*Q @@ a Hp 0# " !pW  "0#px!| 0 %xp'? A10N@b@P, P0@ R?W@pG 0 _?W@P0 W(K (KoBb@, >b I,0!pc?WP -L$M L 1>?0@0c40 S.,0.D < 80 @0 L0 #\##4pmvmznܼNS @L❀fm 00@0#@D@H0g{  0  Pl PM舂0na0 P0#    P T0` 0fk00#̎00i$ 8Pl1 X0  P$0 PĐlq dK 0'b,p hQdp` P} 0P `p h 00lˠT1P $Z g{0q 隁 0ppfKXa0 $!@ 0 @@Pa018Ba  n @ 0@ a0g{ e[lp @  0@p`dI 00 0 nb)h0Hr `la p `0 01lip 0  la dKa pPcH0gy  `0`h P 0`l 0` P80hh  e[ 0P 0T P 0 g{XT˄  0 aP 0PP0a8@  0  hDL1fk e\ ᜐ@ 0@ 0h@ lˠ K Xp! `0 l! !0p l0e[p  ab*  pL0<` ༐  0` 0L!`dK 0}  Hࠕ00! b+ ! T1` ` 0e0i  0 `, 0``L0lʀg{Pp a  T P\vfl0   0p0p, pP0ig} @,1lA l1@Pn 1 @  Pfk @P@0H` 0Wl1 0P荁Pl1  00lˠP g{ 0 eZX0 pP `  %8Pj0$ 0#Wh0 PdKPHahnਐ0*0#  gT0 !P`Xj`@pì 0. 0#  (xT1 %`pmnpX` a0,0# @ @lL0 &pe[zlˠ dK 0  0# fk '88 h0  (` T j0$ 0#a`0g{dKHP0* 0# h )@Y@0 P i `LP !lɀ` Y0jfj 0. P 0# &PnPP ` 0,a0#@@ d0yflˠ ``dLp 0 0#]jX1 %pp`gz` `L꩎0$  'e[ 0#` H0d g{p dK0pin0* &0# P1h fk (  ሀ hpPj ̀ 0. 0# !0hq 0`[\b,0b;(! 0`Xq n0,lˠ@ a{  0#T@I`!  0P!` ꪎP$0 P% 0: HQ 0 (夀,`L;] 0p0Da % 0dc (K -0Q^q?`p@PfUpLpV@@Z* Q( aouZ@ @0Z* Q(@ fZ @@Z`* -L$M01>?0@0c40 04L0 0^#<<0 8 0@ #8D0 L0#\#pT..l<[#4)KD[<*K4/0K@L04 00K40-PK C.KP H +K,pKH0K  U 'DH  0#<0 "( 0#40  Q \Y(KAc< 0@-@0@ $0$ 0 0 0 /#EgÉܺvT2 -LZM@  hKYoOh b4bp   _0!dj i .i ( c `0`  cc,0 " 01 \ \0 (bx  c   q! X a=ii .ଐ cq-T 0 ,' i0i  0̐ 0Pb1 0i(i   , a=! L!aL bq *L c-HL1 . i0i ,0 01 0bq'D  @i i jj! 堐 ጑ 张 吡a=(-༠c <0, cc )b0 8  .0ax  b ,  8 =j|x! 4 pb!Q? `P0`?SpP`0L`@  go8T@pb@ 3T C?0YP@p ;?0Y@P 0 -LM`Pp(K  !62 b1 R<0Q0^ ~?@ Q R 1  !1PfS\cS Kx9$8G-M 0H 0@ 0 P$P`(`H`,P  0p@  00@L ` 0(, 00($ 0 ,@ 0j0!(P,@ f 0 @0 P.!T,f. 0$0@P0L0(  0,P$ @(0,@8`< PD08}PZ1Ab_`j?qā^f> AfoQ0@^ q  0@N01 joQ0@bq  0@ߍh8 -pRLPD@A1>0`9W@;@ RpG`@D  Q*H0 0@WH0L@WP O@1 0S@DR𭝘H0 0@H0L@耀cWP20:P` O@1@ T@D  `phSH0 0@H0L@ -pRL`D@A1>?0 @c WP20&:PP O@1@ @D  pj?W@<@pG@ ?W@D @WP iO@1@ @D 0-8PL@ YOP P@0@0D@H0L@0(8 -L\M<, @@H l h p P P 0 t p0 t0 < lp p0 t t K @KP0|0 x@ H`0 4 0 lK@  L#D,<4PK`!$P`t|0K, @^ 0 (KT 0SQ0PM AcUUUU888 -L MP@`pP DHL.$ . . Ƞ,Ƞ  D,, ,4..D, @.$ @$.`0PK p@$,4  0 ,@  v 3 0,40!0 0##$ 4# ""# !"!!" ! 2!26:0#`p4 P!@!4 ! $ 0 (K3333UUUU -,0L0@,0 << " 0hu"\|i 0-L M 0"0 0|"xPx0@t 0D@FLPFH h0@FK0hF|9\|i9{i0}i9`|i9 -@PLd0 80D8Q hD`|i{i - Lp`B`P W P80Ud08@ ( B@PP{i`|i -@QL^ ppW`$P0S c#20 !   \P0@0 0 000  @hBcdBc -LMⰡ00 SP? 31p`^0 @0S$ 0!/ V U 010 R010 R PQt #200 R @ ^t`VX 4p(KV ^"3(K0@ pP ,P0@`@00 000 dBchBc p-@LP0` RpQ 0ES#2@1 R U 00  Q 0 S Q pPg?U( 00  PhBcdBc -0L}q0SK RY|PPU 0S00S  00+U>l 0`P7 @3" !?3?#200 〠 3" l000`ml 0 <0P  \PP VPhBcdBc -pP0LS`P @VP#:3"@ 0S0C0000SP 3/P0  0S  7>dBchBc -L MpP] <0SZ 4 8QU 1PQ |1 PY`:d R 0`0d R80K oP00K0@#0(04(K3 " 0.0S  0@0/00@0 @|0  P p( 80(0x4 U8dBchBc p-0LP`\ 0S@ *x 200 \0` V ,0 gp $fp\|ihBcdBc0}i$+Q@-@ \0Q  P 0 SQZP00Q0S @10  -LQ`.R.\V&  \* V  R b\`FPXVp`V @@lT@!d =XpJJJ J9999 -LQp`-R-\V% 0\* V 0 S c\`FPWV`V @@lT@!pd t=WHJFJDJ AJ`9D9 9(9 -L`R?Q;8 Rp.0^p.W& 0Sc^pV WQ pRP 0 @nT@! :/P`dV(I IpI I999x9 0-LdMPP#t@K`=x x0 p l h d ` \ X < 8 4 $ T P H D @ 0 , (  K0ItBc++t+9 -P1L PN@0SJ a@ TE P, 00 R0"PPU.Nx!00S PP 7<l tP .< lk lg0@ T0P < lV P <l LpBclBc1p8 -P00PQ0SLeQ^ X0S  X"00l 0@P`uN PP  !U< !l@1S  RUa 1`l :P@D 0BSD+ +H+@+8++++x+8+p+h+`+X+P++++x+L++++PtP l @P  R0 !P0p@ PPU `l P@7 30 @ PPU`sl 0P  0R !("( 0p@ rrrrrrrl @0S l 0S 0S 01S 060#0 R0 P 0R !("(  0!S0!B("( 0S 01S 0j0#0 R0 P0 0R !("(  0!S0!B("(  0S 01St 0\0#0 R0 Pgpwpup p ppmpkpip00@ p0 000 S077@0lBcpBcCcPCc EcDcDc,CcHEcBcxBc0Dc8P8DcCcBctCcCcDcDcXDcCcpEcBc -LM@`l PpPa Xa 06 0L( KlP UL P 0 0U2XJ  (0U(*XJ e@A0?P00S 1\1C40A\.0@D0 0l/P  0CR0(l O$K( K lP BU0t(0 Wx 0`0`r -LM8@0T8  Up4 0 , $ ` 0!R 0QQ  R(KQ01Nu pP K 6:$ d@T4XQ ,0 00 2   K:4 0 Q" 4"80K /0S ("(KK3/ 0 0`hK( 0 Q 8 0U 9("0 (" `Q, PCdf9 K  0PS`@f0eT@ 2 S80ps1~ 00" ,2 `4B , 0S 0"K3/42 RTP0," ("(K  Q9 4"8 0 42$ PR6$@e T @ T Q 428  04 0( "(K 02 , n94"8 0 s4" 8  0Fw0SS(S  Q9(4h 0K`0   @KK$ "R- @ >92 \5 428 0K *9(" <(4"4!0CS+++|+|+|++$+L++|+|+|+++l+l+l+l+l+l+l+0 0P(0 0d`V 0@Tu(00 pP( 0 0GP( pBclBc////0 K0 H (-"(L (-"(L (-"(L (-"(LJ (-"(L$ (-"(L R@R-pLP`A z ! j -LMpP@,`K3 0#0P\#  O0#0#0QA#0P0 Q3@R3x 0#34K  0-LMP K#5 !4<"D\0 @  5=z K0 -@L 5400 -@L 4h4 Rp-L@`Pp! BP @ 4p 0-LMP 0A00S0 B Q$@K 0w0 0#0Q=4K0 -LY  I (-"(L \ % 0-PL@P PP00 -@ML0,9K - ML̀@0@+K -LMhKP@ @pKa4 00 RX  Ta1*080 Ÿ2l d@ < @0 hP KP v 0XP0 ` X T` X"@TŸ0@ QQP00h@KPR@Pl  PVT0USPQ V`1P @I 0X 0 `T` X  KPl P0l 0 P0 XO TH0SL `pK0@ 3000l `e0 pS8 0PU :@3000l ``y0 S P Pl 0SX H(K (><0 , @0=y >/1/1Ec,9Ec -pLP 0   R`@0 0` 00>@ T000@-pS`P@0 000   000 000  " @Tp@-`RPp@0 000   00 0000  @Tp0@-PQ0@  0 000 0@0PU0@-pR`P 13 RP@0   "  80#440# ># b1#  @ 0@^ 0-@P LX 0#40 "( 00  0#40 "( 0008 -(0 $ , 08 40< 002 -@Lz 402 -LM,PK` p3 ,[  V 0R3000[00K–\< ,[  T 0R3000[00K 0Q1 0Q11 0#P1@1!@0#T1z M1K1 0#P1  0R3000[x 000#0K  0R3000[x 000#0K -pLP`@~Vz_1 0#P1`F V@  1b0`R1!~ 120VS  2𭝘1!0#P1z_ `h@ 1 -L@M\PK`p7@1!1@0\0#0@@T  /1K -@RL@M@P`$p  01\PK@1!1@060#0@@Tx 1Kpy1A -L@M\PK`pQ@i1\ h1@0\0#0@@T`  60K -@RL@M@P`$E\p 00\PK@31 21@060#0@@T* 0K\p1@ -L@M\PK`p@ 1X 1@0\0#0@@T  v0K -@RL@M@P`$Xp r00\PK@0 0@060#0@@T XG0KXp0@G- 0$M0| l L\ ̠<Č4HX p%Č$h Px (*@&'4@%l,| @@ @ 0!0R#00c4  b0 0 0# 00P! 0#00ϠO!Zp`ᨀᩐ#`p @ <\ L4 , $HX $$ @%4,P.$ &',)<$Ѝ p-LM@0(`K/1P00.0 0@0#0Q/Kp -(LM"X0`Kp U@T Kd 0 00 d0T 8EcI?("(/ -""LM 0`, 00 P" 000 @Pp 00#00  "  0p0#0 0  ,,0@W0 (Ko/ -H$H0p!`L BP@0D /0 0hc -@L// /h/ -L@MQ@d ` 0Kh0 / /h@D0E @H D  L@ P h0S H@K0`@ \P LPT0 XP 0K @K|/`K``[\0@$L`X`0K@0Lp#D <P``0K@0D#L4p `0K0@#4<$D,`0K0@#<4($LP``0K@$4$@p`0K@$<@P`@K8K0!@"X @0 <@ */d@K@ K@K 0K"/8K X/`0K0 @XP`0 \@ T@PE@TT@ XP h`0F@HPK`PU`P`HP D` P``FvP` t@Kz.0K .P(K8 -L4MX \0  X0H T !H.< \.H@P L <@ D @ D@XT @H 0Q@ < D0 8KF.(K\ 8K.< 0K.T8K8 KPKP[\0@$L`XP0K@0Lp#D <P`P0K@0D#L4p P0K0@#4<$D,P0K0@#<4($LP`P0K@$4$@pP0K@$<@P`8K\0!@"8K 80 4@ h.0K <d.PK0@ D0P L < 0 < D0 |8!!p@-(0`"dP  0". . @0   0 .0.   p8 0-0 1 0LPᚓ  ┒ 0@,00@0x%c -LM Y90 0R40 001#((8, "X#H`p $  H   %`V Xp  $8,  8 ,0S* x%c -4L@-=hG-@0 084 0<0   0 0 84 0M<0   R0 P ` p@  l0 P ` p08 40< 00 (0$ ,$  084 0<(00 ( 0$0 ,, 08 40<0 (0$ , 0 8 40<0  (0$ , Ѝ88R@- @0 08 40<00 ($0 ,4 08 40<80 (0$ ,< G-S5M1 ! 1! 0A1@QAPaQ`qapȁq $(,P !014 A"802<@ RBa?V V1 1 00q R Q{~?xQ" 2BRtb`rTH<0$ #2CbRrH<"02P pQq(%@'Q$brtlȠn0%p`T"c8qdH`p"01!P#2"&0'c*1a021eZ021` 0 (22@#,0n,0c̠0dLc<01`021&0l20p2'P#l2  #2\022,0220200(02 #2lȠ#2n@#0dHc8`02 &02l2b*0p2p2'#ap2P#2Ȃ` eZ02̂30#02 #l̠p(2Hn @#0 Ƞ0010H1 0X1 0h10x1010x10l1!0`1%0T1)0H1-0<1101500900=0 08!0(804!1 8(1 0 8( 001 !01 !01 !0t1 h! 0\1$ P!(0D1, ,!00 14 800< 0 !40!0401!1Č!x1Dl!`1TdT!H1t4!<1$0!1!$!0 $ 0 $ 0 $  !01 !01 !0|1 p!0d1# X!'0L1+ @!/0$13 !700; ?0 01  1   !1!1t!@h1\!P`P1D!p01,!0(1 !101 000 000 000!0<0!0<01!1 ̌|!p1Ld!X1\lL!@1|(!$1, !1!,!0 , 0 , 0 , 2H" L"1# #1" "1" "1" "1" "1" "1" "1" "2" "2t" x"2`" d" 2T" X"2<" @"20" 4"2$" (""3 " 0#3 20#22"#2 "!#@,P.` d"xBR AbX2aLR"p!0#P%"|rh\2PR@r4(3BRbp',  #<$L%\&l"Dr8,0@P`\2,̠r崂x.h"#<Ýl<02'|(",,Ġp儀ā|H PB.(DR#8b,r#Ġ2 !$L%\&l'|@X##8`T0@$P`R pr02 #402 #8|02%D#4t02%X#8p02'd#4h02'x#8d0|2#4\0|2#8X0h2#4P0h2#8L0\2#4D0\2#8@0P2#480P2#840D2#4,0D2#8(082#4 082#80,2#40,2#800 0  0 0 @ P`p  00|@@xPPt``ppplÝ " 20B@RPb `hp!pd"`#\%X&T'P ) L0*0H@+@DP-P@`.`

p ?|$h(\,P0D"4 8280,B<@@@A@pQ?U405ލU c r 00ā`V c40@  @0 -@Lphw( 0-H$HpP L@  d0\e 0-@(PL  0p0h6 0- @PL $((,0h $R0-@LP00@0 D (,0 *0  /!( d1 `A K K   t0KK0@t0 p@ K0K | x @d@T`$0&HQ .=R"GK30a tKPK`t p A_K`|KPT`| x H! l8!4& @A @Pa tPK`P`C/K 8 |KI?KtP p` XQ\@T$XA t`l!&=E_K`| x KK`Q,pQ!Q_K` 3@` |K| x MKxS/K P` = 3OK@UKP`)W/K P` Y?KP`P`%=3@!t@D |?3 ?ST?3@ lP "} ??C?SJl0 $0Pp @(K -P8LP`p 0`R1!\ 0 0 Q< P8𨝘< `pl8W W80 0Q< 080@ pdW` -L(M8, P 0Q <0<0 0Q00L0 < H HP p$ .]%}'M$-100??#* ?S??s M$?3)m?0C ??C@PP?(@? 0p p 0@.040 0@ ,@ 0@P0 L@ 40K P0K%V0@<0 8@ W`@<0KP`4@'y0@tD0 @@ P@`D0Kp,p@H ,@  H040000 0$0000 00(0,000(KG-QDM@P8<04(, $t    0 "<4`p6( Ƀ.8080! " ()00 @`pp(p 0 ,(`$8*pǃp   "@@@!00# @$` p Z  DЍ - 0P# `$LP`pg# $ -LM , (0 @0`% &,0Ktt 0#@$0 @dd0d@d p%&,0K0#@$0@p  &0(0$Kemosuespmodnarodsetyarenegylbdet -(0p0 L@ c%(0'0P`0@% & `0!#@" $0P!,`"$ -@L  -L@Tp(0P0(0 iT: ` b$ eP@hT ` V$@D XTPT  oG$ -L0MH@K`pPT 0 ~K -L,M H D L0 `@ LPH  R\ \PL΀PG 0: S t0D 0 ?Sʭ L\HK ?@,Pᲀ ?pUL20 R02 0 P\W L#0S0 P W(KL @10P80 0: SsD0S0X0S<0 @0 , 0O,0p '0@0<0 ȟO < Y 8 4 qb @@,0O0 |"Xc8W`80< @0 L@@0 0t t0D 0 ? SʓHR0T R80HRN0< @ 0@@ 00 z @0 @0 0  o 10P3 60<  , 0 00  ŠYX -LM,  9/0P`,0S,@p,Q@T@a0 9/0p P`(K0S,p@,0S@S0 9/0p@P` G-M$PP`l00h 0P01>0  0$5@ 0p RT001Tx?>   cp i  0S0X d @JTb001^ pQ?>   cpG C  0`0CW^ Bb   R 01Q 0110l1X100`1$ő\ 1 0R 02S\0 P3Ѝ 1 >0   r  R 10 01 -L$MH L  p ?z0OO^P`1`>PL 0  BSLaeH L08`0?>   cpH 02ᠢ0!$PL0` p2RLH `08?>   c 02L!0#PP| 00`1ɯ D @ QL,0S PQH 08 bS180 1, !1!40 L00 0,<0 h1< PoQLL `0Oς  1>0PO>p@P` Q 804 \0 0S. 04  0 S ^,@ 0O QD  RH  0~-|C. ?(KLH,0p S0QJ 0H 0 d-).U Ec@88p9949T9 -L`MH5 Q`004 40 p(0 pǏx 8@x@d_ ?< 8 <@` 4!8@ a, QT.QT14 P/8 0 Q< 8  @ ?P  b. <@_@Pp@l h PN8 Q <@(@`00S @3CL#020C2 0,x%cU 999~ -L@M\ 0pSPo0@0T8Z0LOPo P` 0OVʹ <4 S? }0 @ \40 P8 'HP0O R,6^<<@`0?0 0,0p@Z  <04@$ b $ 4 D0@4 DL# 0 0 0 R,P1^\0?0  0<0  B 0 ;0@0 4D00L#040 Q 00C00 ,{08 0 ZIzV1>0  ?>0 @0 3C004L#0000800 ((x%cU 9D99$9 -L0M L `LLH PPT P0 00S  L PD H^U #0O0@00S T08U ZO 04 R40 p F0SFp W^ T K Dv@ < 8 Z?z `0 , 0 K 1>0 108\` 2Rψ0O0K` 0@1 >00Sy 0@ <0 T Z p T K pRQ8 4 }Z8PK` 1ψR` 1> 0 #0P @` ^$  j$ 4 D0S@4 DH0L# 00j 040Z0C40  j! 400400L8@K0ADz@@ 0 0 R#A4x 0@ <0 S 0@ <0 @K(K80,@dYn \^ 1/X`0 0O0@1>0 AR!0 \ `! 400C40 i! 40040T0 RY3 1> 020$  B$ 4 D 0@4 D80L# 0 ^0C 0  0Rυ0O0` @1 >004y0@ d! 400C4000 c! 400C40x%cU -LM ,  @_ 0 x8  0x4  ?n0 0w`, p v@ ,84PP800\ UBQL4 CBABQ0 ,0ĘT@!UP4 V< ᰤx<0PQ`004vP`1`#Z ,yvV`!@V`YL#20T 0U00 RH3 VHY@0SJL#20T 0U 00 RH3 Vr\AZ@0YL20 8PU@!@`02 08\W YPL20 80S@P2 08` BVPZ,(K004` v~ ,P@T, ,L#2, \08`V04`V U TL#^08PU04`V  T  -LMP040 00 `@4pP @ 0%2%p(K  XO ,0P>* 00 ,0 u X= H#0S0C0h0 K P 4 (0 0pP+0d0Q5h@T'dp@l0S 0l0@l0S~l@l00S0l0 00 ,0 H#0S00 [_0 DP$0hp0 0$$ J%le8999PC,9h99 M-L4M00T P S@0,0 00 S `3Qt 0a0S QARQ< D?@@c,d 0PQv0@0S@TmT0! ( ?Q< 80  \! 00,KTKzP@  p,P 3v0,0  @(K  0 , s b4pǏL H0  0P@  <K?v< K @ D@ @PJ  0HRh h ; d0,s c4rct SqQP l$SpTTP@@@  @ 4ß00c$ $@ x0S :s,L 00@<00, 0H,00Q0<4 Sʈ   RV<@D4@D_@0e,d u 40PS 008ŸD LQ4 0 j&<K 0 ?0Ueʰ0H@h  h Q d004@# c4! 0S#Q,x 4 d03t0,r,L 00<00, 0H,0@0\4KR 0?#$<@TD4_@0e, 3u 4S P004SP8@0 <0##84@Suq=4 R:T@0c\D4K_ 4Sv:sL9xe8999F,h99909 M-LM@  0 00SN `0S `3Q 0a0S QARQ< D?@c,d t@0d Pt0@0S@TOT/ 00 , @P<4 S72  Zs nQ`p2ڰ0h  h (K#3 pP @ 0!#"@84`S  ?vtSP 0K0LF,e8999 -LM P8%@  (=0l1 0 R P4 UR00 0a QUQY00 @P @ Pb@ 0b1re R1nQW@VY0:00YRڜpK4K 0YP  04  B4 X`V  0  L@K0 @ @@ `00,KsxP ,0H @4!\@_M R    00 @#wP O rL00P @ @b b3a R`Q R\H:D 0`( 0N@_0kxJk`0d  , l1 \.Q00,Kq`P@ 0R'x!k,0H  j4Q0 (0$ @ ,m(K,sl,5Sʰ0 70,n` Td9A-p8@T`Pက/.000b0X3 x x0  T0 S0 008@ TQEc@88-8Pp) P P 0 R/030P @0A#O1 g00S0P'1? 0@  `HAR-8Pp# P P 00 /030 @0A#O1 g0000P'1? 0@ ` HA -8Pp P P 00 /1>0 !A `gPP@0A#O 1"1?0P HA`p-8PP`# P P 0 r3p/1>0 R! "A@e0 0@A0#O 1#"1?0P01 FA` -LM 4 P80 1\ plWRl \R^Q V0 $400p004 00,K0 oPP ,k(K,h80S4,85H 8 0  ,  00@@^3  pQP485@0L 0p U///// -L9\%t0R /0 RT0Rh0 S8 R40!R ,5s(5 ?0 #(5TcEcC-0 LS03Q% 5p00P5,5MS ڬ4S9Ӭ4հ4S@0Ӱ4Ѝ0t0O/ s  Q#`2C50N,O0@0PL HPP@`P`/0O0U4e8<%@5DEG-M\ 0Q. ` ?0$440O3C@$0O4D@(Pp0O/oǏɯ4 D 3C8<$=0 @TDdHtL 5\#ЍT-80\%R0$Ğ4 0Td 00  0l  /Q-/ p-L MP`U Kp@@h 0`PHD 0<P$Kphe9~i94}i -LM4 8 40@hP0 L, B0,0 80i800 \/0 0\40 j Pod0p4 H4LDP`, l5. 0\#Q0Ym @ H 8 R:k,0P0,0 800 \, R ,(Kd TS b5 @l4  `\h0^Q^,@@@,m @044DPHh U L5HsP5,5S4 0054E180S hj,P, SH 00Rx%c -LM\RQp`,0W *\%0R@  K0i0x (!WF@g0 00/_d , l1. @\$Q0$K~m@P$( HP0S 3S iF@TU p-0P SL@`pPp ph -LPMD @ @@< TH0 `]DP`U@5 0 1P0S00H X p0S0S 0S 00 L10S  3/P00700^4i00600kY0SbP XD 0S" 0 {T)PD `R YIhT00S $0  6d Q0h99 -LHM` `X ` \  D d0\d0 P \P P P <~T05S*P(KDA X@0d0U 0T0  45 S: \XD 00KₘPPDXd 4 0H \@ < 8 LP ; d0\L 7Z 0jSXj Z\XRQVfT0,0X <H @aP T @ PPO4^ITP0 0So ,a0t03U0Sd000X\} TX850 p0c Y !YP0 PHH` H H 0dH,K 0 0PPXd0X 0 R:0S*,a,0HP0 K UT0@P 00@b b3a R`QdRpVUTT85@0L 0y,F_X @05D d0X 00 @d 1d 0S-X0@0 X @ Q`  0S 0S d0 0;0X Q U D0-X00X00\l L R 0X@0S PX@ Q4 R d0X0P 0S P`d @<K40@X@0l@Q  /99 -L$M 8 @ dP 08 j06D 058 a 00K& (@ @PH R U00@0lUA < 0ӊPD  ;;SPt0at00S (0 00KPD 0 n <0\j p0\g 0d0 p\b sD H2@0P 04 0S*" 0 R0000000@0 @   <  0{PD 0S0D0  (0 00KPD @00 H 0Q;0 8̋060 8 tP 0D@ 60 Sn@ 0H @0R Gn@ }8  X@P060S 0rsD@ pxQ `d 0LQL ` t d ;;S dP D00bt0t0Fc9hh9 ///////-//// -LM0K@ P00 p-LM`0KP @P00d00 Rs@F@pl 0R -$ L0S00Ue 0-L\PT @qP004  0 0 Dd0d Q  0S/ 000//E//00CS@,,,,,,8,8,,8,h,,,,L,,L,,,,, 00/0( 000/0( ,00/ @00/ ;0/ 00/ L00/ 00// 00/ :0/ 1s s s /40@0Dl00l /0@0 0@0GcFc GcDl R0l0/ 0S00/0-D0@Qd0 0<@0@TP0 @$P @0/00 000! 001@Q@- 0@ 0$@/!00100000@Q 0 S /1 91/ -LMd@ 00PY ,0KpP  q(K,0 d`t0t 0p0pP  0 ,q q  pP000,1P*",0  0 ,0pPMOK { , 0ppP0 " q,00| q 000, ,qt P P 0;0}h.c -LM80 d0 0"&1S0:S*0 ( dsPP d0 d00 d0 r trP04KS0004@0\0`@,<Qp\p`80(KS-.c0c p-L M `d@ P0dpdKp0d   s0d   发 -LMPp0d0CSBl0tS q$ 0`T0 D 0| Kp0S@t0@*`Pt0sx0s8Ht<`r㹆@T`00@`;00㬆@TV90dh. -0LdhB0 dh⛜0@-d0 @0 0S Qh0S  0@與R (0@ -LUMx d ` 0V0|1 pP0KKU p! p(KPK UPdXd@00K P0 @P ,P L@ <@ t xt0 PK0 J@0p Pct1ZKF/^pta\h0 SI* RY0 SAla 5@|Pp`q \ 0Q@h1 dA 00V1KV1K  U!KU!KNK,QU![(KU1[  c B-( KZK ፿0lP`0la .Y R0 Y :0 0~?(K0S Rt vp x0 d  0S rp 0Sjp 0Y - `0 @PL 0pP0l  d000X r0( o0ppp/c 0- D0@L PP0l Ӈ0/c -LM 0P@  0P"0l 㼇d` 0p P:0@0 0t0 lA 0@塉ko $K (0O0 @   =j p-PL0@Sd 0 d R `T EoCopd0l d \0  0`l bl ^p&op -LM`dPdpWpo@T0S  o0@0S B@l 1nn HP 0!d R0 d R @00C0  B  0Y@P 000   l \@00C00 0C0@(0 $@00@\ -LNM#dP`0 Qp 0;;I ,0KpP  n(K,0 d0 p t0t0(pP (pP Hr 0  ,fn dn000@,0   000  0 00pP 0 H0KT1 1RTA  H 0<0 00K00 <pP 00C0  B 0 00000,n<@0 @ 0  ,o00HKH 0 pP 0囆0嘆pPNK  0, 0pPl  ,00OhDGc,Gc -LCMpP0`S ( (0R ṅm(KᰅV  ᕆP?d<1 R4d (10S ᘅV  υ000  0 00P   B 00C0   l 㱅l 㭅hcNK  < 0OP h -LNM `, 0 ( (0RpP @;,0V Dm,P @m /n0n(K\ (0Rd9 d0S @nd9 d0S ^i  @P0p9dP d \! Rd @90Sw\0)0d Rp0: SDA @A  l ),dPH dPL 0P!00 P P0 00@PT 0 L!R L1lHl\nDQP!0000 ᣅPP1  B 00C0P    0lxP@a ᝄl,l03n00 0 0m 000K `@P]#n 0@U ἄ@> Ḅ@: 00@ @0孄H@!0Rf D\S QX <1 T TL!R ,gl,gPH @P*0  ,K `@Pm,d0PH1 M dL L\H LH 0RP0Ro 0m 0 P,00P00SR0S \!P1R 0 0 P0\P!0@ 00D1 D! R T X! < 0 .R 02@HP 0RTQ H!4 R@H000  H!H0 00@P HH1  B 00C0H   P!L0S H 0 L1 0: S X!R@P1D 0#6 LH@PX1S) <\HH1  B L00C0  B H000L1 0LL, Pd@ P@Pl 㱃|k,l 㪃, tk00 0 0< 0K _@Pl0^i dPP!d`Ui X1Sdl ㊃V SkU 0Okl 0x @ 0  0Q L vL0S]B@]l`p0Qo L1 p0Q@OaNOK P 0@P TQ@ H!00C0 H B H0 00.l 1jXQ T\ 0P9 -LM @`0PQ $0:  Kb5H86r& 0 K6 MP$`H 0 H\2 20 01 8 000 J bI ˄099809 -LpMp @P P`, !up(K: S3 (@G (0X  0P , (0  0pP40dPQ !R0 K00S0805 0d0 GY 8&0Qp0 0^  \   0˄ 99<-~ix%cl99 -LM @p ` RP  Q 0R 0S pW $`TG(@OGP6 TP 6 $ 00099 - -LM P8剂0@P(K6 6,K LPV860 RQ 4 $0pa00 ,0H` GY @ a 00qb P 0S<  0S6 \P Q@ Q 0SG QT 400cFApd BPV 00`A@ 0TTP,HA0 #  080C 00 0C0&,pI$0"{T  A 02 10F!@P<0<  T 4a0vF xp P@ ; 99499 -L M P8剢@P00 (K6 6,K LPW,0@TH% (,K/0PT  0, H<@@H T 00C P0 @ H S0@L0 p`B|8 R  L \d0 m 00\q 0Qq0 R0o<0S R0 0 00 0cSDS60@0 4 < R  0RA t 0 pR80080 @`P R\`'0I0 0c`0S> 0@ 00<@ D0 ;0T0 &<Q@qHH 0H@0 D0Q0< @00a40 6P% 0 P^#0|0tp/0OT |p0x@|@ 0,+p ,0H 0@0 0 000ȟ Yli 0,`S`0=@T00SX 0a0|0 Rm ` @00S V` 0S @ (000KPT lQ R\Yr06000h@00  h  I,P <0S 0Q0"' T | h0 sI@T@ t,K/0uPT } jSuX$ /@P000 ,  2"T@t0S0h 0dFc99 9899 99h9 -LWM  dR 0t p!  |!  @6t0C PT| |(KPK @elA l@00K P0 <@ L@ , @ oAx x0PK 0 oP| J@0lx!0c0R1 >*0pS0|1 x5]?KP`(@K`Q \a PDtQ pa X?*0S> F/ZK0@h1 dA  0U!KU![KV1KU1[ 08#8(0K0 Q PoZK p]K xl!؂!0 @d 0 S:  0S* || @tQ pa |A -LQMh! hA 0`1 ZKL0Sd `070 hY1KVKht 0R 00d1 U@pIh_Ÿ 0P@ LP (@K⼐d`4 8KX dXK NK 8@ D` < H T` @` o(0@\",0YP (K 0#68#80C S񟗾8F-@F-TC-HF-TC-PF-TC-XF-TC-`F-TC-0F-0O Po 0$= 0@  @P000,K/00K9@P0`t0 0R@Ppd)0S@1 M?C(K(Kp @`Kd!b,Gp0@P00xPU B ?Q,h!x /0@00S0@ 0`p@ 0d Pp7t0S0G0E0C0A0?0=0;nPl |99 -L8ML LH H < d PX P% H0@T T+ T 8 Q L  0S 0SX0 0;0U8 Q4 R0000(K<X0 @0@PX Q } 46S| H < 00KqPP0X80 T P <\4 @ (~ Hgz, 6<H0aDX@@ Y4 PR]D& 0Sc ,;0t03U0SX000\ 6@00&D0 c4 n X !X@ @0 0ãL@ @0 0 ^UQDX ,K@;PPi`@0X@PLU0 XUPPWX0H xPPg<p06Sx*P\,:XP`%U% PQ,8T~X L<? LTK 40X80l@Q  *V6 P)X!P 999 -LM  d 0 00 0 0SiP@e , 0S2M  6S c8R SQQCQVS ,K p0V=@T1$`(p,p <0cZ Q_ Ht0 q@P,8,@ @0S 0@0PQl h Cڜ 64c cb SUaQUs8 4 0&p p0t  aZ!hP 0OTl@(KP@$0  S(0SP8K,@K0 0K p0 @<@ ,@P t8P(0$  000l SllPXK @ 0SP0SV *0 ` \0  P0S 0 Hڜ@`P 6\5 c S\Q\PVP P FV|@ xP Ɯ@ @ D0Kd@ 1P ) P) P7 0XPKPYP`V{  @0pP@@0`YT0 @P0 @  8@T@ U @b3[Dp K4K L0S `0=@K.0<0K8 d 62K 0C3K L0S `01K0@ 0 0. 00 K/ KlA ,D K0@dpP (0d \ ,0Q!/XpP 0! B! 01000,J~000  CpP ,00q h=j 9 -`@0LSP_bpjJ( (0R Sb_JpU  5cpP,d0!R! 00 :bpU qb !0 00 pP 0! B!H1bpb  pP h -LhMP @, 0 ( (0pR` a,0T I,P IaK0K (K\ (0Rd0 0 qKd0   PX  bP08dh d t !Rv 00ot 0 j0: S\ X  JK,d0P`0 dhd ! !h 000}PP U 0 aPd0S d@I`I\ Rh@ 0000obPh0! B!h 0I0S# nazI,xIK0K00 0 0J 000K = 0`m0 .Rc 0aQ aM aI 00 ` 0wa`X 0Ra \QS  Rp T0 l  Zd0S ,1I`h SP0 : ,K Z=P,dP` dd d R d `0Rh0R?  0_ P,00P00S*R#0S t0hS 0 0 0t h 0X  0\ %0pJ\P0Ql0 p T0 0a 0_ d0h 0R ` 0   0 R `0R d0Rd0 0: S p0S `h gPp0TQ00S ` 0! B!`0Hd@p Q10C1 10C8#8S1i d 0d 000,vH00 0 0L 0K <0PG dh@d0YL0 c p R^L R [HY 0WHI_`0h 0R?l R `02!R !`000Ph PG l R `0! B!`@000pQIp%` d P d0!R\ Rg 5XB`tl0S P 010C100000(}GqL@HK! B!00 00 0 0 l @0 0@aP60[S#[0R  |  0T  0X 0C0< lA 0 0@a5X989|9l99\9=j..9 -LMP 0pS, d`0s0s0s (K0s(0sX0s\0sP0sT0s! (0$  0R vP 000 0T0   0000 08$T0 R0 0 @t (0$ dt@ 0 y㘐ST vP0 S R 0000R@ 0S 0;0Q 0S 0;0 p 0S S S  0fP|l0 (0$  0R vP l0j ,0 ]Pc@0s 40s (0$     ,"0 "0 1 \0 0@\0`@00@0s 80040s ,00}P!Pu0 (0$ 2d@ 0R +vP R 0S  OuP   0:0000   0 0L (0$ b iqRa0 S uP)$@0Al0m0s640sJ@0sGx%c -LMd 00 DK p- Px0 @L0 `P d 000Xq0(F0`-G`p/cA-RpP `$(@"00 bR:  Q3a0 R R0d0e S :0e0d  S* aS:\ 0P-L0 0a00P0/0a00P0a0//// -LMPp ;$P  t$0(,@ \`,K 0` `P a#P  (Kj i`i܃i p-P`L@ @` p i8 0-@PL| @ P0`i8 -LMPQ`p6 0^ 0^.:0^+* 00000 0000@P  K@ 0K#P 0 @9 -L$Mp4 W80 `PRXppxa@P3 $ (0 U.:,00V,K0K 'j#@T# ( $0 U:,00VR 1 S0!  $ P X"@T (K,40W@:00W8pX080WxpW*Xp -L4MPpU@80 { 0<%Q01Sr:0a bU,0 8 50 R 10 />0 /.``  0, 80P` VP(Kf4   40 ,80 P;P   0 ,80`P %P  4800P, P p-Q M@L ` 0 @@P 0@@P 0@@P 0@@lPh 0 @@@@0*080 Kp܃i89 i@9 Q!1P! 0`P`TV!::@P `0PU`0U @T (K@ R 0S@(0$ ,00V: R `0U@@0ST 0 % cP$( ,0  0 R 1S0!,K0KHP, 4V@:00V8`80 p-L ^ B\0P 00Q0` a2@0c@P0 `20C@PpP 0@ 10 "  @$ B 00CS0 Pp - 0@Lb 2nP00 0R000 0 p-"fL@P  00b0fS0S 000  p^\99 -LM@, , 0S,0 YJ @PB @ 0P`VX 0$@ 0P`VN 0*0S((0@3cpP-  0@pB@P# =0 0C0p0  !( A( !}ZCAfZ RPY(KM`K0  !( ( ! 0Ch 0i$999 -`PV,LQ00C2SΠ BP  R00C2S QT  R00C2SQT \pX pt%`dV`P W 0S0$p(00(0@`p$00 $ꀅi -PL!FTp/ 0`P/".00Wb A0P P 0 ;0A0 R 0 10  0K IG09p9P9 -L !Q 0hV59 -L!0C0S(pP𯝨  !DW/".00`b@fPU@a0 P'0P !}W9 -L !FT  0 P/".000b109 0-PL0@s0S Q @hATb kH0h6b k0S@00h'ꀅiii -LM vZP(K0Q#2  2Z0 #YW@``0PU W00  p r7 0H$0 ( ,`v"Z00 0b lPF Z X0 p,p  @pHW `  P3  (0@0(00`0$ T $ R00 P,0S`X``0F XW@h000Pb k Q @Tqꬄii|ii -0@SL ,PU00$00R00C2Sl  0 pS Hh(00C(0U 0,S 0C2SV P 00ꀅi 0-( !FTL" 0P /".00 b 0S 020   00C 0 R0 0h 99@9 -LM00 Sp,c0Q00 Z BB"R,C2S, ,0a( 0S7Q`10 PU( , Q00C2SV@ PT , Q00C2SV0@00XZ00 0SIPT,0`S(K @T@U  0P0XZ00 r0S'00 (Koe p-0L`p R000  R PPU @oP @10P  R 0A$0BS0a[PP 0 00ph"\9 -<1`L0V0Z0Sp1 0S PPU @7P @10 RW 0A$0SW0B$!P @1PU0@S `0V0Z0S 0000P000S@w`|i -L M@ 00P@p`PP  0@, 0@U p`L 0DP@,$Khx9iePi99i -LpQ$M@H L `D@ Չ1P< P0 S@CWeQ0 0a00P 00< 00@WTa 0S0C0@0 DP @0 DP T\LPpWAD!1P 08 0P 4 ,0 @W1 0 SQPC0WdP00 `00R4P004 8000 P 'JD 0S U0000PRH @8W(K@Q Q,00,0000DP 0@0 99 -L@L\p`P \  RU0S  0Bs𨝈U  0h<0 00RUhb 0h+ -P0L000S@p` 0Cs𨝈  0h 0h 0S0 -L M4 @@Tp@ 0S 4$0 0bQ#6,0 ӷ, Z0#22Y#b,0@SPpW , Q00    0F$0 ( ,P!1b `hP Y 4@0 0S ,QD4<0 ! 00 @`aT,`d`h 0Q`j0  0P#   0PP V1!0 Q 0$ 000  ^@,  R000C0S0j 0 00CsZ44 D00D040 < @p0S0 00p(KVfPP0E V,0Sa,2  @ pZ,0SC4D00D0Vp @, FT P PP  (0@0(00P0$ T $0$Q TY P404$ 00 c"&<0000 P$`0e#6S\  "(<0U#8X8:X2U9:4 P 40<0e 4 PD0@0D0P(Kob g Q @T(Ko40D  D 00C0(Ko440 P "4$` 4#4  P$` ꬄi|iii -@LPT00 p-PL J `P@T`0  !( ( !ATa;*Tp0i -LBP 0 Pi -@L3h"Pi 0-@LTP (0 0  !(  ( !0oDT<4S(0h0S p00Cp00iPii 0-`P M@LT 0 P@(0 QAK0hPi9i 0s0 0/ p-0AL01 @_P ` 0S P 0S 0SpPRpP P 0S00@ P`p 0Sp$ i9H8 M-L M@00< D @  <0@S[D 0" 0@@ H0 SB2D4 00 H8 <@80 aV5  Y, ,t 0S(s X] 4P` pQ10@P0PSS 0 B0 U@0S R0L00 5,`V8HP8 Z!p00jp0(KOW0`pD0OWVD Q<@0PS0OWPVZp p00jp0YD 4P0@Tp VX4@R ii p-0LP@ R,`p0@S0a!p R P 010U`P V000V000C0S R000  p5 i9$9 - L@P S M-LM0 0`0 , R 0pO# @  Z (KY 5p PP (0 @ 00CSꤺ--غ-غ--- 0SE0@TLXRu90>R(0 , !( (, ! 0CL*0pW0p O &#*0@Z0pKpڄ0O#Y0Q{ !h R:Q0i99`9 -`ȟMLVF &(*0&Z S0  pS(K - 0Ls`0CS 0Q R$0$0$0 QQ@T (: 0  !!( 0 (  !!Qt!0’dQ@TLQ @R&R00R @P R !p00Cp0 0Rc di !F:0XpQU @T 10@P QL Tp00Cp0@4bTPpWHc0i9ii im 0-L MxPU K0@@\ 0TTP<88( 0PK0h(e9 i9i -A2LMpc S1 # $0K&P   $0R`0@P@RP0S  70 000! 0 @RPc jc -LM0@C2A P # S<#Sp c 0K`P  L2 S<#S PQ R000 R0QL2  S<#SPc $c 0`0p -LM A B2 \̠# S<# S@p< c 0K❇`P   L2 S<#S PQ R000 R0QL2  S<#SPc b 0`0pYp p-`L@c 0cPP p0S 0  0Sc b`Pp@Q0@S> p-PL@c 0Yc`P p U0 P c bP`p -`LPc 05cpP  V@ $01 P0 0S1000C0SH\000@Tc Jb`p i@Q0@Sھ -LP F& 0S\1 p`@U    0@S/D P #c0⬆P@=  0@00`+ 0S5p0`0  0O @R 0$0 p$fO0c bP@ djTr`p`@0,($Hc,etHcHcHci4999X9 -L M@ YpP` D < 0  !( ( !D  D @ Xp :@P`0s  42@P (0 X  0 X<0 p<D\@ @(K0 0%@S8 '08 P  06@P 0  !( A( !.!( &(  ! P 8 0100@0Y`p4 4  R4 :@`p@T4 0R  & G&0 , T 1PP (0"0  !!( 0 (  !!@TP 1PP0 PJ6PP?@0 , !( (, !0!h@0  !( ( !@T0 00@S@ ;0@Q40  !( @( !Pt T@P @ ; N(0 G0  !( ( !LN6<M  3P @010|990i -`/ML&@!*$Kp 0K @ $p @ @@PP P  KN 0 , !( I(, ! M 4 MK0i -LpM1PUU `tMV @P'P@@P0W  X R`P0@PM @`T. P`P^ 1@P  W00X0S \P^@DZu(CM`?MU i`HcHc 00 0/M0Ѝ/ -LMD<0 0 @8  @0@(K800<40 #40#"B P0 4 08 0cP` 2P0#0 e` p,0 @ :@P`, @0X Y@| 04 0Zc9 -LM 0@S 庎 0SxLd/`0 R000   ,L h_0C 0njHc9 - LàML pWP`P1W 1W V0S0:S0 :@P`  07/ptataLPUPU 0S06 00(/$1L5L  ^PAL R  R 0S"L ^ ,000S0 00pP L00TL 0H0 0L000$K:0Zcx%%HcHc9Hc 0 0 0C 0 /Te$0@/0l$0P/=j 0-@PL0TP0 00   40R  00000i 0-PPL@0T   0h  0ht -0 0 @ 80LRP`5:<0Rp2:0 8@P$ 0$  c R 5D0 0@ @ 80R:<0R*V  [ @P 400 -LM@Pp``K K P1 U@1$PK2%* P $0T: $0ST0S t$0#&R :0R*0a 20 2JW KK0i8j9 p-`@LP   ph -bLM0p00 R22ll    P  .(0!g 0  !( ( ! 0 t@"0@TG U 0 <abPN000@T 0@2P5  0 M0 00LQ(0@0 !( C (  !( , #Y-$J[1~JT(KẊ0 000; 0 QT000,00jJ00XbJ$3HKJT  , 0  0i=j90i9 -LMϟ! @|? \ : P L H0 PKxP^ 00>0Sp1x# Z00 W0~Sp8  Wz3X@3 8 ,0K @?P 0d,S0!D <0 /{` . ,4PK@ 04@ 0P @  Z<0cX@ (KHc>00   -L$M DL 40KT4 p00 < 0SO h"h2QP8 \< \9 y`,K8< 80,  000P!4@,`T 4 ,:,0 @T 0\ 4,:,0 @T`4K:'(K@A)C0S ((1@ 0S 0SC4K'0C! S, 0 0 l0Q @ T00 +|B 0 S ` `R`^<0,  04K `&P_ ##\90Ajii|:=j -LPp눀`0t@B 0R 10 P B{+B*q+Hci p-PLMPp)@`Kl P X0#&R*D!0R*0a 20 K+JUp0Aj8jh9 -LPM($rxB 0R Zl 2   WB PqcB 0R1   DB1ZhK@ @@Yh`K|!p8*0 @P@0pP`8A1X5BP1 Q 0 hK!PR UTBZ LBU1h K@U@PQ 0*)1(K0@p  T0 00 @` P@AVꌗi##Hci9 0nS-j9 -̡LM A Q 1 R R AR   Q;* 0 1 S0P1* p X00W0S1 $1 hWp80`$K0!&0@P0 `P?pX(10 0 Q *0h6 0(0  X00W0S X H 10  0 R0 0, S0, R$K茗iocHc#x- -LMP<8Nl@T`p(KT,K, Lp0   P, 0 K8i#9 0 p-LMP8p`K! ̃.# 0@P0 mPKpi 6 0 -LMℑ8~p(K!ph 00  0@P0 IP>41W ,802 0cP`0  !!( 0 (  !!04 L(:P@zG`W 0p (@Pp0x Ll1pS 1W00S,(K, `཮,,  ai#Hc=j9 -LMp@ `.` $PK @ 0$@ P @tṀ [}K -P`pWL𭝘 #@P+ (0 0  !!( 0 (  !!0 j0@P`:P@`XW% DG@ )40@%  Pp00Cp090ii -LM>0`~0^p@0P 0` `P @iP 000T 0 00 0@P  K0 @P冹儹傹##99$9 p-LMP@ |`|0 p0  `0R0 P b 0K@P0 P 0`KpQei0Aj#HcP9 -.L M  8 80(Ǩ0!Y# 0@P(0 P0 ,(KZ1P ,08`0ap`p |1ph  a(RP4K@  0 4@ {#PA,P0U984 ,0Z0S. :@`p4@ R00000  0  0 &0  !( ( !Z0C 4,0Z0S$,8 GHci0Aj -L M0`SpP5 0S@0SQ4KP40 0 #*@,K` P L,!&R*8劸0R*0`#2 0 00  000 JU  "0 0S(K0@> 0`S00> ~ ,f$0 0S 0Aj8j9i 0Q-L@00S 3/D00D0p@-0\ @!@1Qp\ 1 !R`#`3P TQ030 "SaP^ Q0#02SQ#3T0#0 2S%pP/ 0 S(0$ ,00\/1P/ -L`$@0@PS:b V@cp V:E f@U>0e S 0SR F@U0P@0F\2 lU" R!0e S9A U R0ST0l0U 0SS1:Q0P@U 00b S9R R0e SYD0S0e SI9@0S,  `0R 1P `0R 1/ -@PL`0P`@T 0Q-L@ 00S 3/D00D0h0@-D0DQ 0$@ 0TT0ST0SH H0RL L0RP P0RX X0R 0 00R 040c@P4@PP80S@Q 0S@ R00S0 0-L@PP D0 0U:$0U#300< h00h0/ Q-&:$0@2 PP 0Q:0Q4@0Q*H0Q:L0Q:TP 0 R 0Q:0Q4^D0Q*dP0Q:0Q4 0 Q:j$0(0@-P Q0#03 P$ 0S @@1 Q#3PQPQ 0T # 3P R0T # 3S RdQ T0#03P0S T0#03R0STQ 0T # 3P R0T # 3S R\H0LT # 3P R0T#3S@P T # 3 Q DRT0#03\0S 0j-$ (,@0 R:D0\34H0R:L0\34 -LpPU/ 0S,`@T1 T R& @TP @0 Q 0` 0S0@  0S@@@`vP rPU 0 00p 0 0  R P< X? P@0T 0` @Q0S0P  0SPPP`CP ?0SP080S0p  0SppP@*P &0Pp0p 0 0 y0S@00S0p  0TppPP @p -Lp` R 0SPU 0SZ0 0`R 0S0S @TP R0 0@ T`@0S0P  0SPP`PP @@ PRk Q 0S R 0S 0R 00  S`00S0@  0S@@@`:R 0S0Q 0@ 0S0P  0SPPP@vP r@ 0R 00  S`0d0S0@  0S@@@`VP R R0 00 0@ T`@C0S0P  0SPP`P5P 1@v R 0S|0P 0@ P0S0P  0SPPP@P @ \ -pLWP8 @TD@0Sp`W`V p 0Spp U`P@ 0U@@ 0R@@V @@TX  p`W `Vp 0Spp` 0-PLP@! #3Q0 R  0 S R0P 0 Q@@00 0@0P/  S/P 0S0#03 P/ P 0S/0S/P/0S/P/0S / 0-8LP@P'< Q00R03SQ PD0$ T(0, 00\ H00SP 0T00 -P$L@p` 0!S8@T- P $ (0,0 0S*:@@P` $ 0S X:W WP P0P d0P sV@ 9P@ A0P @j P 0S/0S/P/0S/P/0S /P/Q00S/Q00S/ -@8L P< 3T 0-(P@LY9$00$00h@9 p-(@`LL9$P0$049p$phry$0]M (9 -$0L@RMh/M$0/L$0L 9$0)M 9 M-LM4 040` P @xh 10 Sp!z3S0CD  , , K00K0 PPFY`+,PU (0$ 0TI*,Q $ (0g @0RDT:H0RLT*P* 0@P@T :,P,  ` y(K0g00T0@ , K00K0 PP  a40`@y z`, ,P `<0T* , Aj p-LM$0P (@`k8!LP w8$0 0$0$ X0kzg8$0 K _840040pF840040pX8 -$0LP@ ?8PU40040(`A8$0 )8p$8AKPpP3U .8$08KP -QL M< @0 8 80Q:<0R0,0 ,(K 8<@P^ 0ZD0Q F 0ZD0G>$Z(0, 00Q5P 0Z<,  D0@4 0040 00 ^ @  $0<`Z p1p!Q`!V<J bY@P& PU# @ 00CS"%.%.%.%.%.%.8 n0,0  8g , , 8 ^0@TP jW P%4 0S00S a600CS0c$0 Z p1p!00S @ L0 D0<pbP0b 0b04P`@p0@ 0A,P, P Zq$0Z p1p!$J7g0790i -L@aT0000Э޼9 -L`PP@ rT p  gU $0R P@T,(0, 00,000  0@@ -L@p`P = 5$0( ,$0( , 00  0@ -L`@p*PP  P}PP @0S @0S P  0P@ 0P@ 0-L M 0@RPP x0SPK0$0( ,0 0 $ (,@ @Э99 0- X0PRRUL*0e/s B@T>000B -\0L@  Hh><h:47600d T1d@0CT1h6Tjjgii -@LP R0000 0 P 0-L M5 0d0 d0d 0d R@ 0P @庨嬨| 0td @寨`㡨X 0Pd@夨8喨(㑣K0hgie9j9j9Tj -Z%ZULp`e    < @q$0X+*@0(PS$@d,P  << D05 0P0 04 48 ,0S      o(P$$ bP!  b `h0@,408@0 dPtu00Le;ET$0 0-$0L 1PU Q3d@T T10T1d30\0T000000 P 夢@P \P 0 @Pd0. d0d0S00>00 -LMp@P` # 0:#:S 0   Ć Ć780 P 0i80 R>0>001010!# -LM ʠ,ʠ\ 0R lR >0. R 0^  01P  0-LM@ʠ,ʠ\ 0^* @l^ >0^ 0T.Ơ0 H R P 04d 6R0  0P 00`0S*#0i -L -LQ 0 0 0` P00 P00S#@-@ʠ,ʠ\  0R lR >0. R 0^ Tw.w.w.w.w.w.w.  0@  0@  0@-0 " 0S  ʠS,ʠ\ 0R lR >0. R 0Q  0 0@-@ʠ,ʠ\  0R lR >0. R 0^  0@ -LM`p0SP  $K0S DP*"*R 0UPbU >0^PU 0Q  040(0S% $0 " D00J@ Q(,! Z x0 R 0@K n0 00 OnURC/,0 峛4j99 -LM@ ʠ,ʠ\ 0R @lR >0. R 0T`V0TK p  0P $PK0@ $@ P @  -L,MH T H P :#:S0D >0 Z< *2 P08 40 ^8 05P L 4 T TD8 0P4 H4 PP , K]Pr ,P. 0< R*L0,<$ QSa 0R^:D0<Y!0000 ) 0 0 0 R# Y0 Y0,^P,  0<Q PIH T8 hLD8 L8 34(K@ Y@  Y@ 0R0 , < aP 0S0000S 0S,00 @4` @dP qP00 PH T8 ' 040 4  -LM`@00 SpP (K 00Q, KPP00@0S 0 0K PP000, R 00CS 0,0,0 00@SP *10 -LM0, S 0 00 ` p 0Sg |UPUY > S V@(K B@P@z'zWu>0n`V  ,  g:#:S, 0R0S4R y 0s   01 0R S 06@T 0(01 `,K0 @ T,000 R   BR  540(0S $0 -P0J@ Q(,!' U 3 R~ 8@K f 0 80 M fSo0Vx0@KP`  {D0P \RC/Ÿ,0 嚙P @W  0 S  @ 00 \\! \YN\PPL 0% p" 0 @ Q` @*Sd @&\Q \@T0 hP Z 0 CR > :   K   P01 `,K0>@>\0P 01 0R5 S 06@TS @ +  0KT  ʀS~@K(! 0_@P P0X 0S  0@ Q0 ?4j990 00/0@-P@ R( 0S%\ ) \ ^ \@ 00\0 S 0  0S  R 0000@00 R P, R/ 0\00 S 0  0S   0S 0P@ 0S@ @0  @0@000S 00S0@ 0\@ @  @0@- R 0S ^ 0Sk0 0R 0SI0SD \   R00  \0S0  0S    R( ^ 0Sm R 0S 0R00S 00 S0 0S    R000000 \0 S0  0S  R 0S@0T00 S @0  0 S  0R0 0S00 S0 0S    R0 R 0S P0U00 S P0@  0 S  @ y -LXp5 PU?P0S `X`V 0S @ W`RP 0WP P 0RPPV 00SZ   `X `V 0S ` P 0S/0S/P/0S/P/ 0S / P 0S/ 0S/P/ 0S/P/0S /P/Q0 0S/Q0 0S/0- @0 S0/ UTR p-@LTP `P`@ @T@p 0-@LPT P@ @T0 p-@LT`P@P  R0T 0@ PP P@p0@0@ @P/ -@LPP`p 0  !( ( !00C0, 0 0, U,0 `$p0,0P0  !( ( !000 -LPM< 8 \Kw Kp@-d0 P0U#F"``@ 0T !P01Rb`0^pIc8j0@-0 @@$!( (P@@$!0@ - rL\R20 RP@L0R P U3 @0Q  Q*60 0 0R0 4 R0B60  B0CR0 \4 `LV`@DPV 0 SAP!@P@ 0R:P Uؕ\ `LV`@DPVʹ|ŕ60 0 R \ `LU`@DPVIci8j9(9 -LhP \0*0  0P 0@ 0P 冕iL9 -LM0  4 0  P, 80 < @  (2(b$ȟ. 0PQ<0 @_TO T"vM[(00\Ql!L0R A0R @0 Ul!L0R 0R d (0 0R0HA :#:S 8 a40Z C$1P*VR, 4B  ,F@<00@ 8!"&0@(Ko 0@ ?SʭRD0@0@T P0U ?@P 0QʙP(KShih`i=jiDh|99 -LMP`4 Vp@q V,0S  0SQ21C  4000(K 4 Ph#2000 0P; U, X `FJ$&0RL04@<0@0D0H0: R*YG 0  !( ( !0`VPY' 021C, P B 4,  噓4 (Ko蓓|呓4 0@Pd0舓X(Ko脓h3,0 g >Ic8jHcP9999499 -LM,a0PS  A* pW$ >0n`0gV@P0U,>0 N@ U $`KP% $J 0U>hh@60>0>0 0U Icggj0Aj99@9 -递L@M0 , 0 \ 0 @@#$ 5^ p 0 0b\0!6u"3@u `#0SEڸ 0PcW@"#::2#0PFU`` ƠPʌ0L04<0@0D0H0 R 0S ! 00 0^ n3  b0S 0pePcUg^ 0, >0>00 00 >00` 0 P00C 0 (0 0, `\0TXL(K(8iIcPjB}8ji9gpigd9@-0 .!( (@.!@@-00S%(00A R0 10  0  !( ( !@00C0(0 00 000000 R 000 0 !( ((  !  B R 0  0 ii-(0 C RH 000 0  !( ( !00C000S(00  !( ( !00000  0 R00P00 0< R0 0 0 0 ii 0-(0LP R0 <10  0  !( ( !00C0(00&,0   PP@0!!( 0(( !! 000(00@000!!( 0 ( !!00  P Pii-000CS00h00`0 000 !(07(0 ! 00C 0ii -L@\ $0 0  !( ( !QA 0  !( ( !A000A -L$MPŸL`D@0@VPU8 4 <0 /<0@PPOTFt 1@ ?S,) Z 0s ,0\(0\ʘ1!lL0QHP`0@K  0 @0 ,@ PP @(KR1D0Q Po0RO 0@VUW0@< 8 K VV 0  !( ( !h0 Q0  !( ( !Shih=ji`iDh -LM`@.p,PK 0P(P  ,@ @vPP(,^% @ 0 0  !( H( ! R000(0  0  0 ,@^$KOc -(L@L7 R 010  0Ǡ   B ( - RN 000Ȍ 4!00C000S  0 00C 0 R000  !0(000(000#!h R 0 0  !( ( !00C0, ( 00,  0 iiyp -QLP`pW5 (0&r`VP @0Ds(0 0  !( ( !`VPV(0 !0  !( ( !R0i -L M0@KS8 0 ,@ G ΃,Ơ0@ cP4 50@T2 6P` P `8 e000p0  !( H( ! R000,0  0 q 080@T4(K娏9 0-L0LP@L|00 0X El0 $0lE@l4V0h.pi -p0LSP`(0! R& @0!!( 0c ( !!0,`SP' \ \ X4 (0 U!(0 R0  !( ( !`0PS 0 !( 0 (  !0(0  0  !  -LMpP@` 0 \   00 0 0D(0 0 F(0(000SZ% 0|$K $%!@P$$D|@0$8 0Ei=j`iT9$0S$00$0-;Q=ji |(Kl3Y ) `PU DTU X 4OF#J64; 0#?pPAnD+0`zpPDTU Y4p2pd 4 kpPKHH+,0KDpP+0@KScD 0`i pP0t0CS////L//,/p y0ST0! p\ P"@ 0PV  r &Pp 0Dp pP\ \@  00@0PST00 000S( ^,\  , i(pP  10Sz$\ \@ p\ pIcPjic p-PL`,U@@Tph0i -LMp`0@,P@fTK0$@K0@ $ @ `PV@$0  !( ( !@ R000 0  T  W0p$40 S%:S 0 40 S:SQxP tQ! }i`P$U |lK_@ lK ltQ  PS|@(K@3#lL0Q x0S\#t0  0OF*p#J 6|Y0 3 # ĠP,0 xHt\PP삟P@:6Q8040 t0SW 2"lL02\@0"000| @ Pp |[ @0P H00H0 x0S0 Pq |Pp@`*f0  !( ( !`VZJ|)(0Kp# pP| Gi00x;@@\00 8|YpW& PZZ Y *Tf|r0PS 0S P HXj,Y p|lKq|Y Oc$h=jig!CeLg@ . -Ll@Mt0q0 t0 pH09LK pP00P00Sp00p0i00  -L M0 S0d% @\0!@@@`0P  0@k|kt 0l@kXkKhD0bP 0r,rLgPji9Tj9j 9Xjnc990@- 0S0 06BQ0(0 a0"400@_#& U0 0T0 -LM0 p>0n`Q70 a0@P$0S, |060>0. V  b 0 K@P0 P  ahq K f 0| 0f#&B| 0S* 0| 0c#&|  09 P-0L R.  . hrT9 00 0/ -L4M0\ P `X Zj @<0t"0b9 0S_ R@@ \P  Z00ST K0R00n\0T0@0@T0 B? @ġ0 l< L  @00KP0 H` Dp ,@ 8 @@ 4 G 0SV (1@ XPK`0@H V @ T00T00S` T\[0 0C0 S V(K S@f X00R0S T0 `e0S8 X`Pl \T Xl(1XPK `t9=j -LM= - 0LS0S\.qxpD0 0@`,PXW𩝘9 M-LM 0  X0 0HW@`  | 0 x t0 0 |Pt Uzx0KpP` tP 0  !!( 0 (  !!:@p Q P`|@Tp 0`,0 5PP x`K  IP" m ( m 3 @0 P0!!( 0 ( !!(  @Y 0Qy :`@|p\m x R 0S P0000@%70S0 =0(KU`p00 @`P@00 |@ T0K0@x0 t@ 0P |` _,0 |t Q x (  0 S0@0  # 0  !( ( !0#73@`pQ]G{0!!( 0 ( !!ܻ 0 S , K00KpPK 0 ,P x@K00@K0 @P@[T 0!!( 0 ( P!!T 0^< ,0TQ. (0m0  !( ( !.!(  (  !O    0Q0 0PP^P ,0TQ0 S  0T01 T<g00  !( ( ! R( N0: 0,0 @@ m@Tj60*5\j nn00  p0!!( 0 ( !!90x@Spx Q=0i :999 -LM`0p @0U ` p KT0  0-LM@0/ 00H00 0 P0S P0000| l60S 0 Sj00    $Q(0(0(000 K0K0hp5n,:8: p-LM 0@C^ :`0000P5  0   0 S 0 " P0  0 60S    $ R(0(0(0  0 0KphKp0 hKphu5,: p-LMP8414a@0TH>(0S $@T U0 0S3 0 0 R,0, 0@$@T@Tz,@T 01 P& 0S0  $Q(0(0( 0<0^,@TKphW 0(j8j0j -P` LpW 0 S A 00@0 0l7l! L=j -LMp 00@"0j50S{  0SQ 0 0 0  0S$0 $0(0p0(<0@600 R; 1lK 0(!P"PK`| 000P `@P0 @0S$0 $0(0p0(<0  ;40 0@0$K/4 0T0 l 40  L, K0 P(0P0, @(`0 @Qd&T 8 0#40"!B 0S@vd:8j=j IcDPchd0 8j(jp: -L M@R \IpP` 0 0!!( 0 ( !!0\p:@P`0s ^,  (0  X 0p\0 0RP P(K0 0P0\`p \:@`pPUY  U `P, + (00  !!( 0 (  !!PU 00 , !( (, !0(!"4P0 P^, ?PPU ,K 0PPP,0 , !( @(, !G,00 ,(0 3,0  !( ( !, Y:x:0iQ00R0 S-LP P00S00S000P/l:Q00R0 S-LP00P00S00l: p-`PL@ P+_00P30@p p-`PL@ P_00P30,@p -L(M PU`@0S 0S0Sz0Sy eGTH DK0EUSP 8(@#h"x 0Ÿg@: -pP00PQ0LMS`, C6H0S=VS9 HP)P3HK,-0S7 x |0S"R6D7 R{V H0S \0S\H6 G@[To h0sP @0@0@0sA @0@0@ P, d0Y0 6SKZ<9KᛐK圠K\ 吀 ("(04"4$9K $0K, K 0KP; 0 S0 0001 E0KYxKdK ဠKKYxş\PKdKcK\ L ("(04"45KdKt H@P  YP# FCOK@Y<0 d0K$ 1 0K ! 1 t0 .IP, , KIP 00S 0010p4 d0KP dKYLğ0d0KcK\ L ("(04"45KdKt cH@P  \YP ECOK@pYd0K1 0K$ 1 < 0 ! t0 HP, , KP 0S0 0010,G0[S@0[S?0[0S[P \ ("(04"48#P (Kd P0,0  Y -, ZV  0 % 0$0<"$00@0@&0 @00 \0 0x p0`|0 x` $S|d}0@0@0@0@-0Sc S/`  K.0P ey@KH XP 0 00@}, FP0 0 R , K.0 WeDD>, K8P 0S0 0010\ ("(04"43K#DNcx%c88gg8:j:: -`RL@Ppp 6PK B6PE K*5TM 1CTL 1CTG 5T_5T (0CT :50SQ 0S_ 5To0CTu*t5T2 l5T- d5T[ zP5T <5T T1S/  3/p#5P 5PW  m840SW  0m9XA !4R/pWp40S-p0CT*l4T A0CT 0T 0CT-p0S 00S \p3T 0T ,0CTX1p3T{:0Tr30Stm3T 0CT0p0d3T_ ,3T\ 3T_X@3T? 0Tp6@p0s !`Q R@UR 0A0@0s `q`VpW@<9 0Ap0@l@(k!p`$d@\0XN @pP& MPV \ ("(04"48#P R` \0R00ZV0@p0@0Q0@0@ pW  @P Z 0*d610P0S (!BP0d02P eHpP :f\ ("(04"40zA( Vli@Mi i"i >ii %i Ni4Wi@>>i Ii Oi Qi Fi!i  -QRLNMQ\! `1 `4P 1CP 1CP -(K0  0Sm0Sj1SSf1SSb R_3X^ 1CX[ 1CX0I \P P@QJ@0`SE0SBpKV  V KV@T00   1FSK00K\!`1t  pX`K bVXP80T@P40P@00L,0  XP T@ P L =VP 8@KCV0)D2X  XK 8V\!pWGpWD 0SY H`K $VHP80D@P40@@00<,0 XK HP D@ @ < UPp1X0 VOKV  V$ $RKU\!6 K_K@@ U\\ U\!`1 m'1%!KUT00   eK_KU$ $U\!6 @F@ Ud00XbFUpK`U  UK U4iiii :à 0 ( -L M`pHV 3PU,P  0 , PUX t0S\]@\YT@T@T 0S,0S+ 0iS PJ~ 2 R ,  ,0 R00U0SU0040 V00S  P00^00Se 4 R O0 ,,@ , R3 ,  0S9  0@hl*P hl* Z 0@hl+P hl+, 0 0@+P +,(K 0@*P *1@P ) 0@)P ) PZ~,0`,` ^RYʗR40S  N 0 0bSPR@}<40S9 2cKcH.j0: 0-@LTP @T 0 R BTPT00 -QL@R  UMRp` K\^0S[ .SY T 0 \J .\H ^I  0 a?R0a 0PK0KOV0[ K A [R A0B0S 00 RNK K; []PK6J=T00 <0 \ ("(04"4  0 -T0 a 0 p-LMJOK`uL0 XPK@ T0000#0Kpgg -LM⨠K S0 8 UddX@KtPK`Kp  pK嗀K, `pK_K|pK{K0 R(K88 -1LS@ R hPGPp4 P2 GP 2PUU` SP  SP U" U00 0  00  0 00  00#0 UP#P P S  rSPLIcDIc -LMPpPDa0S"$K,1@T T P0-@T5P0`0S 8 `8 _0S 0 @ P `p pP@ P`p_8`0S 8800 _8 7_DNc2c:h: ::: -LPM⤠K @8 S T\ ("(04`"q00K 4 KxKK  0  TW K0[xK00K` 0KtTK@0 \0K[ K(@ ,@ P@  Fp6W $K6@00@0 0`6@E DpP ( (#=KP 00 Rp  @_p8DNcT: -LMh0@S *l0 S:68JK0CS eP d0  K@ K=PRP 68 -@L¶0000#0 -LMPP T @0Sk(+T8pK4$R\08#8@D0`K#Dt 0BK80K7K@@P ` \0R* R\08#8@D#Dt 0BK80K7K@@P ` \0R d0  Id0 0d0Kt ?>t ?>88 -LM`\@pPe:U VT @T`00V00S 0S 0dS1!P00Sp` @P"J 000 00 0000!0000! 000 @TP Z J0 000\PZ0` W V00S \ p p W 1 1P00Spb 8#8%QA A0T@ @P"J 000 00 0000!0000! 000 @TP Z J0 000\PZ0 8#8%XU\EPEJ0PPZX 8#8%QAAp0,$T!Xp 0~,$8#XLpGRp<8#X8#8%P @@ $K 08#8%XU\EPEJ0PPZ8#8%QA A0T@,KP<,$!$',, %PK0SP@ S2 0P 000 00 00RP& R 1P"[2[[0[0!0000 0!00P00S S 00S S00S 00S B] ?]:l:P P/0/Kc@-@000S S0P P 04"48#88#800000S0S S/00S S/00/00S/ -@L` pR! R 00S SV 0S PU P P (" "(04"40m 00S R W n P ( R e P\ ( -PRL`p, :P 0S' <00@Op0 0 >XQQPd0`0Q }OPP -`QL@Pp P P 0S  U R 0 PA0 d0x@@T 30A0` 0 P 00P 0 -L(MRP(  8 @ T6 0 S0 S0 S= (K 0`PDpK,O(0 C0KD K 0@`4dD$PaH00  L GH L@ GL t0'P d 10 S 300S0C00 00S0C 0 000S0C00 00S0C 0 000SP 0S 1 0( 0*i ZGp 00SL   `AeV-jKc`j -LM0P @ $(,L<4,4" Z@`$Kl11TE \10SP@KG0 ?0K@ K8K0S6 ,( (pP d0 X0\0Z:S`P l0Z*0@P \h*3|0@T (@TP00S00S, ("(04"43K(LcLc.j$LcLc -LM@`J K.0px K.0P K.0$@0 PRK$g: -LKM`*@KPK>F`K:F7F0LKK 0KK0K0KKK.F\KK *F K &F( ,0K8,P (01,Q2@KF\KK0 0KK F;}|P(K;0[0S0SN 44 R O/K  B.0)0 R[0[0St\ ("(04"45KlK0[0Se\ ("(04"44K]O/K  B.0 yR\ ,0KP , 0R0%P 7*LRH3@P  $(#Q 2 R: \KL K  NR1x@KE0pK \Kw0KxKE( m4`P 0Q @T \2 R1@2 R \KL K H "R\KL K ( R  H QEPL  1 R O/KH.0 B⎕\K@L K  0Q1L0[SLA \KLK /Ep3D 41 R \KL K eH QK0[0S@@NK(J( "s$P$\ 0 a i0 00V 0 R O/KLK.0 BA\K@L K iP5F 0xQ00 R \KL K $L QKcDNc@.jLcLc$/::9`jT:,:::l::: -/RLpMp0 P 00 S0% :Pf 0 ` P0 3V ,+Vg ,V V( 0R0% :PO 3V000011`PP 0@S0% }:P< 0$48#8 R`P<V 0Z0"X' hKD0 \h0Kg K `@K,NhKP OP 3 R~ 0 00K⣄Pk3@P $((K 0R0%@ J:T 0 0Ra`P0S 0S0% :P 0 @2  0 00KlP 0 00R6:0W 00K]P 0 0R':0r 00KNP 0 0R:0P 00K?P 0 0R :0@0 00R0% b*PD@KLKC0 L0KKKC, 4 LK@Pe 048 <:0RH0 00  L0K\ㄠ P t |0 p 刀 l`K $ 21C0!10\ X hK( 0K0@%084HU U\ :\0 0 000^ K.0@B 0MU0ESUU :V,$0 ~@P d0QV R,|$0}P  7 R'V,<$0}P 0SV,$0}P  k8pQuV,#0}P  +a\fVs, #0}P  -Q0S0G SS0C,<#0}`P 16 0Y300~ V0  Ÿp8X`0@ 4$D8X 0@ 8$H#`jDNcL:O9 0-PL @R 0S00S0 R  P @0 S00 0pK$Lch: -L$0-+0 (+0 Lc(LcLcLc -QLM# @P`p, (  @P, K  .pf`, K $K -`L4ǣ0@!0c480!0c4<弣0P 0c4D嵣0 0c4C@@D0@ 00Q0 00Q DP@10 R 00d  SH,0 0C# L0 賚pPP孚P@ꫪx%c -, 0LRP*L0 OR^, 0S*4@pD`@` 劚@X4<0,0 H8@H00 Qk,x%c -LLc(Q/0( ,S  3S001 001 R0P// -Lx0hH0ghMc 0-LM @KvPUv P  0K0 -L MQ0 03SP KA00 P0L/S[`/X/X///////////////////////////////////////////d/X/X/-PTP0 PKh 0 Khr `0 `6 tpP0S (@'a5\00 P@D PLcH.jx Lj Lc(LcMc -L4M@PP` 1KQ<R`/////////////////////////////////////////,//`/////////////////`/0Q:0K 5vV0[00[ 01PڦpQ: &0K"v"[00SV&0[0(pQ:N0K( vVH0[00Q:0K vV0[00[ 01Pvt(I: p-PSLMPK0C`@0%T  @0QPp@p -LMp0 @$("(04"48#8(``V`!3T (P  1T +T (KZP*0V':.0K u,0[S! -0[.@[01PY3T0V:*0K u3T)0[)0[1001*@[PP<T000 -LM"0K@ pvu3T!0[!0[00QQw@P00U00S +v1` T ` `MtU* 0Qu Pu@ -L(MP @0 PPl}a 0 R - 0(@3T )T/  PP p3T0000aa 0V 3T T@uu2@P  (K<T<T u+T+TP l0 3 )0oP@uPl02 @yu0 $(,0<,4#:(K= 0 )0IPP0P ll0(K/ 0 )0:PP0P llrL@K :L0[S@ S5 X,. )0< PP0P llU8@K  0PE(@Pu  00Qm 1 )00SuP0l:K0[0S S $KK0[0SH.j 0-0L0@SP ڀS S t0S0t00 0@0@ 0S 1  t0T@00@ P @P00 0H.j -LM`Rp"@3 1:S? S VM*  hp  `bV @0SV;0 `bV(KV0PU:0 =0K 0:00 <4("4!<^00 >SM: 0V R*K:"[04"48#8 00@P  Mt+00h <`*0p@0@P0h @P+,0T0h `@0p@P@P,00h H.j -LM@` 0)S0p(P 0 0Q( Q0%(":P*0@P  (K( ,0KyP , 0R:0( ,0KyP , 0R0% *8_F0 EP00@H.j9 -LM0 ( `  !($ @PT@ 0$ (0BS2:(R 0S bdq K $00 (000$K(K0 KpP20 04$0S 0)S('P4 (0 s 0 R000@P  ds` p@0@P0@PL( ,0KAyP , 0R0% *4E(0@P  KcH.j9 -0LlM40 ,g P& !( 0SX \9I 0@9IP`0@ {'R&P00`S1 0 0@0@, s(K0S% @M\0S1 0@#P ( (wP 00@0@  ! 00@0@*^3 @`T0S& pQ/ 0S,0S)0S&6(0 0@0@|9t #= 0@8H 0S$0S00@0@T0SE ^ P P Q 0S@ T0S? Q  0S0S0S ST 0S 0S$0S S6 ^m P^ P 6 ^ ^ P P 00S S$48#80@4S,KP0S 0S0S0S040 ,pK0 K40KaPv0 R 4Q P00P(0 @UP0T@` g@1 UP  2 1C 0Ɵ1 0 6PP0 I 0 SK @S,0\0 0@0 @H#= 0@8H 8H 0@8H'= 0@9I^8 ^ P9 Pw00S Sq\08#8 $#$("<8#8"( 0c0S0S 0S$0Sk 0S  0@p0 0-L lP7 0lC1   R0@P*l4P4*0 R0S 8CXU \ L1ѓ4P4:H0@0@(@ 0hnnBTIcNLjKc:j0g: -LxM1 `0S 0S 0S0C0 MRM.0 rV P   d0  P !00EV50 0 U50 0,$P P P ,P@`T~ 454 0pǏPp`@ ş 00@`V0@@D VpK00 .0`KO .0J0@`P, 0PA\  0B Iopp 0Sw0St0Sq4 PoßP0`@@ T@D  $o(KSVpK00 `K.0 .0,@ 0`@mA d0`0S0P90p` ,0RV 3 R d00@6=0S/ S 0Ss Sy l 0SI0S 0 nyUw] 00 0 R4P0S#  00S0 0 0P R 0 1@P \ n  0h  0HP4 <1@@P @D R2 7P# P5 (P  0f%00S00000S S 00S Ss\ Sn h P80`0@X80<@ H00@H0L@XB:j:jKcLcH.jx%c::Kc p-L M)  0K@ `PP 0T Kp00e  TK :TP TP 0S0![ P P!K 0Kq -LM" 3@0SP0 Y 0 0S "101202(K Y 0 y"00000202  :2<2) 00K0` ` ,< $4 !$ 4,̂&<4 80 Xpl XZ 0p 00 000 00R[ R= 00   804 88!   4#8!8  8#8"QA"A"8#VK V :V 0S0"h0SP0SuP0Shq00S S 00S S *0Kp"F 00S00S0vizi:j:j - 0L(S``mpPm7Q PQA @@A1 01 4 1 H000(A00 (  ( ` 2` 0-0L@P!oP01 0'S 0S S) 0S S  0h (tqP0 0S 00S0 0 00S00S00000S S 00S Sʚ; -@PLQ000i R5 h p-PL`@m U  U U -p0V 0 00p0V 0  Qp00p0V 0 00p 0 pKc -HL@10@00<0 -qPP.Q00SL@` P { 00/T00S00=T00S0<01T00S P { 00#T00S P { z0 03T00S P { mpPp p2T00S8P { [080 -L @ `Pp3 \^00S#D #DQ !(40S *Q////////////0//X//X///////////$/U P U U00⃁U#T P 2TP8PN{ :P  41U R 0S D00D0U U 0U0SR @0S3{ P{  1U0 S<𩝘U0QS@𩝘PsU0 S𩝘0SS Ud U00U1{ PB  0Q 0S 0S0S0S @TA  R00S 0SX0SU0SR 0SOP )PQ{ P  07D00D031. -LM@0pSP` @  @K{ HRU0 -@PLW{ h -`0LCS0`Vhn@0$E D |0( #5#30L20D;j2cLNcMb -|L 0H 00 @a00 #5: #30/0 00uMb P-L \  R @T 0 S *01 0 S00@ 0(  --|:: 0-@PL` 0S[ 0SQ P d1 RMX1P U 0SCP0 Q0,;j(Nc$;jx%c:jHNc -LdMHK`p@KW0 H0KGKP,  d0K d P10 S00 R# W  (KW ,@ WZ!0 R  K.0oZ80 8,,80S Z ` \0R W  P @K@mQX ,0KX 儀 P P,80S !,DNc : :P8 -3LMPp@y 3P* 0P 0CP (K2PQ 2P02 ZP2P @8TዱwDPpPU 0`S" 02P 0x@@ 0S TPVP 0@S00S fT[*00S8PK^D ^Q t0 0P <02 @ %  - 5  x8Q 0P 0 0 `X100 ( 1 $,0 [00S3[S\ ("(04"43K00Sli@Oi Ni4Wi@$;jHNc:j%cx%c -0LS[ \#\ 0 R0@,0 d0#00 h0#40 l0#80 p0#0\#\ 0Sp0 0 ( "0 , "0 0 " 0 4 " \t0 R0P\  00S0\ $#$("QHNc0f88 0@PP4TD  !P i@ 0 @@ 0P 0n1 0 i i@H$H04$48#(H@KY 00S0 0 0\0 8#8 $#$  S|  0 !`00Q0`P000   0 00 0Ba Ꮷ,R K.0 @Ze8@0 X!.0,R KNe 4P80,0!TNcgKcLjDNc;Mb : : : -LM@0P <Kp0  LK,tP `V 7 RQ7@P (O P(K 0R0%P R:U \pK 0 \[48\lQ \ &300  L0[S @KH 4PL0[S |PP@ 0PA ၸ0P 0@[ K PD 000? K.0d@ K.0d8 0 0!  ,0KTP+ , 0R0%P *H![0[0S\ \("(04"45K5 Rx  K.0d !n N qP5@P $(e K.0sd  [0[0S S4 RD  @|P{4 R9  5x4 R  <K P@4 R# T U i0 00S 4 R  K.0-di0 D  t0P 8Q 0 R 1# S ;i @R@U@T} 0i 0S 0@1T P00 8#8S1d00d0P @PTX P 0 H  0TMM0 PHU^ 0SR00  U  1S501X2v.0!U* R  K.0c@Q80  U i0 00i ]Q0 0001T P0090!0!R00S0 1d00i +P  @\@P`RP : ᑥ0U00S  0!d0  b0"00 R w0"0F @0!>DNc(.j :9:`j:4::d:::8Nc :Kc -LAM@P<K $  LK6,01 \P 0R0%P 7:UE p\K  \K `V |V0Sh0SMd6@P L &(K<0S080S-40S*00S'$[6R U0S GS  ,0KRP , 0R0%P *_5@P $( <K8PcHU0S L*@K.0LK b, 5 R \K .0b  K.0b@C/K.0b8 00S <K K.0rb v<K P  <0S 80S40S00SY iL iH0SxD0Su@0[Sr\0[Sc S( @KH WP` R0! 11 0S  0S0S0 s 3X R S0S( 8[0[0S\ ("(04"45KL [ \K! 岵Pp`P`1 lK@X i0 00S dR0S \K K.0a Ai0\[gR0S <S_1 R~  Kz@K K( 00KKj@Ph d0  00 RS ^!<0RPP@SA "80S40S00S`00$\ ("(P00 Ġ"Č2\ K<K K2 @1 <K@00S@0`0\  0<K\ K <K K.0ja|  "PP 0p_a `UKcDNc .j:9`j:::P::<:x:::8:/tP/0S/0S/P/@-0s l@0@0s H@0@0 @/0@0s0@0 @x%c p-T0L@`TP @T 0\ R Pp$;j -L`M0P\` 0S K Pd0{ x@K@d0 08KH0 t p :l 0@ `P# p-0LSP`p00Sp\08#8 $#$ ᤡ0@t Aphڢs0 -Lhd Q 0 R  0q |0@0@T0X@| T 0@0@L0P@0@T0X@0@L0P@DNc(:x%c -LMx@p8Kᆳ &PPf dT]80K0 0 K1 0K 0K00K0 840 0`,X@  @ Ԁ @, 0000 0 0000 4 0000 8 0000 0 0K8K0K0Kh0d |0 0B00 K@ KP;UQ Kⰳ@P 0 N1 RT@(K0H@K0 0  d8H04D 0P,`@0P< P`0`@00 0@K 0K8K00K@ h0d |0 R 0|  R Qu ` | `0 R Kv K.0_0 @P"@`08 @DNc: Q:|: 0-\0L@PT@T 0Sx x0RϲP 0HNc p-L4Mp0P`1@T@T T p0 x0x R⬲P Kp@T@T 0 R0SpP lPp00p0H0 R F K.07_x0 8HNcDNc: -L 0 A< i0 00T7 2 R( <K K.0yWi0 D ,0KrGP , 0R0%` 4*L2 R h@T 2 R  <@ @ 0<K @@x0SN SH 0 SX [K 0 VK_1K`Kl 1[ x0301K 1["# 001K K0 $ (,< 4!4"<1 0 $ (,< 4!4"<1 A Q OP@4  @.00S0 R&  K.0V Y@@T <0 R  K.0V 0LG@ XNcDNc8.j:x%c6MbLNc:\:`j:9:4:::k00C0S/6@/% -d0L  0 0, 0Bh\Nc0 -LM`i@AP~ R 00 000Sؑ+%Aq @,@2t <2( %00*K"K)@K0 0: pp @@@@ 0d0`0 0 * B', #(`z0(0@@@@@@@ P+ i@ 0 @@ 00P 0!0@0 Hi $H 204$48#("48#80 @ 00KP@XG8= 0@@4DD(K?h8`j 0-0L R0P0;S000<S<00p0@T@T 6@ d0  ᧨P G@T0h\NcXNc2cLPP7P 0 R(1"(1(0241"4101 #0 !0p0@  0#$# #8`000 , d  `202, l0 , 2(0H `Pw$0S(0S9Pn HKH@K4[@K 0 Pq,0H ,K PͱPPP3S ,0S00S40S80S , P@Kx1@ OPhU-,\KcKdK@ 0dKKL@ >PP@KV=jzi -L`pV P@ P! P9 T00PU0S+ V P@ 00P P P 00W l `FpGW@ L @T0gG F`p( p@ @0X:-:T::-DD t04 C`, c(0  bP@t=j_ NA / 0-@L P0h@-@R0 0#\P0S S/S/0S/0S  S 0S//Q/Q/Q/Q/Q!/Q1/Q!/Q1/R 0S  R/@/R  0R\/ P0Qc/-R 0R^ U! !Q@-: R (2 R R -PPPP RrPP B PP R  R00 B R000Ѥ000l\000Ѥ000 R \6 R B0-.40P<$DL%T \,Ġ̌8 R0 .Ġ̌ RA R B0-.80P8$HH%X X,ȠȌ8 R0 .ȠȌ RA R B0-.<0P4$LD%\ T,̠Č8 R0 .̠Č RA R'0 R- RP1P P1P RrP1P  B P1P B  R010 1  B R0q0`0q0`0q0`\0q0`0q0`0q0` R 0\6 R B0-81, Ġ%̌T$\D#L0P  R0 Ġ01#̌  R R B0-81, Ƞ%ȌX$XH#H0P  R0 Ƞ01#Ȍ  R R B0-81, ̠%Č\$TL#D0P  R0 ̠01#Č  R8#8S    2  0/h8P P  0S / /P P  0S / /-R0 0c BSR48 R p-@P`x BRpR0 BRRR P/0 P 0Qc/ R-L" 0S B@ 0S \ @`0d S:^ 0R B^a00@R0Sa@/ R 0S0a@/00 P/0Sb/R 0PP  R/0Qc/R/0S0  R/R/ B0 0Q/0 0Q/Q 0S0S Qb//Q- * 0 0 QaR *0\ 0 S Rb/` `!  0@-RP@# A0La L\0   S00`P0S 0zP R00@P0S ZP\\ ^0 `0ȠR@-,Ƞp` QR2RHV}GR0pG@00 0 0  0 0 0  0 0 0 0 0  0  0 0 0 PU @"Vm> 7("B 1@W b`0`WK W300 0 0  0 0 0  0 0 0 0 0 0  0 0 pG0 W `W 0 R 0,8(2C"B0 cbR  0 R h0\\0L'82C0L0c00 P @@ R,B B[q p-@PL 0[! 0$H8L(2C"(@\`0%H c@`Q AAQAA,0R+B>.B0 BR,B Bpq/x80@-Q@0R,P0 0,0,! ! 1!4##!#$" " 1"4##!#$""1"4# # !@D#$""1T"#T P0@T0,0!," 0x8Q  0 "/ p-L`P@@Tp -PLM0@`. 0IK$1  0K0R0pK Pd@0 Pd@0  Pd@0` `&$K` S-L@P`0 @R1SVPQ00QppW(,0\`0p(ST0 p,00D ,@0`F 2$, L!P0S,V\,KX03/`P 0 S000009 0 .PE00 0 ɟT0 0CLPX0 008$0d\Pn@2C0PS @0< 00@< 0 \RP@ (=0Q ( 0 40<0 , <0 `0l0 $0 #44$p0,0% -$PL4p^@F (\ 0@c T#*0 ``T*:d b@T*00(0S, 00000R00#3,05$ 02,0(00@c T: lB (0,00 d 7`4d 0(0,00@$`0 (P4 -pPL`@$PU 0S0 S P00( T b4(0,00 04d ,@0 S T Q0P -LDMPT  8 8(K$X PH QL  \ 0 @D@ P0P 8p<`<@ 8 S,0000$0000T000 000D00000000000d00 000V_ L`F0zL Z0Sp8 ? 0 0VK L `F0zL  Z0\"'`?P  Ud 'w\`Pd JRh? 0 0V# L`F0zL Z'4,<'<$00 0 p80 0Sx  8T\aH  D00L@P(08pS<0S  l@L0T l0 T/^p0P(P8 7 0 07 0 0`l0pPX0Xd 0P P8 < 8 0 0G-|M00\`0 S\ 0 |0  2R0 Q2B@P0 RPU0@ @@@ |ЍU p0 RpW@0 00SJQS03<X 000Q\ 0|0 Q@ 4T $D@0 ^U010!W0!P808 0200@(0@L @$0, 840p  0@ , `Tp$(ń0@p@`p0 4 01# 1 l!c0  ll 0S@BpB @0 D4  4Q40A0 0440|0 2R0C8#(@Tw 000|08"C^B4 0@ T< P`0U |0S (aR  00 cRU  0( 0 [S 3 "R< 080 0  0bC1 @000000d0U0P0S PZ $(,80>P00[P030"S @  7 4^)  P0 4 @0S80 0  04L0#04 0 @!@00 4P @0 !0084 0@00400@̠$0(@,999B9P/$ R 0S/P-$^ 01 0C$ 0 B0P- $P | 0  !400 / 0-@PL0$Q P*UEU IU[U(0S 0,$D0S 0,$@0S 0,$80S 0,$0,qU0$00gUqU 0UG-p,l A?@0CR0Mx8|P0A?00`0`0, \0 00@ R 40 0 0t%Q!\!  00 RY*PUW  0 ^@ 0@ST@ 0R 0R`  0R' 0R" 0R 0R 0R 0R 0R  0R ` R 0l#PD 0@H08XT0 H4."D H @ H0D 0@@U*0*S -PPL@$`Q00V0SQ0Sn 0Sh  :TRpp Wb0S *R(0P(@ ES` IS [S gS. Q TRZ:Q Rt0ST 9QN )21C00@S90PPpp,P0(0,0Sq00 0S y8 0 80 #4 0 8q000S 8 P T  0` T XP ZC0SSM 8080 #4 080 #8 0; 0  0  "4< 0 "88 0 04 0BL0S0c00s3Y 00 S&0B2l 0ĀRL'  c0#2cq0 a0aPl0S 8!IF g800SS@SP >R |6 0S   0p W p  0 S,0S ^* n838 0 \p,0S ^#:W0[0 p0$0S  } 0$ p0 0W p  0 S,0S ^a:t 0 \p,0S ^o:W0g000S 1 R !!* 0   1S 0 S,0S \"< 0 \ ,0S ^* n880 R I00 0\V n88 n88g00~[00v 0SE}8![X n8~8 w8 000C 0 }0 0^m , 0R  S $0QPS 000 0 0  0#4 0 0#8 0 0   R  0Sg   0 0S  0  0#4 0,0SB E0 0 I00 n880   0   0  R 0 0S!0 00 q00L0D 00pCL   BD8 8RʓR0989B -LP@P$`V q@0 T00?Uʄp吐"!B 0h 0 P  0 T h 0 @ |P p9 -`tL\EPPUl8 H 0XT 1#D04 H00 @ H0D 0`p0Xd0x` 0\*,0lpA?C0ChQ 0BSW``0Sxlp\`0 SdTTT4aLD4A  !t@(4, 0! 0A9!0P933;ӗӅ@! 0@D00tx0l#3LPlptxpTlp:8 H 0XT 1#D04 H00 @ H0D 0lpxLQx0NUp0`0hlp= tBPPXatPUZB UPh0S 28l  @RP 0C!@ 909hP\l P80 `Z00e l0\00 RtZ\ R80 b0Q l0\00 Rh0S( ||18  0@R0`1  @9H!0900CQ lptp@ lpt0Slpt0 @hl0t \l P80 `0 l0\0R0 R S xp00c Sx0`0 lpQ`Z`9`9  -LPptDQQl8 H 0XT 1#D04 H00 @ H0D 0pWl` ,0l`A?C0CgQ 0BSl```\spDCD3a83L  !3, 0! 0A9!P0922;ӗӅ! 0002 t`0 BQl\t\PZ0L`0l08 `l` 0HX T2#D04 H00@  H0&D0 ` p BR` l``l`^j \ R80 b08 l0\00 RYxx1 8 0@0`1  @9H!090tl` 0CA`Rtl`l`8 `0`0l` H0XT 1#0H0tQX Q!\l P80 `X00l0\00 R XR5Q3l``-X`9`9  p- 0!PCUQL@`tP7l0\0 Stl0 P0`Qt08000 al0l0\0D0 R l \,0 aA?C0CR:Q800l0\0-0 RpQt0p03VQS \l P80 `V00kl0\0 0 RVpVp 01P? "# $P 00S /P0S p-PPLp$`V (0S ,0S 0@0 @0@040  0R b R0q0*0R0,  E@8(@+L0D, 00 < @CL   BD`21C 0 0|` H@l@\@t@x h@p 9 -L M P\p` (K0@R1S  P(0 S0082(0,0S,2,0qV`f, V , `F, 0HSUV00V0S Y00é?Z00ê?40 0[-(V `@P@ 0Πh10 €0 $@B, 0A 4 TP 0`,40Xp00 L00(8, 0(@L 0(0#`D 0 (80!S  @0S D0S P 0`\ 00$P儐删(Ko404 00 0O_/1/189 -LM@ 0 0=K/,9/0`/89 㗇 0Q 0Q09  d0xQxA H0LQ40 , ,0 0/ | \0p@-P0P ;L0`&N,;<0 @P` B[$0K8;`p@`NctNcNcG-X1p0\;^M0100110\[`1@ 0T'+ 0 P\[3P`1!0 \[\1!@0T:`P@0 R P0`T 0\+Ѝ0<0 R0 P\[PXA-\p10  W@ `P! 0 00P`  ^`  P0EW10\^ \^ V L! 0008 000 \$ +-Ӳ0Ѳ000²0Ѳ0| G- M0@SR 0 0`1V0ಐ Z > VEP 008#88#800 "$ 0 c\ 0C0PU0:0. \e0nPLuʰ 0PU00*Y   Z  0000C^ Zh \$ 10. ⨄pP0gUڔ058#88#800 "$ 0 c\ 0C00`F,4 pP0gUu $058#88#800 "$ 0 c\ 0C00sPUNڐF058#88#80 0 0"$ 0a PA~ VA$3pP0gU+= 0%r0P UF058#88#80 0 0"$ 0a P AM ЍTF0 5 0C4Ÿ82 % 2pP0gU/2 %qP UB F058#88#80 0 0"$ 0a P A T0 5 0A4D!058#88#800 "$ 0 c\ 0C0p0P Uʸ F0 5 0+-058#88#800 "$ 0 c\ 0C04p0P USF0 5 0 0@-0@P 0CU0 0 ! 9090 0@S0p p 0<010)EQ )<0803ӗӅ1(0  `9`9 G-4@ MP '!0t`P0fUڜ058#88#800 "$ 0 c\ 0C00,4 Q*04 0CⲐ Yp 3+ 0̣` P0fUڸ058#88#800 "$ 0 c\ 0C0 0\3QU" 8#88#800 0"$ (0a"(R#A IX223pӗqӅ!0` P0fU}t058#88#800 "$ 0 c\ 0C0 0$2QUq 2  e^`a`0>8#88#800 0"$ (0a"(R#At1  QN:0TkpP0gUF<058#88#800 "$ 0 c\ 0C00 0 Ѝ0 5 0S00 5 00x0 5 0X 0 >0< 0 >0Z 0 5 0`9l 9 9`9T 9 9 -LDMh 0,& p`W6@L >L @0 SU 0 5 L  \ˁ\@ 0S0%L0h 00?@T  @TQ=0! $ş`K 10\ B ` ğ` 0Q0CC!10 \K \  000@  0S 8#8  2 P 0 0 `{P4p R@`   B10 \ h pT X  \ 0`0 3 \㳐3 ! \ಐ0PU1> 0 Ld A010 Wdd 0 T0SH0`0Yil ,0Xl \0@װ 0#!X R 00" PUdQw G@2 R 0> 0 0 Q0CRA l00 B 000d0 0C BSd0 W> 00P0 K P R 1> 00T!Q@@PE 0Sc0 N!! p^P Y BP p( IL !L 10T\ @ 41 B8QX 00b0 0S0L0Y H K 008#\L0S P@ 0^ `(K 0S08#x 0 ` 0R(K0 rC LPU@(KP=TX< 0@-P@0S S0t0 0"$0C0 0< 0 #40  0 -bLP@ Uzژ058#88#800 0"$ 0a\à A882(RpgPPŸ+0Რ08#88#800 "$ 0 cZ"0C0 0!a0P 00eS' U:x0 %`Q XLL0>8#88#800 "$ 0 cZ"0C0 0a0  ;㳠 0 0 0 % 058#88#800 0"$ @P0a\à AX 0 >0`9@-0@0Sڀ  0#4 0 L L000S00 0 0000 -@L@ ^pP`A 0>8#88#800 0"$ 8 a#8S2 A00  8#, #808#< U0 0 \  0 >0 -LM`pPP00 @2RU+q&(+lԅ@010> 0 R@DT0ş  5 0 ^ !0S  W R0QS38#88#800 0"$  8 a#8S2 A0,S@ T J048#88#80 0 0"$ 0a P AZ㠂P 30 10> 0 ("(("(  0#40 P0b\à B U  Bp P0 10> 0P U ,0P&M C@   00i00S(K00X048#88#80 0 0"$ 0a P A00058#88#80 0 0"$ 0a P A tJ0 4 0gT0H . @4A0 5 0 QX 9`9 90 ##/ p-L@MXPKX T0 H `l @0D ( 0 , @P KpP@ FT@D@00?@,9 -LMO- Y I* Xb$\(  O-`Q* @@ P@ @Pp$DL%T\ @pP$HH @ PpD%\TP ` RPbZin4_cksum: out of mbufs p pgQMW@PФP``$($,Q@Qx       x         @Q@ Q x        Q0@cA@0  0  0  Q@A 0Q@Х@PP484< / p-L(M@@KP`( T 0@` gKp p-L(M@PK@`( A0 @  P  0Kp -LM@K  0P$K  0P h>P L@K(  0P48`@0@!x1*4 x x!40P0C0$K`?jgp?j0^ 00\R 00$0(000/ 0C-L`P Sꄕ1 101\14101010101 1DAP hAL d@T l0 p pU W@ PL d`bbh@ PL dZ( ` Pj @P hP% :4 ^  @ ^ 4: S@21C* "!B 0 :0^ 0 Kp -LM@`Tp*  R $ PR @0PS L   0 P  @R(K @ x -LM< \ 0P 00c80 0匢Xpw `tŸ Zy0 K40K Q 0 0S 40 Ro >*"*0L,  080< P @,T> 0\:00Q^ (KP 00b, :#: :cS1!\, ,8  000`Q!0S P 0pW@21C0,0,0X ` 21C0 0@T\ 8,0 0 S0@ p 0 , KM p 8("(8Q, "*46*, (00S 0p 0Aj  -L$M$( 8 R`4 080 0 VR"PpPP%4V@1,K080K  `V 00pR00SP 00 4 $00( 0(K -LM`$(p Q,0W80,  PP p 3U00S 0S  @,K(K QR , 0 00$( p0$K -LM\@P$(`3*KpȌ$  K$K pP$0 0 $P(0`p.  0 8\8 -Lw: -L>0^0P0@ DP 0Y`p@00T*U U  0C J0SjZE Z p u6(8H8\880AjD: -LM0(KpR(0 $ &`00^*P0.Ơ\x@: 0c#\2 050:00$00$  $ 0S`V y< K8j j -Lp@@`  ,P kP `00  000$0(0 P0@-@P# T!00Q:P  RR*> 00 0 bR !. .0  00 >00 >a 0Q00> 000 -LM4 8 @<0  8 080S 0 Q 8Q갤11113t(Kig80< R,` T: `@aQ40pPW ^ U:>0 >0 S00P`8< 0pdWp! <00S<0 @8<0\,` pT: @gpW PV:`e PU4 00Y00   ^e Q:>0 >0 S00`8<pd Wp!0fWp!U <00S<0 w @`8<0P,`k `gpWPU@ePU4 00Y,0  Y Q:>0 >0 S00`8<pf Wp!0dWp! <00S<0 2 `@ tt 02c0 0 ,, 0 & 00$*!00xP@tl0 R0 T` L0R  K< lt00 @j00 `+.  0;>0 0t0 Rt 00PpT` P0R  K@X lt 00Pp0>0S00 q <>D 0+ 00)@ 03@tŸ0SxD &D JZS D0 @46ZS#PP @): RTP 8#8ZS#=)6?>14@D0 `p `V@# WU>000 t"Q0S T` 1R , K, l`tV@D0J8ZD0 0(K)68; D #;1 4Q@t(0SD *JD T0` 0R , K, ltnT` 0R , K, lt\0\ 0 <0 P04 080 2 < 40@j@j@jL00.*@ @@@I 0@@j0PcHc,Pc 0-0@0 0LP$0   R00 Rt iP ` `000@0  0@0$0)$剷[@j0Ajgg&: -L(M\㧺T(㤺L2L ( BϠ01l80 " 0]8Q} 2@ < Pr 1  4K@ B0P @4 0 @.Pd4`VYH* @<`JVX=4 5$*(":X1 0"P- 2C 0S0$ *"%0L000Ptp0S T` 0R , K, lt<   @< >80< S @@0(@  P@(K4븞gg;HcXGj0Gj |g0Aj|':':0' %#&R*:0R'*0a 20 <PP 0T0U 0 @00@0  (F#&R:0R: 0a 20 <PP 0T0U@00@0  D1t81 R $1T1` 1R , K, 0l0t 0j0$  0S@ 0t0` Rl0,`0T` @0R , K0, lt8j0S< $#&R:0R0a0#1521000*< R$ @0< 7\ 0  \~ @ @p$R4 SD0SH  0R01X'0QU@0`0ó@0`@0`] P` < 0@V 6 Z0 0 4 R000$ $004Sc V 6 R 0R 008 00S o<QN $RD4S<SD0S6H R0R01&0AT/ 5V2  <<<@0`00@09VI  @ @@0`00@0W@d <@0^ @[<0H < 4< @0`H Rgg4S[[4q 0S  l 0Si  4Pa0S 4<  @ @p008 d0TDt0S44 Zi 0f *:$  0SpZ t0CSS T` 3R , K, lt?0SA t3,<WL0P00 0P V <3 Z(30 0 \ P @ @p$R44SSD0SH H R0R01"0AT@0`0ó@0@0` `"Vv  @ @@0`00@0 P`40 0Sp  0S r 1Pî<<@0`0@0:@ Ĭ@Pp P ] !V+   &8T` h1R 8, K48, lt8 <0< @g 0PSt `r40o Wm 0Tg 0S^ 0\X  @ @ h0LK 0S D0\ ,0L0޶@j8j0Aj@j<9!00Pt0eS T`5\, K , lt@T0D6P0H8@;9@5p:#:S/,5,%0PQ,KhP} '*(":10"P 2C 0S0 ,00*"%0㔤0@t0pTS*hP :*#:"*S6*H4H$0@Q  0!P? 4000 %*(":10"P 2C 0S0 000*"%0㔣0@t0pS*㳧Xd#0@Pp9X< PX43<#0Q,KP p2 0b!P 4, <!*(":10,\"s 2C 0S0j <:#5  X040 t0S]*<et0S <T` 2R <, K<,*lt  8 21C <0f0000 ;+ 0 0 P 40,0 0KtPKpT` 1R 0 K0 lt 4T0` 0R 40 Ku40 p0ldt*T` H0R , K(], lt%@j~p@g00^0L PU@`H@ $@K,0  $ 40RZUzj K剰Oc0Aj):a 0-LM   $ l(0 @!P , 0.@嚣 0@!.@ @1:40  4P@1P@E@0@!P ャ$Q( 0080h0E   40K0xI=j|1A- QQQQQQQQ RA- 0@P`pQQQQ R@-M Ѝ@-MЍ! !P: ZŒŒ#! !P: `B!,aB 0>ZJJJJJJJJJJJJJJJJJJ }J xJ sJ nJ iJ dJ _J ZJ UJ PJKJFJAJ=Q:Q:Q:Q:Q:Q:Q}:Qx:Qs:Qn:Qi:Qd:Q_:QZ:QU:QP:QK:QF: QA: Q<: Q7: Q2: Q-: Q(: Q#: Q: Q: Q:Q:Q :Q:QA ? QA ? QA > QA > QA = QA = QA < QA < QA ; QA ; QA : QA : QA 9 QA 9 QA 8 QA 8 QA 7 QA 7 QA 6 QA 6 QA 5 QA 5 QA 4 QA 4 QA 3 QA 3 QA 2 QA 2 QA 1 QA 1 QA 0 QA 0 \aBC`B0QA 0 p@-@P`R p0-@P0/R0-@P \, 0L 0l4 @P0/R0-@P \4, 0L 0lRQ@P0/QP:/// p-QLM@P` S 0Vp pppS`@rP`&0-@P0/R0-@P \, 0L 0l4 @P0/R0-@P \4, 0L 0l51@P0/ p-QL M@P`S K 0V Kp  Kp K@rPp`(Ƞ 8!"(,Ƞ p@-@PpS`b `c0#3 Q. a l^#(8.(030# 80 (3#0"P@p.8BA Q ! C2Q -L@P-S'pU#`S PW0#03d g0U f  e00#2 S06"l P@X t@P` r0(@pP@-` a@ \B/@-@/0@-@QP a0 120^0 0100 -L\M@P`p `5`^0p(KSP 0W p#83K8#8ẃ[0 X$,8`K("X&3KK0<AZ0@L0"[[[2[x h[[$[3[xh@Pcp@-c@bP`T !L2pQ:P:/// -LM{ -L MKsK K0-@"P#0/40 $ R/ ((0"4S/nc40 $ R/ ((0"4S/nc 0/nc( (P08#808#80/$0$$ $P08#8 /d@d 0Q 00/ -0L 0+R 0  hyl0loP \0 RPh PD0D @80 \=jAigoc):oc:24;4X8:): - LM0S@00@P@@ 9Px@pp0 8`|Ph<#P, @ococ*:@*: @,oc(ocqc$*:p@ Pp-L 2R 2 pB00|b 0h0h"S S00S@P P0S S00SQ000 S0 S APmjSpP0-SQp@00ACSCP?22>2>2>2>2>2>2>2>2>2>2>2>2>2>2>2>2>2>2>2>2>2>2>2>2>2>2>2>2>2>2>2>2>2>2>2>2>2>2>2>2>2>2>2>2>2 ?2>2?2?2>2>2>2>2>2>2>2>2>2>2>2>2>2>2?20Q00@p@ T T0 H @0 8 ,0 DSBOghGjococ,*:<*:L*:$*:oc*:*: -LMPw D.?)m0?`S P  A 0ҩ0S @   00FS0S\ 8T P9 H9+R@9@)89*  1,),9 g9)ɟ000 噩X喩3I@ȟؘȟ bx @``~|夨 a,Ơ  0qP`XPP8 @T:00C)0塞0P0c1*U,0 I@9#9S @0^:7BAD@L*偞0 1P0b*U0`X I$IT`ǟ0 C\LW:0d0C *0a0 C\ g:0 0C07*Pǟ 0B1\0a0:0 0C06*9Ɵ0pƟ 1B0a\0z:0 0C0d6*!PƟ(0Ɵ 1B,0a\0b:0 0C06* ş0ş 1B0a\0J:0 0C05*şh0 x10b0x壨`%p韨T5d雨HşX门0 C^#:05L*ʝ儨$TA E2T PT?C ET P4@hD0T@ ğ^N@P`@&l0@@  0e@y8D :@o :@g :@_ :@W, 9@P0>02 a2"&  0tϧļh.,x!l1(`$2 "@峧宧x!h1坧!1 1!1 咧叧! 0 q傧,15#l1 000\`0  (K03,1(/@0ocx*:Q@PpphDB20 @ 85x1p.h+20,X& L"20,.::/:0: /:99/:/:4/:-:/:/:/:\/:l/:D/: -0L0S S S@ 0T<8 @DAmP 0'0g0:@B 0-00L0p0C0SPࠃ @^   02020 ^,T2,T2hT2T2T2 U2PU2U2HT2S2S2PT2HT2\T2 0$ R0@$0 @@@@X 0SC <0= P$RFD1R;B0CS0h<0= $R2 1R:BSV@< =04R SV@@ *<0= $R@@< =04)0"0Q] 0CPP7 04SP1Z00n 00S= ;<00S9  R00 0S 0 480 00S$ 08 <04@P(K  0P&PP"'P0 SP R00 0S 0 480 00S 0 480@P'9 N -LM0*S$ SD AS S08 <04@  (0, $  S (S S |08 <04@ 0$ $K0 480 @ P``0S<0S P` 0@,P (` ,H`P,0Kp0@PD0` p0@ L#D <P`0@(!(D#Lp4  0  8 <0400: -LPp`@P P 000$ 0"U0P  0Pj -0LS@`MPP `H ^00 R00 A ` 00  0#40   0 0`P>00;000` P`80:0 0p0 pQ00( R00 R 0)P M0 00 0 000000C2Cp sP 0 0  `P ` -0LSPpG 0SpC `P p>  '00 P700;000p PpQ0:0 00 @ @[@B Z (0Ss2s2s2s2xs2s2s20[0 R 07P ՗  P p 0 00[0$ 00b $0[ | Y (0А0[0 Y (0Ȑ0[00[0 pPtpp: 0-L`\P L1\ D1\08!Q+ 1\( 1\" 0\% 00\ 00@T  04/02 <008 00  0 000h40h2` 022 022@02 202QQQ`&9 Q@/ 0- LP|@ 0\ 0| 0\004P/P 0S0S/P/4004/4\040/ R00/R@-@  R R R R R\000QA S S S S SL\00\ R*R Q 00\  R\R R R 0B0_S Ĕ\00 "#0  0@801000  0  0  @000/00C0S0/  h5 -P@L ` 5Pp@ 0@`p0P ⏏ -LM< \ 8 40  -(K8[\8K0@$L`X80K@0L p#D <P`80K@0D#L4p 80K0@#4<$D,80K0@#<4($LP`80K@$4$p80K@ $< (0K#  @@ @<  x6 -LM EA`  0pP 0p(K  +P 0pP  0 ,0 4D@ L  ,0 06x, 4oc -LM A`  0pP V 㨕(K0 $Pܕ  0pP8@0dS,K 6)[0` S @/+0[0 A RY, [4 00 < 8 YUYp00P P P 4 <0AQ8 xX Vpoc p-LMx@PTp $ㅕ>0 0`Q! 0$ <P 0ă \ #\ @ 0S@ S Q PT $phUP P '9oc -LM0R pO , 4 P`,  VP- 0`S0Sӏ8 P ʏ4 P0 0  ڍ84000P 0R ,P ,(K Q-L 耊: -LM<0p @R= 9`R PßP Z`KD PK9@KL \  0P@弙2 p 巙"20 孙x@T ^ 0S[ 0CS2ꬂ222|2p2Rl20  Rt20 Xv22$2Ԃ2܂222222̂2̂2̂2 2,2̂2̂2̂2̂2̂2̂2̂2̂2̂2̂2̂2̂2̂2̂2̂2̂242px 0. 0SP U0S `x 0PS@ QQ 0A0_S2lPx P0@S(K>0D!0<B400SP6x0P @R-x )x %x !x x 꼠F긠D괠B갠@ꬠ>ꨠ<ꤠ:ꠠ8꜠6꘠4ꔠ2ꐠ0ꌠ.ƙ또:::ȋ::؋::(::$:d:'9Ћ:::8.:::::::::: :(:0:8:H::::\:p: Q-L@ Ԙ0: -LMp`P`& 2PP` 0嫌@00@0@H4| (0|`庠p000 0S 3/P W`` M2(K0S 2W02 : 㥓@P 3  <`: r:VV W`2 z000 Q 1/<0 @R yRz R   pwp30@P0S8p 2  xQ xP Q R 0S ! 0,K >0"0Q_C 202202 202,04@KS!2(022003 S2ձ02ű0 4P tpPY 80S 2 81 -. 1tb2 `  $ 1X1 -]`Rr0Sn$ 1P 1!02:2B2<2  P 0S:P 000   뼠 :㔒x嶗xP8 60 Re↋P`< : rP` XS2oc'9'9u2ȃ2L2L2T90@-@QP0 2T?\0S 0R00@ -QLp`@0P12^.?\0S( 0R%%@P" 2`X,r`P2 00 0S 3/xP  0`$ 0 -PQL`0p$2U!2S 0S @ P 0@ P00P00S 0S  -0`L2SpPP@ P00"P00S@PR@-qr@ \^  @@Y@ -L M P`0p6P  P 2 L 0S@ 0S P@(K>0 !0Q㽑P 0 0P)08 <041S,0  p @,0@S 0pS Z I > H C'9oc' p-0PL2`S@2@Spq00r S\ o/80Q 0Q /  0CQ 0-LP@0h -L@P T, hp0  !  !>p -00 LQP`p p@ 000P @pR -3LSP`p p@ 3P@pS0@-qr@P\^  0@00@0@0 p-0LM` Q08`000 2S020 23 0S0 0ផ03S0 @00h叕@040TvP Hℕph400$PyOcoc4:-:,2t:D:T:// -RL(M000 `  L0 \qpP  #PP D# 000 p 0@T08 <0$@ Y0H D0  08 <040>0"0H@Qt0@uL  R  +pPm  PPe 42 0a0 p 0 @ @ @P P\s0@,0  Y0 040  8 0<0 P 0 8 <040P 峏 0@,H, P`0@D00P `  p4 0@ P#D p<P80` !(< 0@p#L4P` P`  }@0s PH K `P`(KY0P`0P`dP`^P`X N'9 0-0@0@PK@2L  0 0 S :;;S 0S (0@0@0@0cS -L@` _PP p# @P p 0 0p00 R0 P0  !40 00pW00  0u -L`Pp@P P 0000P0 P0VB000%$00@0P0p P 0-L@P P }>0P0 0-PL@P P  00}.A0 P0Pn0 -LpP`@P P P 00 00G0P0p`0000zPL N -Lpp`P @  0L 0'̠''D;0(T @0pPW@)@  p-L`PM@P P  0, 0f0C P0`<Pp@ 0"200 0p0C0Sr0S 0@ <0= $$R 0A0 0=/ -pL@` VPP p @P p  0 0_0C p P0  0#$ 0 pW 4 0$ R p0u -L@` PP p# @P p" 0 000 R0 P0  0#$ 0 pW 0 $ BQ p͆㱍0u -pL@` PP p @P p  0| 0_0C p P0  03 0 "4 0{pMW 偍+㔆0u -@Lp 㮍P @1 `PP @( h$00 0` S#T2ĝ2022222d22l22 2[ 0  00 ;07@ T0#30;@@\0 @00 30 0  B@0 @:0@T00 [0 0030 0 + @T [0 0030 0 + @T  @\0 @00 30 0  B0 @:0@T0000[00 0""Ġ " 030 0 + @zTr03 0 "#  0 #200廅b[0 0030 0 + @WT000L[00 \0#? 0s@E> [0 00 ;0d@6T.0#30 !  000  00\00    0 :0A@ 0u -L@PT 「`P e 2@P \ T0 0x10 R0 `0  !40 00XDP@hp-0T00 T"" 0T00 T"" 0T00 T""  0T200 T  0T#20 TT T(0T, $ 0T T T8 T<040 TTT(0T, $ 0T@3T 0PTً0u0Sl2p2t2x2|2/ -Lp P`@P P l 00 P `„ C0W0000&4 0`Pe p-ML@`0 PPP0\3 : c 0PKp -L M`S@P VP K 㤋p PP% T%J 0S0a0a010 @ B Q0B RJ 0 @P6P0D@T ;J -LMPp@`$@ ^P   $0K `@@@@P $Q 00  00   K -L MP $ 2pL@1,`P @+ (K $0K@@@ p@P$ R@ 00$000$ 0S (0S T0 @㿊 K0 @ N -L,M@`,@ pPP @I ,KN 0@@@@ p@P7,\: 4 0 < 8  0K@@@ p@P, R" 00 0<0 ,  08,0 040  ,0 0Q t 0 @Y(K@R(0 @F N -L M@`,@ ptPP @( 0K ,0K@@@ p)@P,0S@ ,0 ,   ,0 0 R T0 H@ (K0 Z@ N -`LepP d0( 008,d 040" P T ބ 00 @؄00 '7<l @ $P0 0bQ 00  0  1R0㨉㣉'88# '40$ 80 i1f  ㍄00d:9WEV2t: 0-DL!88#P!Tm@P00 8( 40bS80 000hhoc -LM  0)鈬22 -LM) 0)鈬22 p-0( LP,@l` R2خ222T2̭2خ222t2 0S0C 00 8+0@00 <0 $)a0q\@ph.p0 0 00Cs 0 ph800 $)a0gq0K<0pha0@0$ 8< P@$08<0 -L$M 4 ,000 0@P^4@2] 0, PS 0 t@(0D $@0 0DD08 020@iP@@p0D4D20  Py6 0W*(( (h(%D P`@ W :;0@!0 H008 ,1 p0,l00p G00 <02 (K (KoA0 2 0@Q  R0@L0 H@ L@[L0@S<0 8@ T W<@[ 000!!0@0,P 0 C(Ko0ux2 p-DL!88#P!l`P 0@ 0@0008 ;00< d@Vpphf0"0@0 kp kCphfE@oc 8 8-#TL%`[l@P0@ f0p8p kPU -pf.0" "2 K`C  2<2oc Q- L Q 0C@000S A  - 88LM#DP$l`P 0@ 7fp0 ̠opP@0T X,@ @@S 2Tp 0, SkpP202Q of2T0-.2 Pp W T .>2 02 .6pP2T02P 2p02 .p0 6oc 0-PL@p05p02 p-`@`0 S00Ɓ0,( L0LP2  0\ 0Q000CO@'4 K (^00X0ph_pꈙ2'9-:2X]2 -LMK 0 K*9 -P L d M@8 &3kpP 0@ je@$K 9T ,9T} K0CT 0CT 9T 0S@= Ie9T '9T Xp9T :cP@$08<0p0 0 -LM8 , 4 0@P_82^ 4  , P0 R 400@t( < $00D08 020@i<Pp0L r820 0 YF 0@Q _  0 U0&!:0 0H008 1 p0,l40f4 0 00 /4 0001 (K (Ko)4 !;0 0H008 0 p0,l40f8 2 0@Q  R0S0  ,P 40O(Ko R 8#8 S  0  0  `2 p-DL!88#P!ob`P 0@ 0@0008 ;00< 9@s Vpph\0200@0@0\ap 0\ 0\fP00hkjP01S01S00hS'9 -L8M0P<0 ,0 00 40 80 pP0|PPp 0@@ U|(K80K@K P  @@@PF0@P@0S0S202   0 <00S S 4$0S  S  S  S e S SR0D"P<2 0 0 0NP0@00G EW00U ? Y0 Pp{@ ` S  S '0S@202?0 ,p00 ,W@ ~00 ,T 0 !!g/ p-P0`PL00@8 ,000T08 \ppLj - 0L 0<,pLj - 0L 0<,pLj -Lq@ }q }D:P: 0-t0L M@P00< ,Q 8} @ P P  0 K0 )JK0pLj\: -40L M@KJ0< 0\KpLj p-0L@ P|0< 0`\00< ,T 00<0 \ph00< \pLj -L`P@000T22|2|2}T- T. .y9 ˠ00  0< 00 - "X @`PT T .q1à   ꜐: p-L M048PK4 ` x 0@0 , (` =ZP 044 L p4 00 , (` -ZP Kp}}@`2@:: -L M4000 , 4 00K(0 @0$@  @@ ZK`2 -1L!M4 080 0@0 P,0<000 P#m/Cb1L#`31C0!A}R?b1L#`31C0!AL`Dp|x8 hX(.}$,}pLjpcDpc0A@Mb`:(2:@:=j0gN  0O   ! M-- -o00~N01@pdPP > 0d 0T05*JWZ/ ӲZ,K 00K!P`0`0L00t0 R T`t0 \X }, lJtWZ 巽(K Hc0Aj! 00 Q0 ^@ 0 8 0 0 @0P@ `P$ 0 0`(0p,9) 0 0 (0@P `$ R 40 QR PL0L 0 0!!Ѝ XgXgtLjLjLj0 0/tLjLjLj 0-H LP0S 0@  "!@0  "!0Lj P-L 00 $ $z  z:4gԑ: -P@LP`p+0  "!0 8R  @P 0` p400P Y 0@@ 0 f 0!!a{ _{OcXg: :  -0L@  "!X0hmPpTX0 p  ,!0P\+  1P`+ 04 0004 80l2pt"tbp0( phvIl\:d !::G5: p-@$1$!@L`0 \00P5 `\10C A85@0 B< \0 0  0?1!58< @0 \08 C83A4 #:0 \p0x0 0-4P0@L8 , 08 \0g -@` Lp\P,; 5/ ,@ \P,; 5/D04S0D0D D @00H@0/Lj@-0QH0/ 0Q( 00S@@0Q 0Q0@0 0CQ@000d0Q<0 @ <0  @D0@0_W@EWDW@AW@ -@PL M`p @H^ WD @0/R 80 0@p0 < KQ -H0LS40ThHP 4qs/HP 4s/ 0-@L PR000 @ H0 BS@  $Q 80 8 R80 0 0hx0H040 0-,0P,0(L@S01 0( R  R d wD  H00 $ 0w 030 B 0C1 25004 -3L,MP|3< 8``RPp XP Hwj@(K02,# R07<0 00  (B(\00B0R 8!C8^8 @^000000,0 0  @0(p$08 , ,@P $Q , 8 R 0 RD @8$0 0  D ,04@P $Z_80 @D 0 P80$ @0,0@P, >4 0$#660 @0`A0<0Q 0 W. W, 0 <0 b# 0  0  00 4  00 0 0,`0,X V D0D 0SD0PDP @00@0J< 0 ? R< X b@  ]D0'R0@QOcLj 9 :sc -LM\  p^~PP ` ( `P  5$04@80PP< 000 @`0`Oc -0L@P`!!(  BRB3B3A3B3A3A3A3B3s ,40 \(0\S0000 0,$10l 0S 0< #30 0R:l@TP ml0 X `lP @_1C`V @l0 Y  `0lP@J1C` V@0@,\ Kd@0Sl@T 0s @l@d Pl 0 0l00 l0l00l h0l$!l0h 0$1l@`0S]h@h@P`@@TK PD h0P0h!00 1P`U40S1hP@F?D@hP@H=D@0SPdPH 0?`S@@C \ 0P6 d\ H0 KH0X0l TH  l0X`d 0L , `P@@T 54 { sT@H\ Jd@` VLgL  0SUH 000000@H 0 00H0 0H0 L 0S2H 0=0@00@H000 H 0<0 02H3L`  0Sg Rg @R  00HS80]`02 @0 0!D <0 hG/000H 80S0,0 P`@HD@<D0PhG/000@Q@ @ % Q @ R @0S P`@HD@@@<0S<0D0% S <P <Q P`@HD@v< DH,80S, FDPD< P DQ D RoXPR@LtH080?@9H DD<@P/@)H0DDD@@@L t 0SqH 0<0<0H 0;0H0;0H 0T0V PPL0S0S0SH00000@H 000 H000H 0000H00/d %P@lI 00l 00l0Pl00l Ph0l$!l0h0$1l l@4hG/00000HS 0STH 008 4 00 $0PR P8Qd Q& @Qs00 0 0 0H00 R'4 P]@WD@NPH`B@<HD@L@0P*`$@HD@L@@ D@@H0DCP@lP@+H@DH 080@DH0D<@D0@0n@D@yDT+9: -LM `S8QI 9L< SD SP1=@0(S@ U'S0PS@S> 0 SXX  S0 SL3@343(33|3p3d3X33333< |StSp  S`V.TSPS 0S780SNTQj$S0lorux {@~    fSX`V 0  ^S0S S WSpTS 0S hNS 0S@PD\ 0<#0C 4?S 0PS@80S 5S80SPp<@D@Ÿ^0" T0C@ S80pS PTQ SpS0 S0 x S0 hS0 XS0 HR0  8R0@ (R0} R0 z R0 w R0 t R0 q RTRX`VoXU? R6(KR-R*R'R$|R!tRlRdR\RTRLRDR <R 4R,R1 0@PXRU (KoR<0S SRR:d::0:-:R::L:::: ::ș: :0::\:H:T:`:d:t::::::Ț:К:ܚ:::: ::::X+::Ԙ:8:(:: :d:X:x::x::8:,: -LM0 4H`K4 8" 0 P @(KTK0 K` ;PH D0T p P L `0 \ 2  PhK6` S03h0 5* 84"2/PT00T  P(W` "RzT0K0K0 `;TT  0!"  `0  vPh 0 pP X0K0K0  0`\   0T  `0 \ UPh T NPd T GCPT AIPT ;SPTd0p00T0 "RU11(K0!R!TK !00K `; UQ0U PX2QL PJ ,0S<2 RUXX P X@ T@ T0X1V/0\!,0  YP d @P d C00\ pP \ CX0X p \1P@01 U\! P1s@P .EPDP 'EPO,p1=@0S@ WO0pS@O\ @P \ C0X0 X0 @0f@O10@p OW ,9@-9`ucX:0:-:x: -LPp`@3 $@ T`Vp @3 $@T3 $PP0033 p-L,M38`K @004 P 8OPKp3 0K40 K0 ` 0PP84 3T38 #40 4T3  400 3 400OPꠛ:ě: -L,M@QP` 3@pK 400 P N@ K3 $0K40(K0p 0P@ N@@$ 0 <$@T3( @400 3 400: : 0-QLM@ Q Q 09P@YQ S00L @ᮚ9 0陛9@0Q9L*" 0-3Ls@P P:PP 03 400 400= 4000 p-@L`Q PU P 1S CP 0$@T$ F? R 0S|0 R 0S0 RT p0 CP0 Rp<-999 -LM` P#0@TS X@T 0S0 S MX@TpM03(K0 0 S0 =~400pPÕÅÅ ?00 P M3 400%- P υ0P xMhM υ0z@P <M3 400 MWZC XZ Y* 0R WZ$@F? R 0St Q X P 1S BPO  0R 0R 0  P6(2("3$2# "32#"30#3Õ 0T3 $PPT 30CSC0!R0S %M *<P2 3 400y0 BP0 RT Q. KPu}0 R 0SL.Kxd0 3#0 3#0 3#3 $pP0 3#x0x 3#0::X::x::̜:<-9\ x T L Ȫ L*":ܜ: ħ Ȩ  ,3"/"0"1" p-LM`5Ps`@ Q Q Q phR&Q&h@Q l0h5lpl@ll( 0Eh}ph3&t 0-`5Ls@P' lPP#P Tl5` 400l%S 400dq l5 400l% 4000 -`Lp0S 0`V! R R 0S@P0!SP@ 00!R AP UX `4zczc -LMp `l%0PU/XPU, 00CS0  0SQ400Kl5` 400TT3KL0Kdq l5 400::t :-:x:::Р:ܠ: -L M0@  K0 @ PK脻3 0-LPP0 0S0 @004,00P40U0 p-0L!S@P "S p R0SbP`[ 0 00p -PL0p0 j ` j `0\ P00 @@:0'40 0:0h :T' p-LMAPQ3833L3@3@Q 0 00pp@0| (h0p9`@iP @@00Q0 (00`p!($p'Љ  p-|`L0P h@! 00 T040 0 40@00p p'l' -L MHb0 p P J(K 0坍@ 400P J (Ko+͊,  @0P, I@ 400Tt1t lIh1hQ1>C \1@@0C@D0C@̌0CR2 d ,0X 1@1 0R4 h 0X 0@oPP  0PI !3P ,00 0| 40@\Ip'x::̡:`'d':\'  L$Љ ($:x:: ;l': 0-@LP0!R 0S >P 0 !R 0S >P |0@TGD@T T \ 0 SQ 0SP00P099>9/ -L*0 -0L // -@$0L $0/ -0L -0L@P @00  h0( Q0 ,0 \00 0-L΂M0P @n n @0>2Q0 Q DI0 0  P0 00D: p-0L`P00 ,@0 \phaI`: -L$0@P 0hy0h -L$0@  0-LP@T  0| 0t S0C1$ 00P0#S@T @ @네:;: p-LM$0P@P `)@K\ 0G0H P 00P,  $#HKphꜤ:\3$9l$::c -L M0pSl!@ `H00 0P ,G(K0S00 \QJ1"000`p2A@P0@@$(P@03/à, < 0<K 8 4@ 0P %% VS L0 0704DX(`FZꌕ9:Ф:::3{c3033 0- PL$0$00- $0$0  $0  $0x@$0P@}0H0T0$0$  N'2 -LM@P`p <0 ` p0@@ 0 0-P@L m< 00000 P/\=jAi / -40LS03/ -80LS03/ 0-L<@@T0 \ -<0p@L, ,<0@@( ,{X0Sf  1 X`@0 <0@ ,@0   <0D0?0D0D0S' <0@@P( \`,0( 6/X0S0 g`* XPH @0 R  h@0H X `<0@@ L@$`VL@H R<0@@P( \`, 0( 6/`Z <0@@P( \`, 0( 6/ <0@@P( \`,0( 6/q<0@@P( \`,<( 6/X 0D0ၯ,X 0D0&<0@@P( \`,<( 6/ <0@@P( \`,0( 6/P<0@< ,<0@@< , Hx,PE0D0)<0@@P( \`,0( 6/GX @L <0@T@L D 6/804 H0L 0X0@ <0 @ D0:;: p-LP@^`T 0T@Tʢ?T Q L0DppQ Twp&+L : p-@L+P090/{c0/{c -pL `RPP21Cl @ 2PL^V @`,0BAD@ `{c\>9 -@LT@P@@P 00 R T 0@T0@{c{c Q-L@ Q h7 P-L 0 0h{c -@PL0@0 zh{c 0-P LR R@ R @00Q x0Q @X0Q P0Q @00HO@ @ @L YW ZW Q-L >hp 0-LMPh@P 0 -LH@ \P`p 0piPꧨ? D>9|{c -LMpppP@NBX X0`@HH00K< 0@ , ( $P ` "Koc-:|{cD>9>9>9M4////@0Q 1CQ/-1CQ00/00/ W@/ 0-@LfPcPUPP 0$0 R 0000OcTNj Q-L Q 0-L@8PP P0S0   0 0@0S ttP h 0S 000@HP@ 00000P fg0|c?9l%c(?9TNjg -PL<Q` `40A`t K<Q <QB@41s* qE 8\``00!r P P0S Q0S880L  8`\ <@QQ `40A`t <Q8\ @00@p 8\L ]0ST00P0Q!00< S9p쀟@ 0 S RL0| `Rp H 0S l0VSpt@ `<8 @SW `0T"1H a mE x(H TydNj ?9;Mb -TP@0Lpl0p`t/( t r 0l0 p00`Nj' -L -2LM1 00_040< 4!a0 @4``0P4 84l`Q@ `< 80H < LR @400@p #< R8\p`p00A`t  18\ 0 0 00 00S@,0 0$0 (@ P T@>,Kl 0 x\TK8@H (0,0 `Nj>9>93333oc(|c|c-:(|43|c,0 R 0s3/0S/ Gj -L0@$ 4(001 p-L0P8@4 #h(@T008# T08#004 Xp 0-PL0S0 0S0@ 004(, 0 @04(,004(0X004 0XP|c 0-PL R0@T 004$ (000$ 4X R00@T0004$ (0`004$ X004$ (0 084#8$ X0P|c -x@LQ 0 R 043$ XQ0 R034$ XP|c Q0-L@ Q 00S0<00PU0S $ (@08#8$ Xi<: -L0 @P` pVT T > (l0U008#8 U08#8 XivU00 Xd:| p-0 `@PL (U 10#pU = (p舦: -LM pR`@a R"w$0K*00PPj$0!$  0X$ <X$ 0X$ 0X$ 0X$ 0X$ 0X0$ X0S $ 0X$ 0X 0$X0 S0 0$0 0$ KB$ `0X$ 0X $(0X :=7=@||c::0l 0 d0R R PG0i 0\0 0 0C 000 0 0 Gj` T3/ -L@Q (=<: 0 40 08\00633/ -t0P L@@ 5004 , 004 ,@|c p-1L @P0`40\U U+ 5U U% U Upph504 d0\004 \004 , p5phr|c -t1LM h1+R ``VpWp@P,  8  4 0 0%" MK5< @D @ /@ TP $!5,840 ,(Ko\=jAi -2LM P `a0 04p\0@4 1\5k004 \004 , Z004 , 004 ,@$PK04 0\004 , 9004 , 004 ,@T50 04\$0 ?B#1 0 $  0$0 ($K|c -(1L R`P>U< ֿ0 04p\0@4 0\5trc004 \004 , 004 , 004 ,@N:@|c: P-L P P 0r:hh4: 0-t0L @r04 L0\0P 04\00500h|c Q-L -LHM044@ 0P h':%:hDpcpAT:-:/D0  0S S S 0 S/|c 0-0L  0S%P0  ^ ^0 PS n @B21n@ऊP0(0e/"b0 0|cQ0 0`/|cQ - L0S0@T L0 T,T 88S 0YC8h8L#8~4T6 \0sc@B -@Lp᯾`P@PUPV0P0 h -sLp3 -@LW`h -0LS@ PPP0lPe0P 0Px: Q-LA -LM@31C04`Kq@$PK4 TT T4 1S R$ B1S R* P\1 R 0!@ KVUUU  -L` ZB0PS @@[UpWPPU T1 dP R@ GUpWPPU@堠TFPX#0S9 0@S0p堠0W  P0Ӥ0 P00 o2P@QwP 0S T  000S0 S@00@@PW QT00E<0h40Ba d A9:;gfff p-L`aP`@P@U@UT c@Hpn@D_Pd T:@庺p -0L @P 3p0`0O0:00l:0P 9@@SLFh0scgOc p-PL``hw @ 0 0@phb p-@LP0`S 0S 00p3p00 -L -L 0-LM@s=e:Z7 0s0 Z0 X0\ 0 P`0d h P@  P c\]-@0@ @ <0K0t:P4|:8444l44p4gV3M3g/>P//A-tR M@`T`2`"?Cl2<Ÿ1C 0 ЍR2r 2OD 1C0@l21C@ P1B00c"!B0cP0`0 \0d!S0SL?C  ba"!BA00?000B00c"!B 0cP0`0 \0 S0SL?C  ab"A!B 00?00w0}cgVUUUNj1p@-Q= 1CQ x1Q p00p@T)^&Q# R `VPU1T^QRT Q V U 0SS0SSph  l00p  t0 0x  |00  d00ph@ l 0p0 t 0x0 | 00 d %W A W@ 0-PL㜾P 㘾P@0dP0h0 -L@Pp`P {PTU @ p-L`㜾 PPPUp     @ T 0 dᛆ 0PPPUp: -L M@PPK ں` P+H101(pKa] P ZU3T0\ `S( $  PX!$ X(!X%( $0TP`0\ (pK~PHý 00!00 cCa) 0 &λU d0SlhQ tpp`W (0| 0``$$0 0f( f$ <00S PPU;QMb0}cdNj 0-LPZ@p0h蓻 Q0-L@P Q 0L0S 0P00Hc0 㶽0L0S  㮽HSHK0P00 -@L00P0L0 0-LMLP@U K00 ㉽HP ) 0P0T L0  03H4 0-LM P@0W RMHD0D0 P 4h 0(K$ 0XK0 4,A9-:|c4R 0S p 0P /p/0 P/ p-L M8`K@P v(T080K@ 002K2K0 K1 K\08,0 P Dx42[2[   o4Kpj40u:Ч:: p-L M8!@0PSKp8`K ?(@3@  U002K2K0K1K8 KX08,0 P @>42[2[  54140u:D: : -L`8P P@ PT40pW  P ,''( 6H)@00;00000Evv8!00t:Bl: -LEM$PP`81 ,8 8# * pP 8141 0 S0 (@qP< w$0˅Qgp 0", 9P<,@`  0O 0 @TPM $" \04!0 ,1Ss0@< 0@P`ȡP `0,A@#T@!Qa ?8#808#8?@ ?8#808#8?08( 8$ 10q& P P (1S404l4x44S(K444,!0 d,! R(0!8.0OP`8 0(1KJOK,8  K80 KP t.0   " 08 Ƞ,ȠD0K ?> K80 KP t.t.0 0 p_DCHS%@ P.ah ;::<::$$4 ::::FBX:8 00000S0C00/000/ 000/ 0003 4 0  <040// 0 8#8@08#80/ p-L `@PKj0 8#808#800 0 B4 p8ph p-0L @` P 0(0K08#808#80 8ph K -L$M# 200l1 0(~U 0 ~ 0 ,0   00S00(e~0v P`%%<40!@0P8 40 0P 0@ 0O0 @ $ 0 5P%P0@0,D HP P0@000 Y 01@0 @( \$pڰ0c 0 9P)P G@  3P08#8= Ƞ,Ƞ @00 0   t3hP<P 0<$ m0,0 V` P,@}00000 }0@P}0040 } 8 {4@@0@  80 PA ",0 0,0D0 PP0 PPn0S0F 0 4P$P @  2 P,0Q08#844@@0@ 80 Pa,04 0,0T 0$00\ h 03@T@,<.P000 (Kor0 0P PB Ƞ,Ƞ @00 h,0 D L,0T D LǷ  (Ko!  0d@,\I-0 400 (Ko6 003@ 54ȯȫ:::L:l: -RLM0  `3#40 4 , 4 B B 00i$1P,  0(K@,0 PHŸR00 x00! $Ÿ0 +00 b +0004 00i10 > K@ ,0P(00 00! 00 3@ 8^4 0    E$(,\0 R 0  0N+4p 00i10 0 >p0400:@36+3 0004 \XPH~40,ȯ:40:\:l:<::D:|:::$: -LMp 200l>@ TP 04 @`=Up20 P( 00  ]0@6 0T R P0000r P 0 *000U@ 0@*0@000r$KP 0  00 00*000\000S0$ P` 0 0@  0@$ 000$ bQڰ0N\{P000  0 @^*#+ȯ::Ь:(::: 0- L0P@KY0h"ȯ p-PL@8`Pp00 00000 0 (0 S0$0@00 @ ,00( ,0 ,0$ $00 4040p=4:4-4 -LMP \`Qp @p @T V4 0`D @)T(  )}ch}c:9x:H: - 0L00S@ 00S 00 00S00 0ą0 0  -L M<`Kp@ P0<0K0 60K@?4 K7@KSK00 5 KP3[8#8 K -L M@pK0@ `u0  @ 09 K!@0K080K4  $PP 0l3K0P ,` P@ D$ K ^0@0K18 K40 9 K3[8#8} /$ >09 S" 6 04"40(Q(A 04"40Q. 04"40P$3(( SS# 'NEFX/ -L 0 h`:Oc 0-LMP@T |)) zwd0d`0a0L 0K8o P@$0$(}c\:;hNjQ0:oc8: -L M0(PK@%@(p~D@0 `P@ V 00;00z0  (K( 0@K0 $ 0z P0P~@P( 00K$ 0zH0e/0 ,0 0090008/y@ g -LMPpL@P 0  (%~0D `p6@P V 00;00lz$0   ᭏@ g 00s/S 0S // -$0L\0}c - 88Ld#0\  10<P\l020 }c+c - 88Ld#0\  10<P\l020  }c+c -LM0@400 -L Ƞ ȠX,^   <P 40}c0$ (0 / P-Lp` 00PUR,@l020@T+c -LMpZ0  PU S00 ,0K`P @p@l0, 20, @/}c- Ƞ Ƞ0L,4^#41 0<0S 0S WH}c 0- LRP R010<@T00 0  0p0Sl   R0 -LM`\@p 0 0PP2T 2T 2T 2T .|2T{ 0Ts -1CTc 4 00P P 2T00 R& 080 400 PP  0$1T6 1T 1TP  ~PP800Q080 n80P1  80 008 0 80  0$0oI 0P0~ 00PP00v o0S 0  0BS 4 00P]R0 00 0 0$VWPW0!R: 0S S410<`V/ @T' t!20#0 0pP$  ePt0t0 l0PX 0 !,0 !, 00 0KAP0 H 0K<0 x:t}cS4H4+c+ -LMl@Ph`p"m0 0 0(0S0  00Nj:Njt?j~c 0-@LQP l0 200Qx x0 S00 S P <0 S  \0 0h2+cncZc[4 -p LRQ  0$Qh -pQLP 0S0@0S` 0A P` 0S@ -LM@P j}AK K 0  ~ zK Q-PLp`𭝈1<@T 0R$ 0  `p0S0p0< 00@400 @  !Nj: -t0`SLpP@<0 S P@ P UP \0S hP -LMp,  `DPP) W) :@P: 0 S 0/ JP ) 0 0 P P `9,00(K0h@00P 9,00  㽺Nj - QL M`Pp1< Rp8@P" 00K4 K40 0( K,0KpP $K(04@KP  @t@P400( p<@p0S 04p0 0p@l` -@ LMTPp` 1Ta !1T` 1T @1TP 51TC 0T\@   00 @ 1CT$ X1T00 R ($ W ^ 8D@P.  0T i0Q@P 0s0S ii000S 43/@84 00@P `WUW$NW; S V \P\ 0l@L00Ta @XP ;D; S"  0 @0E8 U:S00P 2UP 30E8S0E8#X8UP 00Q1n08#XQh0Sd00@0 0U~ y0 00 00 00 00 00 @00 00 <0 <UD 0 ;\P  40 9 PUV ;a  `=0SL00 RLP SBl0V ;   0`(0Q 0Q!0S  p-0LM R3 00S 0S, @P`0S0C00  0AoQ*0 R>;  S0S0C00K K 4O 0 Kpgg~cg gPH 0P 0Q `0SX0S / |/(~c -00 0LS@ \ @kg -|0LS@PQ \`V p\`Vp 0U\0 pP\P\`U   ꐰ:: Q-L İ:,0 (("1XP /(~c-00 Ƞ Ƞ,1XP (~c -LM\P`  &4\ V|40S @ d4\$ 9X4\x aL4\ D4\ <4\ t  0p@3\ 3\ 3\ 3\P< Sl$0< S<1S`P _@d3\6  0C\ 0\} X3\PV@ 0C\,3\ 0 3\ 3\ 0R 1  i>2\ 0\J 2\20S20S 3/@ 0@0 0C\0 0 0t  0p@t  0J0p!0 >@PK  |`  0@0  Sr@PpM0@     00 @l @$010:t 0@       00 "?@P   m l$!l 0@PlW W W W @W@W @W WWW WW@W @NjNj`~cWP~c -LM\ 0\ 0\ XP* 41 P0\ 0pXQ 00S00XP 41 r 0, Q}f~fvt|f 0-LMP@@0@0CS00h0@- @.@(~c -`0L Ƞ Ƞ,A0S040000CS0A(~c 0-0 (("ALXPU 0 X0 M`0S 0 0 P3 * P (~cа: - (L(" PP$0AT PP 0SP `0S 6 X`VP 4p0H0PP X`P(~c p-X@LT`p0 ! PaU  " 10`vP+&0S 0Sp04 ph, ph000Sp: p-0LS@P`'0S  lVPPp\P l0 $0|QpPph- UpQp0P`0ph00 0-@LPQ 0S \P l0 $KQ0hA n p-`0LSP 0SH|0Sl1  X@T% 0S" 0`0CS0000 R00%0S80S/0 31C P! W0Q&ڬ 0 S00 S P0 ᧆp00P04 00g;:ncZc4:,0 -@@ @$@@LG0@ gg -T@PL p `DE $ $$ p%0 @gn4y4n4g -T2 00| 0PL@P U[1 0SS l l0@ 0p l0 0Ct x0$PUGp`l0$ R3 X1  P-  l Pl  0^Pl0$10S+ X[ P/ Pm  (㿰l   X  Pl  Plp`d0d@\Q D 4l~c@: g4L:P~c`~c-:8:g:h::0Q 0`c/  <8S@08#/<@8oS/: S/>; S/P/ 00S/HA9 -L@Q ꠍ4444|4000000<000000000000000000 -<00000@ L!pW`V0S \ P0 UD*\? 0@ b0S0@000S0@00 h40\ $0( 0b0 0, 0b 00$0< 0(0,0/@0S/ \0@0/0\@ /DT0 0/X0\` 0  ` X0\/ -LM@  0 P ?!?CP  00 0 0P ?"?CPG- 40 00Kp$0 p O0x !!! 0 !!!f0tPS4`K_0SYt Q|0S$0S'0S* 0S- st08t0 0 S|     K0(00|0t Spp 0S  0S  0S 0S$ 40 444 0S0S 0|t GgX04 0p44 PH 0P 0Q `0SX0S / /ᔁc,0 (("1XP /ᔁc-00 Ƞ Ƞ,1XP !䔁c -`0L Ƞ Ƞ,A41S01X001&010CS01W蔁c 0-0 (L("AQXP U 0X0l pa`0S 0 0 PG>P ꔁcа: 0-0@l0LptXKT0 00 PU(P  0h꼁c@:-:@: - (L(" PP$0AT 4PP 0SP `0S $X`VP 4p 0H0PP X`Pꔁc -LM0pS8 `V R ʯ4 0Z,0 Z8@P,ZP:"0 0` 00a",0 HP*P U@4 @4 0x!1R000 T4 Q  R1X10 0 \400 SZ8@P U@ 0PS0P  J0Y / U @,4 0 RP@ `u   P, PP:08"S @  0, PP*(K,P:Z8R@ 0 0a00a" ^  1 0C`, P*@4 f(Q0A S Q Q Q/1S 101/t<z \t0t000t0t0/ 1!S00 1/T: -PLPp` t0"1@0#"@@@4 Vt0t000Ot0t0 T @T10bc  %P t0@00 0-L LRP001@0 "L@P̦t@P@0 p-`0LSP X@T% 0S" 01`0CS01000 R000S10S(0 31C 3P<0Q#ڜ 0 S00 S P0 {tpL 04 00);:ncZcج4:/ 0-p@LTPX000d@T0 -L -p@LT0 0X0d@T -@X@L 0-PPL@0 d `Pt0dh0t @\ tR 000S 3/PXQ 00P0d 0R`0h0h0h0t0d h0 0 0-`PL\0@S 000S 3/d Rh0h0h0t0d h0 ` 0X0S 00 -LMp@Tp` P0\ 0 ( d>,0`SpPBQ *0S  0 SQ:(( d>b$>.D $ 0 (0Dd $02  -LM@P`p 0@000 P 0@@` 0@@` 0@ 00@p@`00 0 Q Q Q/!R<00<0 ,R<0<00<0// 0-AL@<0)Q944444H4h44444444444444444444444444444444444(4!R@P ,R @PU (0@$ 0<00!R0 ,R0<00!R0 ,R0<00!R0 ,R0<00!R 0 ,R 0<00 -0LS@S 00\P  ^ :!0000C9Q^0/Q\\0 0 C^\\0 0 C00 p-QLMP@J Q: Q `P $ 0S0d0p 0( 0CR0d0(pd( 0D3>b$>.$00a`CV D0`P $0 2 D0`P  $$\(0D d0 1 `P $ R  D0$ -X `Q`ppPgUL@T 0D0T `0S UT `0T ` R $0 R0d0 0( 0CR0d0( -@X`Q`ppPgULT 0T D0`\ UT G`T ` R $0 R0d0 0( 0CR0d0( -L$M0Q 8  4 gRP ڀ;R /t;R: h;R `;R X;R JR APR oKR& MRT`X@0$S 0 `fS0!aL\XT xX@T` KnR3 ڸ:R <R rR0S 0S0!R CRllQ<0 0 0X$0( TBR GDR HR<@_ T0RX 0CR00$0` RN $0 RJ ( 00CRd(0d0 >3R R !B0<0(cR fR XRd( 0.@Ro ARi $0TR a`R !0bP$0V 0SS 0( 00CRd(0o8RI 8R 8RE4t `lR ;hR:0S@`5ژ! ^0`S@K0S@`$0@SAژ! `P` 9TX0 $0R0`` 0CR00Q$0 0S d"4h Od 0 3<(R nR`1`!@ dR ,$ <, d(D0$0,<7 @T4 ( d02!`S0 BS(0( S<0S0!c@<@(00CS񟗡`44444444444444444444444 4 4p <0($ T0$  c<`K04%Bp  P 1 #44 z\QV R(0 p/l0SH4 \0S$ ^! p@\00<`KSX$ TğWP4 0@p  P 1 #4u p^0 @4 j77 W30S@` 0@S)ژ, HP` !H`PLPpA 01S7444444444444444444444444444444t4t4t4t4t4t4t4t44d4X4X4X4X4X4X4X4X44H40@S `pQ $K 0(@K@P$0( Pp@0D H`LX`p`(pCW``C````````0S@`Âژ, 0`S@d ><(@R dR`1`!p gR ,$ <, d>,fD0$0,<r d0 S0S0!0C$0RB ]W0, DL P0@H0Ow$K?l?p$?h?p!c>J?u&H:0:T::|:t:h:`:<: 9:9D: -0LSP`! Q"@𨝈0! 0@T2D 1C@p`@D 0! @00TC9D9 p-0LS@P 0! 0PU0S`P 0  0P U0SH`P 0  0P Uph E9 F9("Ƞ,L(oR- :  S >;  S F/ <0 < <8SL$ 10;C  3=8S$ 10  >08S# 10  <  >8 S # 10   3\ ~0C\ 0C\ h0C\a 0\- #0%2$` m`0 V@P -@SL  A0F10 #f8 - R0L00@ DH10C1 ! h -LM@p `&PP  H D0᠏P  ڎ 0P000 00@@1 0s030  \ HD0  !1A/0S1PQ 101H0D Q   0 0 HD  S p-`P LR 0S0S RMp@p 㸎 00@p00p0c 0-@L0PS 0\ 0cS0?000P -`L @yP 00CS,pX `00 T008@$ Z 0 00<T808@<0  S<D h@0S@8 m EH$<ED1c!@0LP ($ 1X0$ \0$(0T @0`d0h0 @0 1c< 0@b001"P` DhDDd c,2,"0(2 $"0 2 "02 "0Q0 0I,0F1 0 0A S 5p5p5p55p5p5p5p5p5p555 DD$<DH,0 |,pAzt,p  00!0 (1(!0 1 !0 < ,0$z0 0 `  `<P @@ 004  b<@P `0 <" `|  ,p p,pR<a45845\54444|4D555|5X54: -LMP@Up`}0 S^ 0 0Sa,0 [ 0 P 00a PPJ,0 pkQ,10!48<Q@qN ' 0S$ 1!01 !01 , K0 0 7/HD0R   0, 0 HD  S Fa[K  0 K) 0P ʨ,K K$ K(0KP 0h 1 `0` 0 X0X 0 P0P 0 H0H 0 5 55, 5T554:X:555 545 55X55@-A0S 1 00!#1  1""00#$48$0,0c80\DL 1  00 ! #1  0""00#$48$0,0c80\L 0 00| |#1  h0h""00#$48$0,0c80 \00=4Q *@$?4S0>48$P0R 0>4=4@4?4B4A4D0\0X0 0$0(0,0004080<0@0 0R` Pm p 10W,0  WI3535X353525p`P@HD@ ,0S 5*0JS5555d555545@,0`S Z 񟗶656565656565656575758575j!a 0R@S Z 񟗓6555$65H65P65X65p25`65h65p65x65H@Dt@0,0 10,"A @,10,#RA4>>0 0@4A$A4JL 0RP0 0BL00 h |(K0P0T4T \04X00=4( Q0=4ȅ0=ȕ\0!L0 0P HL0,$0  h Z0P0T0P0TB4W0B4 0$B4S!??Q/$ (0R+10,"( ,#?#B4W0B4 0(,048<@DW 0?$,?R10 ,?$ȕ,0B480 004P ^0W ! 0^P RN \P0M ! 0PF RD \0`0044<40C R<$21C01 dA`@0 0 4Ĉ!l@d <400S<4@ h 04X04\<$21C01 0z10` !10!` n h 0`\X #`0 @-@\pP  \ `1 `#01^0P5@10L\!N013 fW00S300P/  p-P`L@ H@8d0PpD -LhM ` PpK@P <0S SZp0S D0Sl@P$K -LlMp0 t 0  `KP@P @0S<p0St0 SZ80KYZ@Y @(K -LhMp Pp@`KP p0S<0SW,p,4 00*qPcg0P$K`1S`/-T1S0T0 R \ 0S0S  QD(K0 0F?C, D \\ P \ 0S 0 S  QD( K00F?CD \ D1S BT\1S n`DP ]K0 \  D@TKo(KK D_W - 1LSPp @`1" j 1 S`@ !b1S 2S i/_ Yi̼ 0-a1LS@P \P bPP  X0X- 0 :Oj 0-DPLMXa@ $K 0$ P  \K0蔡c(|4 -@L`pPP @sV0, Xb10Ya1P 0:OjC5/H 88 #Q 01S 00="R//ἡc/ p-<2LS 00pdBP `po0S phWo000 0@@0Jn -LP 0@R01S0 10<P 輡c 0-Lt 0@R001S00 10<P0 PP0  0h蛁꼡cD 0R/0!R/00 10<P/ 꼡c Q-L : 0-0L@0l0PS * R% 000 00S0 S 00S0 0hm R <0 R 0  0 Pj PjPj 0-0LS@0l0PS 0  ¯0S0hm: 0-L@P0h p-Lzl`P@T" @T" R0000 0     m ]l0P0S0ᨮ@Tm0  {Pg Pj: p-L@l`P@T @T' R0000 0 0000>P 00S0r@TYmUm lP(@T0  8Lg PjPj : p-L@PP 0Spk0`  R l05*  @@ 00P0R 4.phm$)R00PjLgPg Pj Pj0QD@2/P 00 0-@0P@2L0@20 =R00800P8008P0 0-0 L80PS \ 0CQ 0 dP g0 0d20 0 @ڭحСcPgLg -L M0P=2S @2* `2ST1 R8Pi$K0K10`Kl0(t `VpQ:J0P18 ϠT?D3c0Sc 0P@2 0=2@P n 0@00 @20@20 @2 `2S `0 @20@28 T0, 0S0C00=@`p PjMb -LlMPğ @.`0 =rW@ 4Q 4Q{ 4QI 4Qd @(K3Q 1Q 0B~S1 0< RO L@K3 p`0 \` XpKTp 00lPK80081 PU 00 00K0 @0^!0 @ 0 K p0 , | xp tp L @O 0B~S1 0< R 2@0 4p q<` 8pK00L@K80081S@ 0B~S1 0<P . b@  @ ^ ^ 2^|  Zy*Rw 0< R Z@P 0@00 0Pd0 `@ 00K l P0 hP T , \ Xp )T0PS0@E 0 8D<#8 P@ 0Z 1!Q T0Sl Kģ@U4  ~/ό@* 0B~S%1 0< R 0@0 4p p<` 8pK00L@K8 008h0S @ l K▣@P0꼡cUUUUU@F5G5 G5 -DL< <0}P, ,,0}P I5c:cxJ5P:X:(: 0-LM@0L04 PP@@ T0S008  K000 =2|:: Q-L@ Q hD008 R 0 0=20<20<2P 0 <20C<2008 -HrL`PVq 0}/000DR00#`B 2 @DdTV5V5V5U5[0 0=20L0Sap0S0 <20<20 @20@210@ h \0`Pdp00 ed00d"RJ qP%00 S8=2Sl00`"R!000f008id0L00L0 0  T00S 0<20C<20 =2S~0| ||@x0t @```z|xP00=rСcc:Զ:-:OcM5PjPj:Lg Pj PjPjPgS5:0S/0="R/00/ 00 0/\/40  /40/@-00 00D Ƞ00@,Ƞ  4@ 0D@ 0-L  Ƞ ,Ƞ000  P P@% wD04P0D00@-` V @P x  00Q@ 0 0D4`q0  D0PQ0-0R00\00^00L//8/0 R2 1C/ -,0L0S3/L0S/0S40"00/- 04 P#*0 \*0S \0S /P/ - L00 -Q  <2<200C<2<2 L<2S00-0^  0S 0S  ^ 0@- 8 ȠPQ@#,Ƞ R 0 S0^ ^0R0 -L@b 04 p-PQL`@pYU 000ESQp 000 0ASQ0p - 0SL *@T 0S04mPe at:H: : -@LP ,0P M0 0訷:)ԡc 0-@LPTg0H0 @ H0P00@ 0@h0 0-@L=gP0 P$0  ,0P0 00hihD08 00D0< -D0L0@ 80 00 p-P@L00 0K K`K`K 0`K0K`K`K)P  K0Kp -L M8@#hPP @pP@ 0Č.0 TP$Y0@0P *(K`} 02K*K2K1PK0PK/PK.PK-PK,`K+PK` `P~P*0[  @01K `2`K0K/K.K-K,K+Kd -LM@0K p-LM0@SP Kp `PPV e y0  K 0K0 B0K K 0 KPKPKK0KP 0-LM@P0  K0KKK0 KKKKKK0 p- 0LS@p,` P 31C  0Sp;: p-LM@`^P 0S 0S 0S 0S P Kp  0SK0P 0R 0 00  @00 -LMp 0K`P@P KPP@   0` @z 0 P 0$  0P`0 @ 0$@@  -LM }z -40L 3$ 1C@NPh;:: -0LM@ 0K0KK0K@K@K@K@K@KK p-LM~@ATCd KK KKKPK`K@K0KKp p-L@MPAd K!  K KK0K`KPK@K@KKp -L@MpBTAd#0 $K$0K#K!PK`K"K pK@K@KK -L@MpBTAd#0 $K$0K#K!PK`K"K pK@K@KK 0-L@MAT 0  K0KKPKK@K@K@K@KvK0 0-L@MAT 0 K0KKPKK@K@K@K@K`K0 0-L@MAT 0 K0KKPKK@K@K@K@KJK0 -\0LM@A0KKa0K0KKKKK@K5K 0- 00B1 0LM8_@#\ #8KKKK@K0KPK@K@KK0 0- 00B10LM8_@#\ #8KKKK@K0KPK@K@KK0 -LM@ _0K0KK@K@K@K@K@K@KK -LM@ 0K0KK@K@K@K@K@K@KK 0-LM@ KKCTK KK@KPK@K0KK0 -L@n0 4 R: Q 0 Q05:0!SS p-LMP(@`Tp   004/p -@Lb40(0S (0,0 @,000hccc -L$0S h 0@0yb$0S0 0 0@ hcc -LMP`pcb1@T(@T 0S0S: 0S:( pR,0,0,0  B c@c0e w@P 0 P` p0  0,P e v(K 04P00 0 P 0P@  8 0cc -LM@R@QhB` u@P 0$0@aPp R-@ 0Kb@P+ 0$@ 0 00@S00  P  00@Q 0 0 0b R 0SbcP/0 S  0 S   S0 S00/p@-0`4 \P *0 S @  ^*p0S ^ 0Sp0S@@VU p -L@p`PP 0S 40S P P P S P S:\  R @0S/ B/40P/e u p-`LP 4P L0PU@@U4e uLP e uXP e u 0 1@0<@dP e ~uhP e xu`P e ru ephmu p-`L\0SX0P P@`X0P@PUpP -LP`p4e u@PP pP`0 0p0( p00 PP0@ e'u -qLMP@` -K 0pP @$K`P  0TTP @u @A,[Z* [+0[T /u @ 0@hP  t@ p-LM8P 0`PU@PmPp -LLPp4@PA 2`@TD  e 0zuPL0 T$0P pPS 0S) S \0 \*S 0SP e t000S 0S@0 R 00 P T0 p 00@ S 04S!4000$:<:0:: -LM@A 0 K0KKK@KKKKKK<2ST0 R 0@e000 (/ ƒ #30㶢Oc;TgMbl: 0-LP@P00h 0-LM@A0 K@K0KKKKKKK@HPP K0 -LDM 0`Sp L0PU@@"U4e sLe s0 040L0w* ;K 0CPP: [R8[90[esPP @ 0.PP@ T e s(KPP0SPP00  0 \+Y P @   08P P > _020Kh02Kb K1K/K,0K+PK0PK.PK-PKP_0[ PPp e 0tP4P L0W 0@@W  qPP @TJ@TZ*KP*0[ t: -L ! 01 R101 01XQc QP@] G 0+1X P@0Q0U0SU2G? P0U0T R ;\\ T 0 S  0S 0 4 \\T 01[OrX`Q  Ki$H 0 KiP!  -L^KBM@KPEp `00  PV@ p = p<0d @E0;:PD`d  Td@d PeP @ d ` 0 $K::(:90: - LPp o` ;W @T o Qq `q PW  o,q(9H:\:<:9 p-0L`e @oPP P 0@P 8pe loPp -LM, p@Ple oPP@p ,0 00-0 3,  0 P0? @p./12 00 PQ 0S _ 0S[  R0001  0@P78`d@ 0`P4 2@T0 001 @D 0`~P 2@T0@D100@}0 `f@P 30 0(KZ" 90S& '@0 0T0 ^ 0 S  Q 0 S T @?0@S@0?0480S?0C$1 000 0S  3/P  @0 0  10 0S S\f 0lPF V8p ` 0  p@0Sd  }? 0  00>0S0 S !00`00\pp8 0'pV8  QP  0T0 R 0D0Ȼ:|:5X: ::: 5t:<:: -@L0S 0 S  - 0Lq 0Q 0`00d/ 0-LMPP\0@ @X  @ @X@PK0P -L M@04 P_P@$ X pp h0P" X G8@! 0K4 DTGd 0K0/K.K-K+PK)`K,@K*pKP (K d b -L M@04 P#P@( Y0 +P'  @kpP! 0(8@^0K4HdDT 0K X0/K.K-K+PK)`K,@K*KP(K j ꌢ5 p-0L`@PMP UUP 0   jph<0 @ QPPE  -LMR@80 pp j8`0^3K04KFT,KGD4K 1K/PK-@KP2K0`K.pKuP00P00S0,0 Y G8 tj,(K -L MR4 @p ` ` jp 8P!0000K40EFD 0K )@K/K-0K+K.K,PK*`KP @@X ?j(K -h1L MQ@ P1Q& 1CQ K01Q800Q. Q< Q@00 * 4K K0 S;#0 0 LQ Q Q@00  D00 8 040P D00 8 04;0PH00 H00 UDUU@ 0-90L4@0090p PBUpP0TP TPXP XP@P @PPP PPP<P < 0@S<0S=QX0S S 004 D0PS4< @0PLX0Sx 00`@sP`@> VX 0BSwP2 X R[ .:R,1T0Y 0BS;5\5\555t!p!~l!|h!z@!x0Y0R0Y0N0Y0J0Y0FPpiiiX@Y@\@`@4`PY0PX0*>WitiP >0S}O=y`0T04> H0P ::::: :Tk9ȋ::::::T:8:Hk9 -@L0 0 4JS00X0ĵX0ĥ -L@40S0 0$ R 0R  R0Y00Y0 0-L M8P?00ED0KB0K KK@K0KKKKPKK04 -8LMȠ,Ƞ#85 `k9 -@LG00hI -@LG0S00@IS000(0RR00(0(00 (0SP( P0(0 J0(0 -LM@Q` $pSJ555052 %㼠 ŷ00 " 0>00 01 0@0 T0%(KQ( 0 R* 0Q'0(00 (0SP( P0(0 (Ko` 0(00(Ko=0:0 0!0(00(0D5:80S880ņ] -LM@P4`0FP3 pW00 00 0! T@  0 P0(Ko0+ R  RW\0(0(KoT@$ 0AP(K5: 0-LM4 P0S K00K @Kx P,KR)@K0R L( m0 %x: p-ALTP` P K` C[01p p-PL s[@`@ @0!02408P40012` 902`p 55tc p-LM`2 <2PK0@!2 D00004  嬞00CS0p2p2 p-LM`022 < ;PK@ 200004  偞00CS0pp2@-@0 , 00\#^? p-PL`f?(0,@ $ p 0-PLP"24  BT i0@Tf0 0-LM@ ?P  K0  ?P  6$ \3> @UPP  T̠P(T34/ PPw::D54:\5 -2AML@`@3Pp0 DS@ 0@#C40<@3,O``  <GP R 4\;lKp30p3'5T: -@LPrP43SaV~ᚎP P o01kLP  R{0106 -@PLDPh& -Lp8P_Ee43S _`0@0 "0R 1 S4#i>F0S -PL`p@PDWAI WW# 0 0@0@ l¿W iF0 0@0@ p1S 0^iE,&l: p-LMP0 0@0@`\啿D0 K@<0< 1S 3EKp: -L`PP9@U UUpp303PU(h`#R00@`0@00@0@C9 0Bs: 0-<3P@SL8HSDS P< P@ 070 p-LR`P H ; 0 0 @ @p@PL 7p+1 87p; 00: -1L$M8KpP`P 9@ U UU$K303P(UR ̠PA(0 L  @  ,0KPa 0, 娲,0S0 0@0@C 0壾뀃'KA ㌲%0[@T%@K,0 0C,0 0 06 c7P C@0 D(r9\5: 0-@PLL\S H7P P3S 'PP 4PT 070 -LM0S 0S  0 Ƞ8,Ƞ#8G uP,q9 -@LY|30CS|3h|3 0|3eY -L M@p`OP K@0F@*0K>0CGT*K" K)K(@K'K%PK$0K#K"@K!K&pKP -L M`@(pP K@0ND)0K?0CHT)K! K(K&@K$PK#0K"pK!K'K%KP -@L {  h p-L M@`PP Kp?0F"0KB0"K K!KK0KPK PKPK`KP [0[ p-L M0P`0K@P Kp?0F!0KA0!K K KK0K@K@K@K`KP[ 0-LP z@@T T ?  ~$ f& ~b?  (0hH~ UX': 0-9P@0@L9 YQA =ϐ(P (P5(S,P ,P20,30P 0P003XP Y0X3PP 0P3DP M0D3<P 0<30430 4  d:$:D: p- 3LP';A9`@O b 㲐00S 0@(ᲇ|30CS|3CpQi -L`   9 8#8  )2S<9 9  h@@ TPphQP@@0$nWp -LP@P{Ap)n @VT7P# 7P%  C <a(3S 9 @09!Bhb@0hB,*h{BJP htB:: -`LP@p@P@ #A0T 0CT!  00+@4T$ PB0T 0T0/@ @ '@608#8@6j@6@@@ z@i 7i 8i8 -@LpP` & % (@@T ( T hf奻: -LP@`pPb %@ (@@T ( T &@:H$v: 0-PL; a"0R<  V0@Q  R#  E >l@P0? 0 08#8 0hc} !Ss  0- L P# @@T #Z T !0h/: p-L`@PP@4U0@p -LM@ P2#"`3#娃嬃ăȃbU 08 Ƞ,Ƞ#8G t?S!^0C @/@t0pS@00S #0@SgP   0P# P$#0@S3S 3S 哺 K 卺$3S ?&@KLP <y) b(1(!9! 1 !1!0` h1!21_0p"2@r 0ٍ 0`–\  ᫇͋ x@ 0` ގL 55:,q9$::<:5555 5h5,5l552S/ -@PL;Ph -(3 @SL0#$8# P( P, (7 -@3 @SLH#<P# P@ PD @7 0-Ly@P +1P ; 000@ -D2L$M @0?#Ю0   b  ,0K@,pP   PP^ ,Q /08, #X$ Q%@ 0KJ[2[ :,: 0#AS, QP0:p 08#XQ30, 5:c, e@P0 0@0@ )s9P6P: -LM0S 0S  0 Ƞ8,Ƞ#8" :Pr9 -L,Ph2D p-PL9`@09ia~P P6cP |P403P rP03HP 0H3@P 0@30P 003(P 0(303p C <屸 C $媸 C 壸:l:: -LM?`PB 08#8႒Ⴁ @ j"K2KT,K ,@@Ls,30 0p P j@0S (,3/  p(GP b(K0K2K,,K EpꂒႡ j ,3 p\30\3'6 -PL3@SaV~ᑆP P hLP  Os0106X01 -pLP`:P =V VV$ 0 0@0@ S xV iE>ia ' `1S 0 0@0@i2>0W: p-LM0 0@0@P` \Ʒ<0 K@(a( 1S q>Kp: p-x3LP:P tP pP l<|3`0CS|3x9@O ] Z00S 0@ЈZ|30CS|3]=pj p-PL`7]?(0,@ $ p 0-PL"2  BT %`0@T\0 -LM`PpcP @0?0(0K(0K:CJGĠHC6 (K%K#K"0K!@K'PK&pK$KP K 0-LMP@0( P(3S  0P  H0P  00 0CP | 0P<s H0Pj 0P (0P" -LM`@ 0S RPpK0\ pn![P04"48#(!K[#<U0@KR -LM&pK@d ცP K 0K4B [0[48!#8 ? ("(0! 8#( 2S<8 #8( "h908#h 0p 008P#h PPZ0K Q 0 U As9  p-LM@D;_`$0b67Pi 7P 0P=3( P3 P3 EPl 0K? [0[ [ 0 ?P C X5<Kp3#4  ?PP C ȵ< )΄0{7P 巵 <D3@/ P@9@0Q9S;ˉ2 R ,哵; H:h:a:P6,: -PL@`p:1T% 0CT-  00⛆@4T ;0T 0T0/l@4T6@ @; @ ;@608#8@6@@ <@i 7i 8i8 -p  0p00LMP9@ 0@Q Ro 0R( R) RS0,3@00?0 A 0R R 0 `P PhS S?  S S : p-@PLpPp_p9`Z3S ph; -@LP|30CS|3h|3 0|3O -LMP@p`P̃X $KG4%0K&pKh 0`H&K 0HA @40`:T v! : -LMP@`PsW K"`K!`K 0`"K0|   @d0`T ?!["0[X   6 : -LM`P 0`"Kx 00\ `B[L2BKTR 0< `($4Spm <`K @ 0@0 @K 0@{ W0 @ 0@o H0@f 04@ ] 0@ K 0`w(Lp3` 0 0 308#8  0 0H`O$ ( 0`F  " -LM0p 3P0 2 08 Ƞ,Ƞ"#83@o3sCCM3C3sC!3 P,P0P<`3 " 0S;930S@00S #0@SP   0P# P#0@S58 χ0p O0x f 0&PK|OP0e 0χXL0qv\(᷂) Ϧ 0ph⃨1!91!1!1!2!1_0`"2@b 1F 0 Y—\A  y: Ta8 <夲 K0&PK$OPX0 a0厲kpu儲傲03m}^0lv 0 t 1r96:H6 `0,:T:96466t66h6 6 65:`H::0:<: -@PLrPhT -(3 @SL0#$8# P( P, (7 -@3 @SLH#<P# P@ PD @7 0-L@P +1P ; 000-@ -$3L0M8Kp@P` P9@ T& TT(KPT 6@0T~8#0hŸ     ,0K@S,Q0 0@0@#0Q O"88#QW:8#8SD0 H <@ 0 0@0@D< 0A8#8 D0 < @d1 0`0SE0SBH <@>$(0))?@ [P @0C *2 08RR#820 2B Ky: Dpo0 0@0@dcDH1D<-D0@  S t9t6d:P::: -LM0S 0S  0 Ƞ8,Ƞ#8 6Ps9 p-PL`V?(0,@ $ p 0-P0"L3 BT Y0@TVP0 -LM`PpP @0?0(0K(0K:CJGĠHC6 (K%K#K"0K!@K'PK&pK$KP K -@LK|30CS|3h|3 0|3K -LM*pK@d ᇤP K"K4 0! ["0[48 !#8 ! (  "(2S<8" #8( "h908#h 0p&Ġ 0!K"`K|"08P#h PP^ 0K Q 0 U A,t9 ! -p  0p00LMP 9@ 0@Q  KRo0@S) S0 ST0,@300M/ 0@S S "40K KUK| "0@=T PT T<8#( T T 08#(6!: p-@PLpPp_p4`U3S ph6 -LMP@pPcV KG4!0K"pK"K 0,@T 嗯!: -LMP`pPCT K0KL @T [0[W  l : -L M`!pKT 0p< 0py!0[@003#K &0#@K"@Kk  &0#K"@Kb 30!KpWd $0!@KpM C0tG" [#0[48\##8S  4 0p7![Q Q Q5  S K 30!Kp# 30!Kpd &0"0[#@[ DH$HJH$̠&0$H`"K#@KoP׮30'0KL <0& K%K$0K(K(K  .04P U0!PKpR T0!Kg@p0 !@Kp 50!@KpUh 0"K#K0PH $0!PKp$ $0f@Dp7 "0#K"@K "0 00   0!K 0V0(0Kg0C&0K _0'K% K$0K0O (0K0C' K&0K8 B0C% K$0K|! : :Q -LM0` 3P0 2 08 Ƞ,Ƞ#8Z #@?#cCCH2C3cC!2 P,P2P 0pS S S:3  K:30S@00S #0@SPl   0P# P#0@S2030&@K0 @cɭ?0PK}徭) 㧡 0`h[X1X!9T1!P!1L1!H!1D1"@!2<_00p"2@r 1 0S–\  Pz 83| {w93xur 0x d -s9'60:4268:`,:9:65666(6H(6T&60#6p#66:d:X: -L@sPhw8 p-PL9`@09iaÀP P6cP P403P P03HP M0H3@P 0@30P A003(P 0(303p C < C $ C :p:: -LM2p 0PS: S S@` Ѭ.j 2၁C0 , @0K  ,峠,30  Q0`^P 0s (,3/  `(P _(Kl,00 19,0 ,  ム`\3 0\38:'56 -PL3@SaV~zP P zLP  g0106z01 -pLP`Pg1V VV$ 0 0@0@ S3 x=V i2ia n `1S 0 0@0@iy20: p-LM0 0@0@P` \  10 K@(( 1S qL2Kp: p-x3LP:P P P 0|3`0CS|39@O Q 00S 0@}v|30CS|3 2p@l -LMP0`@KpR`d (0@m7PB N7PD @Kx 0@0[[\Č Ƞ,Ƞ Ƞ, ,Ƞ 0KK@ ?MP CY c1K  ?<@P CH R1 L1 F1D3@d/ @@9@0A9C1Z !X:|::8:t6 -PL@`p.01T% 0CT-  006|@4T [10T 0T0/@4T6@ @E1 @ G:1@608#8@6,@@ @i 7i 8i8 0-Lt@P +1P 0@ -3 @SL## 0mP zP 7 -l3 @SLt#h|# 0RPl _Pp ly7 -1L$Mns HFt' 0剡:b6d6:<:i6 X6Y6X6: p-LMQP` ?0@0 0K 0K0@EĠF K@K0KKK0KPK`K`PKp -LM`pွPP KG@0HD (K(0K'K%K#@K&pK$K"PK!PK>P p-L M@`_PP Kp?0F"0KB0"K K!KK0KPK PKPK`KP [0[ -L>Pi@0``pk`p@_@P@Pm@P@PoP0 0@0@ p-L M0P`0K@P Kp?0F!0KA0!K K KK0K@K@K@K`KP[ -LM@P K@0  K0KKKKKKKKP;墠: 0-9P@0@L9` YQ4tP \%P3RP SP002P IP02HP 0H3@P Z0@34P 043,P0N0,30J 4TD N> Hd:$:D: 0-2L@7mjJ%9P@00S 0@q k{&0s 0-LMP 8#8,2S<9 0@\2  .>0 0@Q2 P @@p++!0T 8d #8 )@< .>[0,o;;1" "2c -LPP9@@$p" U)ngd @OT9`   F7P) D7P {$ 8# 4" 0 ,2S 9 @09!%hs@zh%,th%6P h%:: -PL`@pኻP@ m$01T 0T  00vp4P@ %& = S, @S @ 6 3@ %606g@@ 6@ @W 3  `1 ` 3 `$ i 0-@9P@0PL9YQ ̼啽P3RP ü匽P002P 傽P02P 03P ʼ03P 02P0020 4Ğ 從 帞d:$:D: 0-LM@ ->⌿P  壞K0 ?}PP  L唞̠3,/ Pκh::q6 -2QMLP`2@p0 B"_ Ϡ,͠0 ?  lC4B0b2\\  嚺4P ? 0I=K303n6H: -PL@`PaV~lP P blLP  IY0106Rl01 -PL`p4@P#WAI WW# 0 0@0@ lW i>$0 0@0@  p1S 0i+$Sl: -LMP`pP K0 0@0@\弝"0 K @W 1S#i: 0-2P@SLRR VP cP 070 p-LR`P H ; 0 0 @ @p#@PLs7p+61 h7p; 00: -1L M0Kp@`0P$0 zP 9@ V VV K$30$3P2VN ̠@A0 L @s  $0K`ǹ$ R @ 0  $$ $0 S0 0@0@$C 0l$0 0 h7P "@0vi>#e\u9q6: 0-@PL S M7P 3S 呻P 㞻P 070 p- 3LSPp!`P f d6029@ 00S 0@ng0 3"p p-`@LP P 4ph莜b! 0  P/Pphv:x6 -LM0S 0 Ƞ8,Ƞ#8! 坹P t9 -L@ P/)P V h: p-LMQ8#H`@0?0 0K 0KP$4& KPK0KKK@KK`K4Kp -LMpP6 0 4S ,K0 KqP !0(K,P  ̠8Č#Č"̌ 0P d  ,5 <̠ČL8 ČD"̌#D!L  0@P P,<4("!4l̠ <($Č"Č%̌ 0fP P  ,]5 ?s<::`::: :4: -L MpBaP 呛K KZ@P >0PS00S"0@S 2P   0P" P"\g2S 2S8] (X +0P I2f 05P& O +N@`kP 0) |0| 9!t0t 1!0@ 0phĐhl0 3j!,\::$::|:<: ~6Hn6o6: -(L"M"(@0K K0KKKKK K K K -LMP 2S.0$!08#8  Kh..00Q0" "2p488S@`  ఎT` "2p488S@ 0!B!.N0,0•)0 0PK Kh -LM9P@` K@)΅ 0p@.9..  00 00 n@ j7P 7P w2S 9 @0!9Kh @XKh (QKh P :: -PL`@phP@ K@1T 0T  00Tk4P@ y & = S+ @S @ 62@ h 606w@@ 6@ @g2  .0L   2 .>  ("(  i -RLM R R K0K wM p-`LPPp0 0@0@ph蹙: 0-3P@SLSS jP wP 070 p-LR`P H ; 0 0 @ @p3@PL僙7p+F1 x7p; 00: -1L M4Kp@`P(` 劵P$9@! T. TT $3S! TG x1$#$$3 S0$3XXA0  @債$K3e  *$c (0K `ǵ? (`(``F(` V @ (0 S 0 0@0@儸0 0 ]7P  @0~eFu9'|6:: 0-@PLR B7P 2S 噷P 妷P 070 p-LM@Pq 2SK 7P 7P  ?┹P  D嫘Kph,夘Kph坘Kph .>v`P  単Kph2/ `Ŵ_9@0a9Kphτd +> @P T ,^Kph::::|66 : 0-@9P@0PL9YQ ޶P3RP նP002P ˶P02P a02P 02P U03P0030 4   0:$:D: -`LP@pP@ 0T 0T  00 i4P@ 0 @@$608#8@6 @@ o@ i -邡ႂLM0j`@P3p D/00 \  @00 0! Q " $K0j 0 ~@j@c0"!B 3/LL  ó]P "$K303u9'<6 -PL@厳PaV~eP P eLP  wR0106e01 -LM`pPa@P KEUAI UU/ 0 0@0@ U* j$K 0峳 P D P$0S 0 0@0@1S 0K0 0@0@il: p-*3LSPp9`@ 00S 0@+ha0*3"pw 0-LM@P wPP  0 Ƞ8,Ƞ#8@  P 0P 00 SS0 hu9 -LMp`rPQ 08 Ƞ#8,Ƞ 徳P?4@KӳP S P 0$S0S? 0SPz (0S@(0@S坲P$0q P 0 S$0 "冲(0@S2S 02 `R@0Sڬ2sP  @ 00S0"20Sղ@вP0p@PƲ ""0`S0@0S"0S已PQ   0@0S"0S2s 2spW2sy 2sr Yp0` >K,K0C ֽPKA ?g)e@ ƕ1!9!|1|!1!0P h_c@g0*3 Y.0S* 夕(K222SY噕 唕吕厕0 $00B SAB Qa0B7 BSW B? 2"0 P2 PnDj8fhu9<:D666:|::X:`::<::/ -@L 030CS3h43 0 3z0P/0P p-PL@0``Pp6@ =  0@ (0,@ $ H3S0@ 0$@pL0@ 0$@(, p:?(0,@ $ p 0-PL0,P= H# 3  CT =0@T0h:0 -qLM0PT3@0` nXC;QA40+ @T/0T3PT3H   303P坳3@0CS3T ᡼ d嫔0⻭ KT< a<0>ᅵ|30|3ꬕ6h: -@LP0嵰PH3SaV~bP P b01bLP  O0106 -PL0`pᆰ@PlWAM WW# > 0@1A7 AW iB? 0@1 A l p1S xi}3H03墳30CS3 l: p-LMP0 0@0@`\ 0 K@P奰P 1S eIKp: -P3 @SLX#L\# 0夲PP $屲PT P˱7 p-LR`P H ; 0 0 @˿ @pk@PL廓7p+~1 尓7p; 00: -L2L M4pKP`0įP&U& UUpp h0l0h0APCUK AD0  @¯3 03Y30CS3'$K(0K  P (0S 04 C( 0  F? 0@1A R"< 0@1A2h@4 0=hp3D03崲30CS3Pl0R @(00 0ǿ D7P ,@x_ey96: - @L`p#6,7P d3S 0廱Pd ,ȱPh 7d7 0-LM@0PP K034038 D0⸳P ź ϒP30CS3ᳳ4< H0⣳PP  H庒Pa@4T$ c0T 0T0/d@6 @ @608#8@6K@6@@@ @i 7i 8i8 -d0L@x`&003p0CS3Ჰ=@= _  cx0S  aZP;c_ 5 -LM0S 0S  0 Ƞ8,Ƞ#8  庬Py9 -LMp  P@`z23 0@s圃堃)24`3s布弃 0 Ƞ8,Ƞ #8 召=4080@0<0 PR>@S/ 0@S4P* 00S@8<0S80s" <0s @0s C*@K 0`P !s@0I$Kx^d   xp⨄<1` !90p h |0@0@p0 0P x1XRO4M $H::66l66$:: -LM0S 0 Ƞ8,Ƞ#8 [P 4c 0-@9P@0PL9YQ 峩RP 嬩RP ܨ奩RP >02P 02P 202P0020 p-`LPPp0 0@0@phڊ: -LP`P9@VVVpp,320,3wPVh8C婲 0岊,s: 0-LM@ ->⇫P  垊K0 ?xP  及 ? @*PP n Tx̠24/. P岦L::Ի64:6 -2aML`P"00p2@" • 0•C40 •B( 0"C<02 0ͷB 2o\\  p P  0 K 30 36: -PL@6PaV~aXP P 8XLP  E0106*X01 -PL`p @PWAI WW# 0 0@0@ự lʼnW i0 0@0@ p1S 0i)l: -2 @SL"" [P hP 傧7 p-LR`P H ; 0 0 @ @p&@PLv7p+91 k᣷7p; 00: -L2L M8K`@pP,p }P9@ X XX(K3203PaXn ̠A0 L @x ,0Kp̥,pWP084 0LT 8 T ,p084 0Y0 Y  @ |  坵 b7P  @0sU;0 0@0@C̰ 08Ոs $ψJhz96:::: - @L#/-7P 2S tP でP 7噦7 0-L@ʤP0 P7P 7P 2S 9@09010@儈0hP 0hw0h:: -`LP@pᔤP@ w 0T 0T  00Y4P@  @@608#8@6 @@ @ i 0-@LC 9P@00S 0Sw0 -0PL2Rpˤ0`S@00S"0@SᾤP=   0P" P"0@S2S( 2S% 2S"  0@`VY)WP |݇x0x 1t0)1l l01!0p ht}3UUYh4hÇ( h辇<:p66|6$:: -LM0S Q  0 Ƞ8,Ƞ#8 ФPPc/ -@L "30CS3hy3 0 3" -@PL0嫣P0h荠 p-PL@0`ᝣPp6@H0@ 0$@(, p:-?(0,@ $ p 0-PL0}P# 3H  CT "00@T0h,0 -qLM0@P `T3ĴXC ;R' @PT3H /  c303P3@0CS3T  T0 KT<bz<|30|36$: -@LP0PH3SaV~>UP P U01ULP  A0106 -pPL0P_ {,H3S _`0@0 ,#0R 1 SH#PZi xS -PL0`pᷢ@P WAM WW# > 0@1Ah rW i B? 0@1 A 坴 p1S xji 3H03ӥ30CS3:l: p-LMP0 0@0@`\;N 0 K@P֢P 1S 5z Kp: -P3 @SLX#L\# 0դPP PT P7 p-LR`P H ; 0 0 @ @p㝴@PL7p+㰴1 7p; 00: - 2L$M8KpP`0P&U& UU h0l0h0sP4U^ ̠AD0 L @3 03勤30CS3$K  ,0KP? 0, y,0S< 0@1Ash@u 0~h &KAgy% [&0[4  ,0 0C,0 0 0 \7P v @xQ 3D03Ӥ30CS3:z96: - @L`p#687P d3S 0Pd Ph 7d7 0-LM@0NPP K034038 D0P  P30CS34< H0PP  HP̠dDh3(6. P3dͣ::6 -LM@PP`p# 0PU?0@0(0K(0K FH0%K# K$ K'0K!K&`K"K3 030(K⾤3P0CS3 K៥ 0-@LMDĠ DKD\0KKPK@KPK0 -LM@ NĠ0KKK@PK -LM 0K c P K -`PLP@p0圠PUT T Qt0T 0d d]ThT T4 $ 7z9<:BF -LM @0K@K@KNP [0[K p-LMP0QP KpA8#8 K@x=8#8 @H $(2S<8 #8( "h=08#h H D V08P#h @@S P 00 @  01 0 0 T&* -LM@0K @c P[K p-`PLP@ 0PU @p$T T Q0T 0|x 夃@T@pT T<Q H( H7<:z9BF 0-LP0娟@P0L@ T @ 0h.' 0-6@@0P6LQVPVDP #DP+DPHP HP0H0lP y0l3dP +0d3XP m0X3PP 0P30H30 # D:$:x -pLP%o@ @zT* q X7P@ 7P5  K(H0S D0S 6@@06A PVP  /::. -`LP0@p؞P@ 0T 0CT!  0xS@4T$ 0T 0T0/V@6 @ P@608#8@6[@6@@@ @i 7i 8i8 -d0LPx`&0⊚0⇚g3p0CS37=@O \( Vx0S SMPU -LM0S 0 Ƞ8,Ƞ#8 IP z9 -LM`Pp0` r@P $05$K3C3C S2CCS3( K⼞@PO(0 40 0 Ƞ8,Ƞ#8=4呞080@0<0 `RCS8 0@S4僞P3 00S@8<0S80s) <0s& @0s# .@K'`.0`pP 埁 ꍩ 嗁@ l厁`劁UQ H僁 lu xP w 1 !=1!1!1!43 ! 1Ox`8#<3Xc 0T 0p'Õ\  VNRP S C 0l UX V:(6X:6z9:`::$:<:p6`66(6L66P666@->@ 0@Q  /R4 Q QR03R 0-L㨯@P +1P 0+@ -p3 @SLx#l# 0塟Pp 実Pt pȞ7 -X3 @SL`#Th# 0冟PX 哟P\ X孞7 -1L8M8K@`P0՜P>@ T& TT(KRPTTY  @M#ux0,   ǜ a,0K  @,0pPbtP08#8X,0X0CS,0 0e:,0 `@P PPc Kt ,0S Sp PKB? 0@1 A5 ?x废 {9T6P: -@LP30CSP3hP3 0P3\ 0-@PL00HP0.P%3 ?T0ha -LM0S Q  0 Ƞ8,Ƞ#8 $Pz9 -@PL0P08h p-PL`%?(0,@ $ p 0-PL3$(#03 CT T00@Tg%P0 -LM(8P0@"h#xכPT@0?0(0K(0K0&Ġ'0HD (K'0K%K#K!@K&`K$pK"K唟P K -LMȠ0,8!( K 0-("( LM#Ġ(@#\#K!"(0KKPK@KK0 0-!L(MX"%X3  0!\8R# 3  %Ġ(%L%K"(0KK@KPKK0 p-H$H:LX0,`J J%XH$0,phl p-@@PKD`LHX$%(ph! 0-LP0<("!R8#(  M%Ġ(%L%K!"(0KK@KPKhK0 -LMȠ0,8!(0 K -LM(0K!"([ [[ 0[ K 0-hPL,@90,B8,0V(,0Q,00h2( -L@0՚P>$<>,`8#8 2S<8#8 `P>`0, 0,0,i2SP0 pPPN P @00rU<,4$<,!4 $(\'<` -H$HLM(0K!"(S[0[ [@[T @@0 K 0-H$H:J JPL,H$,0l 0-LP0@KP0A!@0 -H$HLM(0K!"( [0[ [[@ A0K 0-`L,0@PP0{U ,, U0 0h}: 0-@L,Ps08#8 ,^ ,0,:0,,0,,M9,:@@03TR p,  TI P,498#80,@@0T; ,l  T2 ,@0,,08#8,,000 ,P80`0H@x@0d,\\0,0hHF}<B}ZOT@:: -@L1.0㽢3 h,X<,6 6<   0 ,08#8,, 0 0,q0, 08#8 z1.T0qX 0H D0N@@0 hH 2LO" z4 -LM0P002@4D0HPL@P@82dP`0h@l@4Z93 `R0@0St 0S4LPf   0@0Sp 0S@03{|, QO 1QZ n|(`K9Lh|. Qp/ Pr1!>1!!11<#!@@3o0pD#3`As `1O3 @" Õ\0  PIM N~ K $|3(`K03,0 |3(`K03 ,0| 0p P\ P6:6X:|L4:96666666x6::(: 0-@L>P@0>^RhOxP xoP)xP|P |fP0|0xP 0x3pP 0p3`P 0`3XP00X30螣 {꘣ {D:$: -bLMaFp\C0P1 ,K,0 ( }o0  @ `SX\3|XoP @ @志XYP $K3 03'<6 -PL3@aV~IP P ILP  u601I01 -`L0@PbPHUp UU# F? 0@1A x{U hn^R P P2S > 0@1Ah[|倚l: p-3LP/|P ƘxP ˜08!0TP3`0CSP3Λ>@O   N0S @&LEpVN p-LM@P7P^ 7Pa .>!,I0,6,@08#8,+, 00,nx,+h0,>T    0,4p x0QP ^ hzKph4t |0A`P N XzKphQzKphJzKphxt3pl/ `傖p>b@0>`NKph?Z::::T6 -PL@`p/1T% 0CT-  07K@4T \0T 0T0/N@4T6@ @F @ 8;@608#8@6@@ @i 7i 8i8/Q/ Q / /0$ 0,B$ !At.p.-08 ?0R<  C4<0 Ax.|. 0-@LL P0CQ 0S0h0 <@.. 0-@L4 ,0RP 4@0h.. 0-PL}( 0S 0@@0. 0-H0 L@h4P 0000S @0hP'. 0-D0L@Q4P 0000S @0hP'. p-t0 LP@8`P H 0000Sphfy@0 P'. ; p-PL@0` S  RphJ00  T@. -`L0pW l @]<0@").qxPU+0@00 U@P_0S 00CS000l0\0 00@0,000$0(Ә'.c\: ; 07 -@LP p`P_00h. 0-0@P00LI000. 0-P@LQ 00 S|0  00S:R   Bk <0 4  0h>  0400h>p.t. p-L^ @`P  ^* ^&0 ^"1 P 0S Vkpl0P T0 ^ 0 R 0Cp 0PP'.... 0-LQh@PT0  0CR0 k00 \P'.. 0-p0LP@HP0T0TT0T08@8 000狖00CS000hp''' p-0PL@%Pp T` TT  \vT ph9ph7<@< 000Z00CS0p'l:'' -LM0` 0 2Pp@P"T" TT; T9 TB 1QA 0%͠ %L @000凕00CS0%K  0K@; R0 QF Q? 9CS 7 7 7 7\ 7\ 7 7 7p0 yvb@ 00000CS0Scv_v @ hp''' 7:d:: 0-L@ 0P0 0P 0x(vh P00CS00P 0D `>, P0P a $ C0?`% V Pp%-t\$K0S2*@KP0RK"K2K2R6 0R0SQ2K?2K*@K02K00C SE777T7x7p7h7T7T7T7H70@"02K0"K*@K2K 20Se 20SY S08#*@KK!PK0`20pLK&yhW?F K4KohuP`V000000 R  BVhhPh1! M 0@] 4P `圐 0@P @ e0 R08#Q 0*@K2K0"K2K@      P'D$':,'(D##'''0 7t.. -2LM ?Rp` 2RS 0RD Bn2"p 0 00@0gT2T"@]0P8B8Ÿ   @'-4 0@? S+ 1 R 1R4 -d0CRD 0RI T1 @1 9$K0S@? *pK2K"Kl1 *pK2K"KT1PH!0S01R 0R0AS7777X7X77x7X7X7X7X7X7X7l70 00 00p p <8# D$ 'p.t.''0 7'(.,' -QLM0`(!(Ds$K1p 0 ?% X00DP\Z, =@  ge ggP 0-  WP 0( Hs 4%=r0|9@:..'''' 7,:: -LM?pd0 \`,0 N \D1Q  A1,A,Q0  0 10Q @50 p0pᴠᶐ,0@000f0 ]@0P}@ =1 ` BR >1Q 0A!pa `AP 0 0 10Q ,AP ΐP+00AP ÐP,00@P 縐P00jrct9`@p0 \q Hq 4q'. '..'''d:d:$:D: -1L`P| 0`@ 0C (0CX!PT1 @ @@}0pS 00S= 0@SpP&   0P0  P0@ 0Sʰ0  /P hqP P lhq` hqPhqD0D  h p' t'..''.:|:::'7 -LM0S 0S  0 Ƞ8,Ƞ#8' 凎P{90@ 00CSl"7t"7|"7"7d"7"7"7"7 P P@/7P,@/nPX@//l/`/0// /$//H/0AhSw|$7$7$7$7$7$7$7|$7p$7$7$7$7$7$7p$7$7$7$7|$7$7d$7$7$7$7$7$7$7$7$7$7$7$7d$7$7$7$7$7$7$7$7$7$7$7$7X$7$7$7$7$7$7$7$7$7$7$7$7$7$7$7$7$7$7$7$7$7$7$7$7X$7$7$7$7$7$7$7$7$7$7$7$7$7$7$7$7$7$7$7$7$7$7$7$7X$7$7$7$7$7$7$7$7$7$7$7$7X$70// /0 R// Q Q0-L@P  X  0@NT  `08#008#0@jPj&7&7&7&7&7&7&7&7&7'7 '7&7&7&7&7&7'7&7&7&7'7&7$'7&7&7&7&7&7&7&7&7&7&7&7,'7&7&7&7&7&7&7&7&7&7&7&74'7&7&7&7&7&7&7&7&7&7&7&7&7&7&7&7&7&7&7&7&7&7&7&7<'7&7&7&7&7&7&7&7&7&7&7&7&7&7&7&7&7&7&7&7&7&7&7&7D'7&7&7&7&7&7&7&7&7&7&7&7L'7//// /// // / // / -(L`P@""4"̠00S0p a0V V 0  04Ƞ8,Ƞ< *;"*#"#? ## 000 0 000000BFvV Ƞ ,4V 0 7000L0Ba21C0aT  Q  R ,{0 0 颋.PH)7P)7X)7`)7h)7p)7@)7@)7@)7@)7@)7@)7@)7@)7@)7@)7x)78/4/0/,/(/$/ //::::::::04;/ R0-LP 0hYo0 @0C 00A@ *0@,4 4ceP0C 80hbC:$"& -LMpSP"[7?`(K $K(KLP L0P'K@N#K0&K%K"PK!KhY嗍 K)7 0-AML$@P0PS 000U00 -LMHP$lCt@$H(K(K'K%PK$@K#`K!pK&PK"0KԎP Ŗ n K : -LMPH.l$|.@0 $H(K(0K'K&K%`K$@K#pK"PK!PK導P  n K : 0-0 @$(LL"(P0 $("(( 0$("(0h 0-0 @$(LL"(P0 $("(( 0$("(0h   0 R   V p-X0'  Q@P PL0@`[o~ z phu -X@L j48#<,"(c, _'R  hWfdh -LMHP$lCt?$H(K(K'K%PK$@K#`K!pK&PK"0KP  n KH: ,0- PL@0N ,4^b[@Q \00HS X00 0R B0HSQ4P0C 80hB p-L M?0P.L.`"K K"0KB0!KK@K0K PKPKPK幍P[Kp觕 mH: -4L@9$   08 #(hD -4L@7$  08 #(hT -LPp`@  @ThhumT @46%CA($H"(0H$(1 0pp:, -?LS@ (0 )0 @ h,0 $) (0-"(LXPm@Mb @T(.m0T S0: -LPp`@ME @T,hmT $("(h:: 0-@LPT  T  ?0C0S 0h p-`LPV@ V@@/0B0RS@ L@  ("(,$  ("(ph p-LP@@dT mP dT8lp,`@0 @}@Tp:|9 -L@0^#`P00V0SPFp3/Pp1p#R,6767P77H5777@67,#(3!3yDp V ""2! "7S7SFV  F"NowiL2!_ 0" "2!#)D !!1!#@ !1!#)D {VX! -u7SP!mL1!h#@  a 1!\#)D V0V  O J F0!A#)D ; i -54 180!, ( -V<}9}9(~9`~9|9}9H}9}9 -LMHP$lCt? $H(K(K'K%PK$@K#`K!pK&PK"0K儋P u k K: p-LM@K 0P[0 0a[0aKA[ $$$ $ Ƞ! ,Ƞ 0e.`@ 0@/o0E-  0,< <0ppl 0-0h 60LSP0CS006 0h Z(k00 @0@0\9 0-PPH#CA- 0 ß  P剆#P [(K!= PW 0!R R8S S0 { <q"D04;20 00\pW 0m0@@ e@@ ]@H$H@H$(@A4 8 41S#@i )7 0@'@ <'< P0@0/.000b 0q @B `PDAM0@00DT!040 M84Qp '.0 4!P! 0 P P{P@ ̗ S 00@@c @@H$@嬅8a 4 < d00/.00ʠ< 0b0`d\4C7: p-LM6`@Pp 1Sp81 R01p00 0P  q$ }P90  060 Rz)@P7Sp7@Pp LP  Q$ Kⲉ@P 0P  E$ QP Q 00 0@0@pp -pRL@ WW hW$ 0 0@0@0P` ᾁ` p 0@D0 @ q pmi0E,: -LJMR`p \\ \8 :ˠ\B0 L @ሇ(K ,0KC, #R0 0@0@0@ TD⠐4PPi +L1 ~hᶖ: @! P  0T 4 8<#8@!:#:0 0xFM< 0S( 1  14p 0 p0C 000 01 1 0 ,1 (0KⲐ@!SdTW  !"'PP@ $K488p04(Op;,0 NH  0Z21C! c%-  P0UkP@( :0 ㄇ@P  fxf@ 0q@PG@P 8fv $f|fP tf @@ ˠ0A- 鮂HP@7S  6 n ~ 6@@06A70S  e `@@fYT|9"VSp: :::L::LP0D7D: -`LP@pQP@ V2h1T% X10SL1TA 06@4T@ $1T 1T  v4P@ N匄6066@ @@ =@ xv4P@7S 6A0AS@@ 06@6A0AS8'@i ϖ1i i i -L@X4P6A0AS4@ p-PL0` -0 0$~00S 0@Yr0P }0?JP Uh@P NfwpC 80  C 88  -LM ČP (KoTe. @P //0PSʦ0@0S/0SP   0@0S/0S?s ?s 4424"0 C   72"` C `8 7 4 1PnpO40 pd17 ggXp X @SX1`/VN>0@818!9!010!1 0@!0 hX02X1"20/2 UF  X0 0 D0C @<0D BD0(K(Kod (Kod|(Kod:\G7 H70,|*7:m8m8B|N7A7h:7)7F7HP7d(8:\:$: -LM0S 0 Ƞ8,Ƞ#8 嗁P ~9/D/ p-H0PS0`04SLpU @T@T 0 R000S 3/PpH@pp000S 3/HPp -@0L<@0D0 -L0` 4#APp0Q W7(X7W7W7W7tX7W7 P2\@P 00@PPPe PP 0 $WP00P 00 0$0S000 0$S0C40+ 0$0S0000S0C40P  0$0S000 @P W 00 0C 0  00  00  @ 0$0S0000S0C40`g p-LM0@`R@ PP0 $RL  Rb R 40Sf 00 K]p2RGH0S0\B@@ @ 0 4 R 0S0C40  0 @T@@ @0@8 0 '@`@<8 N0@@0<TKpHP 0  $("( RL 0CR K$ c0P 8t0R1 R@@ 0 4 R # 0S0##40 0R 0RwHP 0  $("( 0$0l~,@@ nL@c Y7: c c 0-00@L@P0S R000H0 0  0h p-L`PD@T R000H0 0  PL0S /0D  *D@T : -@L(@ 02P hibh<\7: p-00L@@Pr0`S0H00H 0@H@0D)ph 0-LM0 @00P<@0?bT;b0L0K0T@!ʴ2bD 0D0H 0P 'b0L004 0}P  Hb0L0T@DT;$K0h~9:Զ:-:::X]7 0 0  /Q 0S3:Q 0A Q /0   /hgjg 0-LP@T00 0P 0T0C? T00\00S  00 R0#03\0S0 00s/P Q AP//0/0/0// P/0 R/0 R/P/\ P 0 R 0 R/P\//// -(L"HPT  -(L"HPT  -(0 0@00L0P,00 0,0 40 -,0 0(,00 L000 -,0L0@ (00 00-0@ 0 0, 0 0.  , 0-00 00, 0 0.  , 0Q0-0R00\00^00 0-0L0 @PP,00,00,00 p-H@LP `0S 000 0@@0ph -00@L 0PH 0-@LP0$0 @$0P00@0@0 0-@LP0 P(0  00P000h -LMLK P K 0-0 LP00@P (P8 20 -@L00  0e0C 0 hP/e -L0P`p4e @PP pP` 0p0 0 ,p(p0pp000 PP0@ e p-LM`P@jP 0 K0P  0R 0  0$0  $@00Kp0 -LM`x P U, 'e @P e P eh0 ` 0,0'0P0 @ 0000@ - P`ULpe y@P e rP e0 00 0`P P0 0 p PP0@ 0000@ p- LP`eC@Pp e <P ep00 0   00I B00  V@0 00 @p -@RL`P 0S@p@ee pP 0T 1 !Rp@R -`LPU030#QZp @P` RW%4 0P` -LM 0pSP(`VP" $K PPe u @$0T0m$00@T  PPe `V0 0 -PQLp- 0S* 0S' YT`~P@1~@# 0 fP 0 f 00ST  0000 SQ:000 -LMP `0 Ƞ(,@, 0 Z@P`00,p)(#,< 0R)< 0 P0  "< 0Q 0S \  (K -LdM@LKP (0tpKN (0IS@S@ `e P @  0 Č@ P,Ġ.0 @ P @]$KD: P-L 00 ]9.:fg -@LP00P ]00`: p-PL(`@V0$ R0 00S 0R: 0S  3/0  1Vp0S 0S`pph1 00 %V p -LMp@e PPB 0 0@LMt0s 80z0< l0Ruz@vu\0@ 0vl m0qpn@o@r@8X 07`P  eK<0<@0P8  e`S 8 N0``G<kP@ <@8 e` Q0 @K0PQ 0 P {:P4 Y7/ 0-@=tP@0PL=]Q0EtP0 0-LM@P T0哊 LDT0DD  LPtP\K0'{7x: - L\ : -@L= @0!=h p-`0 0@0@LP,\016@D3ph: -PL@p`0T 0T  x0-4P@  @@608#8@6 @@ a@ i 0-L@P +51P ; 00i0ᚊ@ -L MR,`K0pP 0  ^^ "RO R "G͠HAHX0 L @'`P1\K2S02 0K > 0S S=@ @P 00 0X O᷈"@x([< 0@1A0[ ["@9u7::: -qLW@n?*PP2S 0 S*i  P  *LP  0106)01 0-LP@x0h -L MP̠`Ÿ 0 @@@#200 \G.4-P [K480 P \|[8<p @0P ,o[8@ @0pP!@KKO08$ !0K0 K0KK 4QP P[4oP I[LPLTPT0XS P @8@H QP<8@D H@P ![[͠PHX0  @P9P [x@Pv,*Z0 =!|0| 1!x` PW(y,@`:::@cTx7:::4:T::p:u7::xt7w7t7 -LP`pt@PMA t@V > 0@1A1S \`.h B? 0@1 A 0-)@-P1L`QAp,#)&#( '&%$"Yx hd}7 -)LP#p3 - 00 LR s  0 p-,P0U@ `80<@@D LpT0 Pp0PUp 0-,@LTP0T0 0@T0 p-,P0@ UL`80<@@D pT0 0PUp 0-,@LTP0T0 0@T0 -LMQ@ 0?.C""0Y Y:: -PPppL*(0,P`U 80S T V0@T404040@s4TW H0 ST404040@c4tZ: -LM0p00Pc(0|   0, (0QU< , `R0 R 80Q`<0XD< , R H P00P0S  \00 S< H<8  H(  4 @Kx x0, @P 0 6P ,000S, 0040,0,40H`00 0@004@(K YD7}70: -LT00S 0 3@Ń 0S 0 S ?>#R// 0-\0L @ 8X0 $HX0P $8H\0Q;+S   ; S00  ;  S00R0 -L`pBVL@P B/0EP0T |0T d0T \0T ULWD UAU!U\0/0\0p-,LXu, -\0L@ p , -LM\0Xj `0 Y I 9 ) d0      ``0 L 0L\` 0-L 0LB_` 0,L |R0Ll0 ,`0L DR0L`0 ,`0L R0Ll0 ,`0L Q0L`0 ,`0L0a\p 0 @,\0 @0l \0@8` L0L^l 0 ,`0 \L QL0 `l \ 0 ,d0 k \L PL0 ll \ 0 v,d0 Y \0 @0l \0@8` L0L^`0 \,d0 A   -XL80 $p@@P`T+k0Sx0 k@ S x|  0@0 ,@P`@00@@@@P`|0S -X` @0PRL$p @$P@ 0T8 0o@h D0R 80R P00 <0R 0-(0LP0K\0@08\0 X0$HT0X 0hw p-\0@L$!;98 XL}IPFdU 8 X0$H` PL P0 p\0 p8;X$Lp 0-\ LP@/ d0   @08#  P=8#0X$8 LX$8 <LTO\0?00p@\0 Xv)}*0` <C308#(  ;8#(d0 ;8#(0X$8 L\0@ d0X*, <8#(0$8 LX$8 <L0x \000h \?0@}T 8 X0$H @ @00<7;X: 0-LXP$ 6& 0S 08 $HX0@8$ H@l h0R 0l Sh0 T0h@Bp0 -LMX0p0 ,  7 0  @P`@0 0 PA W VXk)00K0@0Y08$ L0X$8 L\0@(K80X$ L$8H  \0  (KoL9`: -LMX0@80<@@Dp8X0 $0 HX0@8$ H,   80P`8P<`X0$8 H   @0P`8P<`@D(K  0I@@D  ,  0@@@D00@0D@8 X0$HX0P8$ H\0@@ ` : 0L@@D,0@ 070@ST  8@0 @@0D@d0  8 X0$HX08$ H `'  % 0L@@D  0L@@D@D 0L@@D    0L@@D@ 0L@@D  0L@@D0@@@D -X 0@80<@@D p8X0L $HX0@8$ H  80P`8P<`X0$8 H   @0P `8P<`@D   0I@ @D    0@@ @D 0@0D@X0$8 H8X0$ H@' 0@@ @D 0L @D 8 X0$H8@X0$ H  0L@ @D 0@@ @D   0L@ @D  0L@ @D @ 0L@ @D  0L@ @D 0-@L8X0 $H8PX0 $H<#38X$ L0 -(0Lp 0HS7 77ܗ7P0S6$0& 8X0 $HV>0$X8 La/DL`0P&P * DL`0P&P 8 X0$H8;X$ LDL`0P&P P0SP0S0p -L bP 9 -pLP`U  |}S00L0P@h0TX`800 \0l X$8 H0 `h9:9 -LMX 0@@D 80<@p8X0 $, H0 8 X0$HX08$ H  80P`8P<`8X0$ H   @0P `8P<`@D (K  0I@ @D   0 0  & 0@@ @D  0L @D ,0@0D@0@@ @D 0L @D 0@@ @D -(0Lp 0HS ꀜ777p7P0S($0& < DL`0P&P * DL`0P&P 8 X0$H8;X$ LDL`0P&P P0SP0S p -L =P 9 -pLP`0  tXR00L0P@` 0T X`800\0X$8 H0 `h9:9 -X0@ 80<@@D p8X0L $HX0@8$ H  80P`8P<`X0$8 H  0@@P`p 8< @pD  )@0P`@PD`    @0P`@PD`0@0D@8 X0$H8@X0$ H@P7x7x7x77x7x7x7x7x7x7x77x7x7x7t7x7x7x7P7,@0P`@PD`,@0P`@PD`,@0P`@PD`,@0P`@PD`,@0P`@PD` -@Ld8X$ 0L -(0Lp 0HS ԡ77p7ġ7P0S($0& /.DL`0P&P * DL`0P&P 8 X0$H8;X$ LDL`0P&P P0SP0Sp -L P 09 -pLP`  tQ00L0P@` 0T X`800\0X$8 H0 `hY09:$9 -X 0@80<@@D p8X0L $HX0@8$ H  80P`8P<`X0$8 H   @0P `8P<`@D   0I@ @D    0@@ @D 0@0D@8X0$ H "  0@@ @D  0L @D 0@@ @D 0L @D 0@@ @D -(0Lp 0HS x777h7P0S($0& DL`0P&P * DL`0P&P 8 X0$H8;X$ LDL`0P&P P0SP0Sp -L P T9 -pLP`  tO00L0P@` 0T X`800\0X$8 H0 `h0T9:H9 -X 0@80<@@D p8X0L $HX0@8$ H  80P`8P<`X0$8 H   @0P `8P<`@D   0I@ @D    0@@ @D 0@0D@8X0$ H0@@ @D  0L @D   0@@ @D 0L @D 0@@ @D -(0Lp 0HS 7H777P0S($0& eDL`0P&P * DL`0P&P 8 X0$H8;X$ LDL`0P&P P0SP0Sfp -L P 蜀9 -pLP`  tN00L0P@` 0T X`800\0X$8 H0 `h ꜀9:9 -X0\`@80<@@PD`p8X0L $HX08$ H   80P`8P<`  0I@P` P`@PD` 0@P`@PD` @P` \0, 0@P`@PD` 70LP`@PD`P`UV8 X0$H8@X0$ H  @0P`@PD`   0@P`@PD`0@P` @PD` L0P`P`@PD`P`U0@P`@PD` -(0Lp0BS7H777P0S8$0& 0S 8X0 $HX98$ L W%DL`0P&P * DL`0P&P 8 X0$H8;X$ LDL`0P&P P0SP0S&p 0- @L8X0$HX98$ LP}U X0$8 H P8 X0$H@ R\ &RZ \0`0B%S&t7x7x7x7x7x7x7t7x7x7t7x7x7x7x7x7x7x7x7x7x7x7x7x7x7x7x7x7x7x7x7x7x7x7x7x77t7 &R& 0X$8 L8 X0$HXp08$ L@0&S 8X0 $H:89X$ L0 < X0$8 HPX$8 0LT -L P ̀9 -`LpP  L00L0P@1T08 0XP?>C2@0 0 \ $ L@0 SA S T0X$8 H0 ` X0$8 Hdh\0  8X0 $HX@8$0 L8X0 $H=8$X= L0X$8 L\0 X0$8 H0 S@09X$8 L@0̀9:9 -@L=8X$ 1<L -(0pL0DL`0P&\ P0S lMX X X $0& p : -P`LpL00L0P@0T80XP00\04 000 ThL X0$8H  `hgH:9l: - 0LP@VAP 0 3@5,  S R ? :Z -L M$ X 0@0, 80<@@Dp8X0 $4 HX0@8$ H0   80P`8P<`X0$8 H   @0P`8P<`@D(K  0I@@D  0  0@@@D40@0D@8 X0$HX0@8$ H    2 0L@@D0L@@DD,@P ,0@P!8X0$X H! 0@@@D0L@D 0L@@D8X0$ H 0@@@D@ 0L@@Dr  0L@@Dg:>: -(0L$`PL0@%S P0S KZ Z Z  [$0& 0@ 8X0$H $0&S X0$@L`8P0 6/0X$8 LT: 0- 0@ LdPcP 00 3@5 ? 0?P  ?P00ԁ9>:: -LP`p?P!  eJ00L0P@p 0T Xp8000\0X$8 H0 `hFJԁ9:ȁ9: -X 0@@D 80<@pX0L $8H   80P`8P<`X0$8 H   @0P `8P<`@D   0I@ @D  0@0D@8 X0$H8@X0$ H 0@@ @D  0@@ @D   0L @D 0@@ @D 0L @D p-@L8P$`X0 L@H0 4/p -(0Lp 0HS $7X777P0S($0& [ZDL`0P&P * DL`0P&P 8 X0$H8;X$ LDL`0P&P P0SP0Sp -L P 9 -0L `3 LPPp) 0P?> S0T0  !I00L0P@ Xp8 T0\X$8 H0 `hx?( T 0 3L99:9 -(0Lp 0HS 7,777P0S($0& ^,DL`0P&P * DL`0P&P 8 X0$H8;X$ LDL`0P&P P0SP0S-p -L _P L9 -pLP`R  tzH00L0P@` 0T X`800\0X$8 H0 `hL9:@9 -X 0@@D 80<@pL8X0 $HX$8 H  80P`8P<`8X0$ H   @0P `8P<`@D   0I@ @D     % 0@@ @D   0L @D 0@0D@0@@ @D 0L @D 0@@ @D -@L$8X 0L8X$ 1<L -(0Lp 0HS 77877P0S($0& }|5DL`0P&P * DL`0P&P 8 X0$H8;X$ LDL`0P&P P0SP0Sp -L 6P p9 -pLP`)  tQG00L0P@` 0T X`800\0X$8 H0 `hp9:d9 -X 0@80<@@D p8X0L $HX0@8$ H  80P`8P<`X0$8 H   @0P `8P<`@D   0I@ @D    0@@ @D 0@0D@8X0$ H0@@ @D @ 0L @D 0@@ @D 0L @D -(0Lp 0HS 7@777P0S($0& a`DL`0P&P * DL`0P&P 8 X0$H8;X$ LDL`0P&P P0SP0Sp -L P 謂9 -pLP`  t5F00L0P@` 0T X`800\0X$8 H0 `hꬂ9:9 -X 0@80<@@D p8X0L $HX0@8$ H  80P`8P<`X0$8 H   @0P `8P<`@D   0I@ @D    0@@ @D 0@0D@8X0$ H 0@@ @D   0L @D 0@@ @D 0L @D -(0Lp 0HS |777l7P0S($0& EDDL`0P&P * DL`0P&P 8 X0$H8;X$ LDL`0P&P P0SP0Sp -L P 9 -pLP`  xE00L0P@d 0T X`8000\0X$8 H0 `hn9:܂9/ -(0Lp 0HS 7,777P0S($0& ^,DL`0P&P * DL`0P&P 8 X0$H8;X$ LDL`0P&P P0SP0S-p - 0pPL`D 0?.C""D00L0P@ T8 0 3B5<0 X`?.B"@ 00\0X$8 H0 ` `0 d0  h4hPDX0$8 Hd:H:9d: -@L@0S8X0 $H08X$8#8 L8X0 $H 08X$8#8 L8X0 $H08X$8#8 L8X0 $H$0 08X$ L -LMX0@|80<@@pD8X0 $0 HX0@8$ H,   80P`8P<`X0$8 H   @0Pp`8P<`@pD(K  0I@p@pD  ,  0@@p@pD00@0D@X0$8 H0@@pp@pD0Lp@pD0@@pp@pD gL0P`p@pD -(0Lp 0HS 7<777P0S($0& "!DL`0P&P * DL`0P&P 8 X0$H8;X$ LDL`0P&P P0SP0Sp -L P 9 -pLP`  B ?.B"@ 00L0P@ T8 X`0 \0l X$8 H0 `hF9: 9 -X0@ 80<@@D p8X0L $HX0@8$ H  80P`8P<`X0$8 H  0@@P`p 8< @pD  )@0P`@PD`    @0P`@PD`0@0D@X0$8 H8X0$ H ) 0 > ,@0P`@PD`8 X0$H8@X0$ H    ,@0P`@PD`,@0P`@PD`,@0P`@PD`@ ,@0P`@PD` -0BLp S77t7h7DL`0P&P 4P0S1$0& ~MDL`0P&P P0SDL`0P&P P0Sjp8X0$ H8;X$ L -L P 萃9 -pLP`  xA00L0P@d 0T X`8000\0X$8 H0 `hꐃ9:9 -LMX 0@80<@@D p8X0 $, H8@ X0$HX08$ H  80P`8P<`8X0$ H   @0P `8P<`@D   0I@ @D     & 0@@ @D   0L @D , 0@0D@0@@ @D 0L @D 0@@ @D -0BLp S7d777DL`0P&P 4P0S1$0& d3DL`0P&P P0SDL`0P&P P0SPp8X0$ H8;X$ L -L sP 9 -LM Pe  @00L0P@0T80X0 \0l  X$8H0\  ``0  mL hP0L`p 0pL 8PLl0 p`0  9:؃9 -LMX0@80<@@Dp8X0 $0 H8 8 X0$H4 X0$8 H,   80P`8P<`X0$8 H *  0I@@D , 48 0 - ,0 SK S0 S0@@@D,E0L@D  @0P`8P<`@D(K0 0@0D@0@@@D @0@D X0$8H  8@@@D0@@@DL0P`@D@ -(0Lp 0HS \777L7P0S($0& MLDL`0P&P * DL`0P&P 8 X0$H8;X$ LDL`0P&P P0SP0Sp -L P  9 -`LpP  !?00L0P@0TXP800 \0l X$8 H0 `X0 $8H 0 `;``@0:` d0 h]X0$8 Hd 9:9 -LMX0 Sp, > 0@80<@@D !8X0$HX0@8$!H  80P`8P<`0S  8P`0@0X!X1X0P!>X0$8 H  , 0@0D@ ! >8 X0$H8@X0$ H   0@@ @D  0L @D 0@@ @D 0L @D 0@@ @D ,c7T:9\:\9D: -2LM, Qp@'(0 , 0BS7h7<77D`L0P&P 'P0S$$0& ,TP!>(0h$P L0@ %S  D`L0P&P P0SP0S$0& 0 @P8 X0$HX0@8$d H@hPh0l 0Sh0T0h@p,cD:l97 -Lp`P=0 R&00L0P@0T80X`0 0l \04 000 lh= X0$8H  `h =p:,cP9l:|9D: -0 3B5L  (02P ? : -@0LSpD0S8X$ 0L$8X :LX$84 L$@8PX0 L`H; 6/8X0 $H:8$X#: L$8X 0L$8X 0L$8X 3LX$8: L$@8PX0 L`H; 6/$@8PX0 L`H; 6/8X0 $H:#:$8X: L$8X 2L$8X 2L$8X =LX$8w0 L8X0 $H:#:$8X : L$8X X2L$8X @2L$8X (2LX$8< L8X0 $H:#:$8X : L$8X 1L$8X 1L$8X =LX$80 L8X0 $H:#:$8X: L$8X 1L$8X 0L$8X 0LX$8< L$@8PX0 L`H; 6/$P8@X0 L`H; 6/$8X 0L(h\e A` -L@Mh 0-@0LSP D0S@8 X0$H@ 0400T0$X8 ;L': -@LT0` \0,B# 0<8X $L 8X <$L8$ : -LM$0 0p 00S S6 S  @0R> d0U(K$P L0@%S < DL`0P&\ R 8 X0H8;X$ LDL`0P&P P0S D0R 80RF 0 R00 P0S$0& 0@@ /PX0$8l Hh0l 0Sh00h0pP0S$0& T08 X0$H@P 0ᾎPv< 0ST7$7$7X7$7$77$7$7$7$7$7$7$7$7$7h7:,0 0LA0S@ T> 0@S S+ 08$X L, $<8X L0X$8 L#T  `, @ , X0$8 H ~ h@T P`0@0 0@S , 堀,, T  >: -L P 蘄9 -pLP`  900L0P@0T08 0$?>C2@0 X` D 0 0l \0 BH0 ` `0 d0  T0X0$8 Hdꘄ9:9 -L P 00 0Q400P 0- PL004D@0 p-LPML0`SP Q S 0R h@KP,-0+8L0 0( 5KPLPKpLPh@KP-05KLP (P LP -L@ 004400 p-LPMhPK@`P,@005KX0(0 0+8L0 0( 5K P@0H0#80Kp0 p-LPMhPK`@P,L0L 0SD0# (0 0L 5KnPH0[#SKp#0 0-LPMd@KPP, 0$0 04KSK0 p-LPMhPK@`P,L 0L0 70R5K08L0 ;(0 9PH0  0Kp 0-`0 SL@\ dP0 0 `0S<Q 800: -h0L@\-L P00Q00S 0$ $ hh;@BOc:`8 0-T@LTP+  @T @0 [P@0  P \38 @TTP P 00!8@00:: -@0L@T0S0 8T0SJ@0: -@L _  @ !! 0-@00L4004PP x70 004PP @78QLPP@0 6 PP:0: 0-@0L P  0@0TP @T0T P0X T0H00@0@0 0-P@L@0 0@0P 70h,]P pt7P @0 0@00h,b7,@0@0H:`:p9 0-L00P4 P @0 00@00h@0 0@@0s~@000@0@00 0- PLU@06 0R0 0000h0 0 0hg p-PL@!00h  h0`@0hd0 PfphOt0S/l -L`\0PSdp :Pd@T0  \0S %@0\0s@0 0@0\ @n\0s @`@at: -@L ` 0mP h6` 8: Q0-L@ Q 0hED@0P0\00<Pd0 0-L M0P@@YEx}60 E HKXt6000 4 80@0 D 00 <0   0 P4T0d X0h 0 l0 Tdtxp@@@00@0K0ht760  d260  T-60 D(6<%64K0h6:-: 88l 8::::|:: -0Lz+p3 80R/00  ( ,100 !0 $1(!/(!:::: p- 0LP55`1>@0S@ V50`S@5!1|5t 5 Q \5Hph5L510 ` 5V$5::0:-::::x:: -0@PPDL  p  ` -LM4 0Pp\2*@R`4  <~5(KYS4 Ps5`P@g PP PPh T1 !T TPYWP,P ,@P0 U 0 0f P0 @  P!0P XP, 0B P`Y4 P'5`P`P@PD@P@yPD`@40LP4`40 (04 ro:l:::4:/ p-`L @PT 1  @PT400$ph!00 R/0S/ -LPMQp0@0Π; ; pK$PP `(;00 50P@0H0@00 400 0 4P P 4I10 DP0  >10$:P:0@-P@< <(4"4 ,!<$ 0!$@,, T< N0 -LPMP@`P $KtpKP$<180 @` < 嵁0P4X0 0KX 40 D P@0@ 5[S P$0+84  X0 %K|PT0  P$<40  05KlP  -LMpPo1[S -`p-`kda004(`P \-^ 004 `PLe:h:': : N:::,: -LPM`p PP` l@KP "0` P0 @30, 8P 4@ 0@ 5K`P  AK {!P p-LM@0@0@0PK@ 0S#@ P004P `P p0PqPQ Pp0@0pp -LM0`K@ "<( 4"4,!< $ $"#4p0 ,0 4@\ 0 00aP0cS0c^t@P@0\ 0 00aP0cS0c^T@0Pt1(@\ 0 00aP0cS0c^T@0x1 K -LLM00@p4 PP,`KPP , 004x PP `,$K iPPD0 x1;t1SD1  lK 0PPΠ`$\ 0 00aP0cS0c^`h&h  0PP 0 Lx,@t,O`P  k,PaT:P:::t: 0-L@PP @0 0ho0h -@0L` Pp@\ 0 00aP0cS0c^T@0PH1`@\ 0 00aP0cS0c^T@8#8pL1X@\ 0 00aP0cS0c^t@PPqP@\ 0 00aP0cS0c^T@pQQH@\ 0 00aP0cS0c^t@PRq@@\ 0 00aP0cS0c^T@pSQ8@\ 0 00aP0cS0c^t@0PTqU10@\ 0 00aP0cS0c^T@0pX1 @\ 0 00aP0cS0c^t@ P\q @\ 0 00aP0cS0c^T@:#:`14!RL:8L:8>8>8>8=+P`@\ 0 00aP0cS0c^T@4pH1X@\ 0 00aP0cS0c^t@PPqP@\ 0 00aP0cS0c^T@pQQH@\ 0 00aP0cS0c^t@PRq@@\ 0 00aP0cS0c^T@pSQ8@\ 0 00aP0cS0c^t@PTq0@\ 0 00aP0cS0c^T@pUQ(@\ 0 00aP0cS0c^t@0PVqW1 @\ 0 00aP0cS0c^T@0PX1@\ 0 00aP0cS0c^T@4\1 P @\ 0 00aP0cS0c^T@0`1Pp@\ 0 00aP0cS0c^T@0PH1`@\ 0 00aP0cS0c^T@8#8PL1X@\ 0 00aP0cS0c^T@pPQP@\ 0 00aP0cS0c^t@PQqH@\ 0 00aP0cS0c^T@pRQ@@\ 0 00aP0cS0c^t@PSq8@\ 0 00aP0cS0c^T@@TQ0P\ 0 00aP0cS0c^T@0pUQV1 @\ 0 00aP0cS0c^t@\q: -@0L0P`v@ Pv@\ 0 00aP0cS0c^T@ RP0!6 @\ 0 00aP0cS0c^T@zP'z'@\ 0 00aP0cS0c^T@0 0#P8!H@\ 0 00aP0cS0c^T@@PL @\ 0 00aP0cS0c^T@:#:D1~\ 0 00aP0cS0c^T@ 0BS0!Pr@\ 0 00aP0cS0c^T@0P416 @\ 0 00aP0cS0c^T@zP'z'@\ 0 00aP0cS0c^T@0 0#P8!H@\ 0 00aP0cS0c^T@@@AP004DT@0Q<x8!81R (400@(0P00(@\ 0 00aP0cS0c^T@4505 81@:4: -LPM`ppKP100 05Ks<P& P$@0KT RH @ 08R#HP@ PKYP6P0pSPP X0 dWPX T@T#000 @T P 05K0,8T0 0 3P PKGPY AP @T K@'0`:-40 ^ 1 <18 R80 0-P@LT0$0 0(00h 0-@Lk0p 0RP0 h"0h蜭 -PL @40p`Q0  04  QP0(0i~04  w -p`TL Px0@h0l`p@t@$@  0`00Y0 m hmI8J8 -L\MP04 S@p0 0(0ፀ(K0`6K GK-K A  0@H1S= ESI pS= S  eS> S7  \  W X1@K k&: 00K 0yK~K}0KK  qK  aK :R: #~P .@ )0 $  ::::::x: -`Lp0S R0000 0 @P⯬@@@厭@00 `hq p-`PL}@T R0000 0   Zp -@LP ٿ00 p- P@L0Pp`0 0 ``/d d0[U 0@     \0pN8tM8 p-@LT`pPP P0P P  み {00p -LM` 㫿P @㦿 TQ Rʨ0  QpP % M IK0P 0:$@K 3sH`DPn0< $ P@ v%@?:Q8HI82: p-LMP4@0 \ 1 `R 0S 0(0~Kp(005SQ8Q8Q8Q8Q8Q8Q8Q8lS8Q8lS8Q8Q8Q8Q8Q8Q8Q8`S8Q8Q8Q8Q8Q8Q8Q8Q8Q8Q8Q8Q8Q8Q8Q8Q8Q8Q8R8Q8Q8lS8Q8lS8Q8Q8Q8Q8Q8Q8Q8Q8Q8Q8Q8 @K 81R #0C###ĠKK K0K<1#̠##DKK@K0K~0S 0 8< 0$08Q0Q:tP 0 48 0R,OpenBSD6.0RAMDISK#168 @(#)OpenBSD 6.0 (RAMDISK) #168: Sun Jul 31 16:51:35 MDT 2016 OpenBSD 6.0 (RAMDISK) #168: Sun Jul 31 16:51:35 MDT 2016 deraadt@zaurus.openbsd.org:/usr/src/sys/arch/zaurus/compile/RAMDISK 999<9T9l9999Č9 9 9 9 9 99,9,9,9<9<9<9<9X9X9X9X9x9x9x9x9,9,9 ,9!9"9#9$9%9&9'9L x @L x @ ة expand 32-byte kexpand 16-byte k n;AvXaM ְdx ̀"s"y"y" s"$y"(s"x"s"0s"]"%Ts"Copyright (c) 1982, 1986, 1989, 1991, 1993 The Regents of the University of California. All rights reserved. Copyright (c) 1995-2016 OpenBSD. All rights reserved. http://www.OpenBSD.org 8""d"""""""\"""X#8#Oc $$@@@`@@ @@@@@```@@@@ @99999 99 X99@99 99@(:ȯ9 Я9ج9ԯ9999999 999 9(9@09@499499 99 9@99 9 9(:9ج9 9@9<9999X99 ȯ9@(999Я999 9@099(c(cLǠ6 %?a*s(ҺK>;HFS0eC=Gry=iG}<;~G݊<<РD3h&ǂLǠ6 %?aextent_freepool_p_freepr_find_pageheadpool_do_getpool_init@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~!#$%&'()-0123456789@ABCDEFGHIJKLMNOPQRSTUVWXYZ^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{}~Ͼ󨷵ǎԐѥ噞᷵ǎԐѥ???????????????????????????????? !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~?Ѫ?????????????????????????????յݯ????U܃'\x'<{'y'%z'Ly'%x'dx'J'%x' '̼'''h'' ( ((`(((hl8n; &C vkkMPG&"֊/aK+d 5ӆ1 q^h,`@yFgKrޔԘJk*OņךUfϊDx%K]?!HpcwucB0 mL5&/ᾢ5̈9.WUGz+2ўfD~T; ʌ)k<(yv;VdNtے lH]nCĨ917Ӌ2CYnڌdҜI%ϯʎGooJr\$8WsQ#|!>ݖa B|qؐ_jiX':'8+3"p3-"< IxPzY e1ƄÂ)wZ{m:,PPPPPPPP49@9L9X9h9t9999999999999999 9999 9ieee80211_newstate8:$9:3(90 `9G(,99$09!4908890d<940@9`D9RDH9ULL9pP9TT9|X9 95,9X\9R`9d9h97l96J:7$97p9 t99\972x997|9697؎996 90,9@9X9!T996\95h 9t:7x9d9p9l9R`97|979A9H9C9J9K999@9I99E9E99995997ؠ:79p:9:0'99!99.997B97* 9"\:O9\9`9J9h97v9l97X 9z$99(9,9p:709B4979689 0:9E<96@96 D90H9G$L9:P97H9ZT9E\X9:^:V\9w`9d97h9@@@ @@ !" 1:7 25@608 943 @ A BC D@EFGHIJ K RSTU V X`abcdefgh ijl9Tt9U|9S9R99F9I9V9E99G99B99X99D99 979@95$9,92496<9D98L90T9\99d9l94t9|99 939h9@9999"9 9!99:99199H9@9J9K 9A(909C89 @9H9@H999fP9gX9``9ah9bp9cx9d9e9i9j999arpresolvearp_rtrequestigmp_init}E#(DoKgpqrstuvwxyz`****PQSeA~ä^':k;EXKU0 mvv̈%LO*ŀD5&bIZg%E]u/LFk_zmYR-!tX)iIDɎjuxyk>Xq'Of ɴ:}Jc1`3QESbwdk+XhHpElޔ{R#sKrW*Uf(µ/{ņ7(0#j\+ϊyiNeվb4ъĝS.4U2u9 `@q^Qn!>=ݖ>FMT]qoP`$C@wgB谈8[yG |B| H+2pNrZlV8ծ='9-6d !\hT[:.6$g WҖO aiKwZ *C"< Nj򹨶-ȩWLuݙ`&r\;fD4~[v)C#hc1cB@" Ƅ}$J=2m)K/0R wl+pH"dGČ?,}V3"NI8ʌ6 Ԙρ(z&ڤ?:, xP_jbF~Tؐ^9.Â]|i-o%;ȧ}nc{; x&Yn쨚Oen~ϼ!ٛ6oJ |)11#?*0f57NtʂАا3JAP/MvMCTMўjL,QeF^]5st.A ZgRے3VGmaךz 7Y<'5ah,4$8_@r %⼋I<(A q9޳ ؐVda{p2t\lHBWЧQPeA~S^':k;EXK0 Umvv̈L%O*D5&bZI%gE]u/LFk_眒zmYRڃ-!tXiI)ɎDujyx>Xkq'Oᾶ f:}Jc13Q`SbEwdk+hHpXElޔ{Rs#KrWUf*(µ/{ņ7ӥ(0#j\ϊ+yiNe;b4ĊS.4U2u 9`@q^nQ!>ݖ=>ݮMFT]qoP`$֗C@̞gwB谽[8y |GB| +2HprZlN8Vծ=9-6' d\h!T[.6$:g WґO aKwZi *"4$8,@_r% I<( A9q ؜Vd{a2p\lHtWBQPA~Seä':^;kEXK0 Uvm̈v%LO*5&DbIZ%gE]/uLFk_mzRY-tX!I)iɎDujxyXk>'qᾶO f}:cJ1Q`3SbEdwk+HpXhEޔl{Rs#KrWUf*(/ņ{7ӥ(0#j\ϊ+yiNeվ4bĊ.4SU2u 9`@q^nQ!>ݖ=>ݮMFTq]oP`$֗@Cgw谽B8[y|G B| +2HpZlNrV8=-6'9 d\h![T6$:. gWҖOa wZiK *"$8,4_@r %<(I A9q ޳؜Vd{a2plHt\BWQP~SeAä:^';kEXK U0mvv%LO*&D5bIZ%gE]u/LFk_zmYR-X!tI)iDujxyk>X'qOf }:cJ1`3QbESwdk+pXhHElR{#srKWf*U(/µ{ӥ70(#j\+ϧyNieվb4Ċ4S.U2ኤu 9@`^qQn>!=ݮ>MF摵Tq]o`P$֗齉C@gwٰB8[yȡG ||B 2H+plNrZV8=ծ6'9- dh!\T[$:.6 g WҖOa ZiKw *h8,4$_@r %(IKy xZݨ31Y'_`QJ -zɜ;M*q//^SShѹ,` @ȱy[[jjFˍپgK99rJJLLXXJυkл*媪OCCMMU33fEEPPD<KKܽa ppB>>|ĵqffHHaa_55jWWйiX':'8볘+3"iip٩3-"< I·UUx((PzߥY  ڿe1BBhhAA)w--Z˰{TTֻm:,ccƥ||ww{{ kkֽooޱőT00`PggΩ++V}׵bMvvʏEɉ@}}YYGG AԳg_Eꜜ#Srr[u=&&Lj66lZ??~ÃO44h\Q4qqثs11bS*? ǕR##FeÝ^0(7 / $6=&''Niuu ,,Xt4.6-nnܲZZ[RR;;vMַa}))R{>//^qSSѹh, @`y[[jjԾˍFg99rKJJLLXXυJлk*OCCMM33fUEEPP<!KKݽa܋ pp>>|Bqff̪HHaa£55j_WWiІX:''8+"3iiһ٩p3-<" ·IUU((PxߥzY e1BBhhиAAÙ)--Zw{TTm,:cƥc||ww{{ kֽkoޱoőT0`P0gΩg+V}+׵b׫MvvʏEʂɉ@}}YYGG AԳgԢ_Eꯜ#Srr[u·=&Lj&6lZ6?~A?̃O4h\4Q4qqثs1bS1*? ǕR#Fe#Ý^0(7 / $6=&'Ni'Ͳuu  ,Xt,4.6-nܲnZZ[RR;vM;ַaֳ}γ)R{)>/^q/SSѹh, @` yȱ[[jԾjˍF˾gپ9rK9JJLLXXυJлk*OCCMM3fU3EEPP!KKaܽ pp>|B>qĵf̪fHHa£a5j_5WWiйX:''8+"3iһi٩pَ3-<" ·IUU(Px(ߥzߌY  eڿ1BBhиhAA)-Zw-{˰TTmֻ,:ƥcc||ww{{ ֽkkޱooT`P00ΩggV}++bM櫫vvE@}}YYGG A쭭g_E꯯#Srr[u·=Lj&&lZ66~A??Oh\44Q4qqsbS11*? RFe##^0(7 / $6=&Ni''Ͳuu Xt,,4.6-ܲnnZZ[RRvM;;a}γR{))>^q//SSh,@` yȱ[[ԾjjFgپrK99JJLLXXJϻk*O媪CCMMfU33EEPPxD<<%K㨨QQ]@@?!pH88c߼wuBc!! 0mҁL &5/__5DD.9WU~~zG==Ȭdd]]2+ss``OODf""T~**; FF)kӸ(<y޼^^ v;dV22tN:: II Hl$$\\]½nCשּׁĦbb917yy2CnY77ڷmmd՜NNI੩شllVV%ʯeezzG鮮oպxxJo%%\r..8$WsǴQ#|tt>!KKaܽ pp|B>>qĵ̪ffHH£aaj_55WWiйX:''8+"3һiip3-<" IΪUUPx((zY  eڿ1BBиhhAA)Zw--{˰TTmֻ,: @6؞]|6*)bp0ZY9Y/1 g&3gXhJd . ۤOHG"(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDlɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~[/BD7q۵[V9Y?^[1$} Ut]rހܛtiGƝ̡ $o,-tJܩ\ڈvRQ>m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxqg jgrn<:ORQhك[ 1Ѭߘr/Ḗ~&jE|,G$l iciNWqX~=t XrX͋qJT{YZ90`*#`(yA8۸y:`l>w'K1/x`\`U%U攫UbHW@cj9U*4\̴ATr|*oc]ũ+1t>\3֯\$lS2zw(H;Kkē!(f a!`|H2]]]u#&܈e>#Ŭom9BD . Ji^Bh!la gӫҠQjh/T(3Ql n;zP;*~ev9>YfCoEå}^;uos D@jVbNw?6r=B$7H ۛIrS{y%P;LylO`@ž\^c$johSl>9oR;Qm,0DE ^J3(fK.WtE9_ ӹyU 2`yr,@%g̣饎"2u<kaP/R=2`#H{1S>W\o.ViB~(2gsUO'[iXʻ]=!lJ[-ySeEIҐK3~ˤAb Lw6~д+MەqՓkю%ǯ/[{AI~-%^q h"W6d$ cUYCxSZ٢[} Źv&ϕbhAJsN-GJ{RQ)S?Wƛv`+t恵oWk *!ec.4dV]-SGjnpzKD). u#&İn}ߧI`fqilRdVឱ¥6)L u@Y>:䚘T?eB[k?ҡ08-M]% L&pc^?kh >\D}W7: P tAu8/;21>8TNmO Bo ,y|$ryVw.?rU$qk.P̈́GXzt}K:zfC cdG27;C$CMQe*P:qUN1w_V5kǣ;< $Y,n<pEㆱo ^*>Zw=Ne)։>%fRxL.jxS<- N=+6&9`y#RnfE{7(2åZl!Xeh;/ۭ}*/n[(!pa)uGa0a4c\s9pL ު˼,b`\ndi#PZe2Zh@*<1! T_~}=b7w-_h)5ǡޖXxWcr"ÃF T0.SHُ(1mX4a(s<|J]d]B> EꫪOlOBBǵj;Oe!AyMjGKPb=bF&[$ti GV[ Htb#*BXU >ap?#r3A~_;"lY7|`t˧@n2w΄PU5ai Z .zD4Egɞs͈Uy_g@Cge48>q(= m!>J=+hZ=@&L4)i Av.khq$j 3ԷCaP.9FE$tO!@MpE/f m1'A9UG%ښ ʫ%xP()Sچ, mbhiHפh'?Oz|Ϊ_7әxB*k@5 ٫9N;VmK1f&tn:2C[Ah xN جV@E'H::SU kKмgUXc)3VJ*%1?~^|1)p/'\,(H"m?H܆AyG@n]Q_2Տd5A4x{%`*`lc´2Of#k>3b $;" r(-Exb}doITH}'>AcG t.no:7`L knU{7,gm;e' )̒9 i{f} ϑ^و/$[Qy{;v.97yY̗&-1.Bh;+jLu.x7BjQ满PcKkؽ%=YBD n *Ngd_ڈ鿾dW{x`M``FѰ8Ew63kBqA_^;Z4ٷ,Q+:Ֆ}}>(-}|%rZLZq)GW;()f(.y_xU`uD^mm%adâW<'*:m?!cf&(3uU4V<wQ( gQ̫_QM08bX7 z{>d!Q2Ow~㶨F=)iSHd$m-if! FEdlX [@X̻k~jEY:D 5>ʹrdfGof,ҏ"W##v215VbuZ6ns҈bIPLVq z2E{Sb%ҽ5iq"|˶+v>S@`8G% 8vFšw``u N˅؍芰z~L\HjiԐ\-% ?2aN[wߏWr:j?$.Dsp"8 1).lN!(Ew8fTl 4)P|ɵՄ? Gy ~tn,fy3jXDD1Zs"*ˁc8:$zi HIĀ@8HުL H_%A@N$A UeQr% 9jyMc@hV 틕Z Vqק)N-fcqw*7 5Wa"ɠBր[t!h!hl iwW~@PճMװx QV$AV ʔUWnྵa$ XK'aU{whkldMDfd~i/IO70j5,s@IvM;B(HDLns) _ɋ}oaOw.+rץ<}+FYYEEهTNoHm| ǥcs_DVj͈prͳ]ny` E`1©\1BN"r\,rN@%/N2g@#x\n܃"ukMxnXO DH?{vw#Vu*F_( +8=6 JRft;QZylu eX&hJpFS(l\v0k)h76*g$ k%ֿh,DUueI40" WIbuU~bڨv^FESGml,gHL|3ەCh\SU2` ߝWc9^28aI37~^b<#NygCHKJf-ۄoH Ja)Yfc(` 0qt&@3/C~A^ l( ؒ0~of˜os*`ژ46K-%#= %IH6Jo8C@TzWOpA:Z„TU|5YŗZ:G:%Sj~=eI&TwQ[P]vlDȨ!帊iX`[ŗY)L;]J5ULkD$5鰽bעT/I18T(q)9H[/u@g+3-fVo*ɛ`( ')dMP˲,\26K_A !PNhذy\CPIMAC8wn\e0Rԋ@+>`xT7}02m-yyS"wuXȃoxkcZ\3]ùzv٣Byqj3ƚ`'PC=+mvN%ύHf6AN( aϩI=߹_d: }+p?PO+Zbbyj.H@,Z@"ғ-ES4n)olIIBr~V>olbfLTq*+9)XLVRf.S9v.i硦>iFt+LVvuOx39]O#2]2=&K/~~<O^?vf)o=E4ӷ+4grN=U"g`k8=ü0}8QcÐӝXyTGָaYwSW-XVcNx.F~eyUڑ0@5㶼P?!@=LXI6QpӱڍyKoqK 0ݻ맕d5w$,ϩ/ tцB*v:-7ޚ, )p@ :$7ѴyN] h1 HZ޻Bf1畏?r 3uQB}\cmd!@ WS1zݨ]3CoFq"8ԚέiGb[UgfN G[oLĎnrWxzdD]Ջ` l_9 ]c2֋~ pIPӻߘ)* mS~H~X.t;/RG'~[!<8zvOB9`55'{ɸ6g {pqT3^-ZId, =4pBwbO&Ҹ$d%FN`7>͕xE_{ ۫v"{.1ן%$r_m L=mPO%os#(ĴyI%4aĘnzn|l6AT޾'VAJJ{` ,8I%vK$%Gv XY f 0NndQ& #Phꃢ@0 /kz%?/?!M@`Iɟ'Կ@uИcnafŽ"o;h(Yy#P_w@CV/|-ҢɡHl4ma/T"2*kT:V"AӢ@f/9/Mҹ-?JDvR7,YQoz Zh{.T"5Y/mKdPIf-徐"3;䎴]4K@E?1.eUʱծ-mԢP @"8On ׿r[O/LVSTIiFXEŅc]ՊSW9j7=T*_}x:vbj Bz)^'rgP8ƌDŽZ*'JkѢ*V`C u\B&Ʉq-ls5&5 M{n0f&%HVV^c ϲc|E pPr(pH# yM;-AB G&LjMG\^ |Y#јr8S#/nqFnEV 9q +A|iCHy}B{BIZݿe\ [ ~iC?9zaz UQry吝5rNcZպ60ę _}֡{/6Y DYD̃Aѱ* ;{ B[A%zzӤ0XޘN?wiy{$[Ĭ%5P_aT1bcKU !h]Yfsc=4·~!+g\ab906;Wd/`:5F- 'zy㠌l0^7%oo;j tE'4:NiOM>dY58EfCr3c%N? (Υ'R¦սTUdpfM w&ۄgC!`X0TroSUGڿ]bVhkʃ;n-Ӧ\= wL3{9+^S_aodC x^c"&gI{ڷ"%-U^7rRyL H[k0 cq/޹ S E!5(T<)c)A|-nRPf4,0P1`sY&D\dwR3A+ٺ|o!PaH?ek«dv&4{^% ;MM1$~I,;jx`]sVz\/1Co0TyXR^/2zj0>՚1B°I #ڸ(0q_`ɣaM/Ǚ."płNؼ40y;'ƸaiH?;(ZC/v7ܱӧßn>ƼB7Q(heRwj-K'5.n\ )^XOX{iT̨g&H`K`8# ~8lI `s5GƱVL>#8d^BFzk Od^AE#\;]>rC|m~ll9`qpsv#E@]%=`GK6DήPQH<p}}d^(O= &g.yr?U+HԼ?^!@WNFRWs3NɷdŸW1O g_?@k{C=K۵cUȗn-J(JqoCCl< _P/~׿PZG.Q>pX.0_|r *,]I鎸P'WIoyR}}Yr@EEt]>uOiVA#. '`vteyvvwHNma}/ 4H<0(Ow Vܒ M"7)}V'|@|硴f^aÝ <є`AFv\;x,WGl"}NC~8<=Q8d{h'فI]j~vh]9K9 ;#Im<Eub'z\aBΒ~Brrp }ȡ[(Ob<51)BSjO[}m(Ki\j#MŌ?,-ҖXRg[HJI \EkӉ7`:SRqDIK @sg4|~q6UO/Т`?mPьGnU?墼38Wg} =3{r3O̫]ňv{{uWBdBc+ri/n+_mazgaq%9̸L!gуb>ܷν8\ =Dmn`I:T`H'W+8$ ږ%Eh;}E `P/(b4 ٠m+1+dZ0RXBA\1>26F3S75 {s{OJWdCQz(~c5_ yCdcdJ$_(͸O@C " 0 O7-{$MgQLq_-_d !S^>'_aB%rqK=;&o~~TLmDl߫I&Ǡ36~?Pa w8Pr.PwWFgOT3ɏ1 i5M\=fȦ[]oڑo/"F}F9mOCCN!и  ?X(>nH&p׋wt|% - y#;(8itb߷@!{7Ȋ@ YVvO@/{U MVi35'#WȯVeka^u˅nwU2?-ɿ[%;з$;mc fÀ(82 Tɪס2Zb,gTzuw11&o6F HjyZVLj~CRv/ t,t* M|k .TA5B=!&|,aRe1i%& !\1cr ^Iy p1 d>>̶Ոî 0rlqn/kءDVÈ9/ű1(x⤣2}o~X$Ū{s0a!-!)۳*)e\,0?Б\,ԩT _w:^VxV޾\!uQųåҶw#)Ei/z毲p[v F98/gsD)k)/Ifingӛ/~p%Q^$Slj>!DYܷ)eyCy9A+MWN )zkS< ~U3rŅ?~                               A@@@A@@A@@@@A@@@A@@@@@@AAA@@@@@@@@@@@@@A@@A@@A@@@A@A@@A@@A@@A@@@@A@A@@A@AA@AA@@AA@@@AAA@A@A@A@A@                              @@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@                                        0 0 0  0 0  0 0  0           0  0 0 0 0  0  0  0          $$  $ $ $$  $ $             $$  $ $ $$  $ $                  0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0                            ((  ((  ((  ((  ((  ((  ((  ((          """"   " " " " ((((((((    """" ( ( ( ("("("("(  ##%%&&))**,,//1122447788;;==>>@@CCEEFFIIJJLLOOQQRRTTWWXX[[]]^^aabbddgghhkkmmnnppssuuvvyyzz||66666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\Z H!x-ML.RN8D( `hz=Skc|j9{Б/Uڅ?AZX_f ؐ53eiEVmv° GJBnI[#Q")yq~ ruo7ӎbwO$26󦻬^lW%㽨:Y*Fexpand 32-byte kexpand 16-byte k?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@,,|, ,,,,,d,,(,,, ext2fs_blkfreeext2fs_dirbadentryTh-,^- ,,\-T[-LV-xU-S-Tn-T-,-- --p94-Ѝ-|9--9uao_find_swhash_eltHc$cHcOcOcOcHcivmmapbsy\nd6_resolvend6_rtrequestnd6_lookupnd6_init0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-     A@!  @a`10  @`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O      A@!  @a`10  @`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O @@ !1Aa  0@` #+3;CScs(1$1$1 $11 11 1 1 1:,::8:D:T:`:t:::   L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#c            (08@P`p   0@`  0@`gg_bus_dma_busaddr_to_paddr $i:|90$i:|9 ,i:|90,i:|9 .i:90.i:9!i:9 !i :9)i:9 )i :9-i:9Ai:<9 -i :9PA:|9pA,:|9A<:|9AL:|9/A`:|9?At:|9A:|9A:|9/A:|9?A:|9OA:|9A:|9A:|9/A :|9?A :|9OA4:|9AH:|9AX:|90Al:|90A|:|9pA:|9pA:|9A:|9A:|9::::: : : : :$ :4 :D :T :d :t : : : : : : : : : :!: !:!:!:$!:,!:4!:: <>: h>: >: >: >: >:  ?: D?: h?:?:?:?:?:?:@:@@:l@:@:@:@:@:A:0A:`A:|A:A:A: A: A: A: B: TB:pB:B:B:B:B:C:@C:tC:C:C:C:C:D:(D:@D:lD:D:D:D:D: E:@E:dE:E:E:E: F:(F:TF:F:F:F: G:@G: pG:G:G:H:,H:HH:dH:H:H:H:H: I:(I:LI:lI:I:I:I:I:I:J:,J:DJ: dJ: J: J: J: J: (K: 4K: dK: K: K: K: L: (L:!XL:!|L:!L:!L:"L:$M:$ M:$(K:$(K:$8M:$TM:$pM:$M:$M:%M:&M:&:&`:&M:&N:&@N:&XN:&tN:&N:& N:& N:& O:& O:& TO:&xO:&O:&O:&O:&P:'l1:'DP:'`P:'P:'P:'P:'P:'P:(Q:(TQ:(xQ:(Q:)Q:)Q:) R:)$R:)HR:)`R:)R:)R:*R:*R:*R:*R:* S:*$S:*_:>`:>0`:>H`:>h`:?`:?`:?`:?`:?a:?0a:?La:?ta:?a:? a:? a:? a:? a:? b:? b:?@b:?Xb:?hb:?b:?b:?b:@b:Ab:B$c:C$e:DXc:Dqpc:Ec:Fc:Gc:Gc:Gc:G(d:GPd:Gd:Gd:Gd:Hd:Ie:J4e:KHe:K\e:Ke:Ke:Ke:Ke:Ke:Ke:Le:N$f:PDf:PXf:Ptf:Qf:Qf:Rf:Sf:Sg:Sg:S8g:Slg:Sg:Sg:Sg:Sg:Tg:U$h:U680~9o:k;lL|=>@ApD FPQSTXY] dK2@9<4` 44j4|j4ABCDEFGHIJKLMNOPQRSTUVWXYZ㡱vt100444$444@[\]^_`{|}~|^_`#@_^_`#_#^_`^_#@^_`~#@^_`~^_``#_#@[\]^_`{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^%% $ $ $ $ $%% %%<%%$%4%,%%d"e"`"  " %" #!#%# # # # ""*#d"`"e"+"4"""""<"C"!!a"""")"*"'"(""!!!! :(:0:8:@:H:P:X:`:h:p:x::::::::::::ȴ:д:Դ:ش:ܴ:::::::::::888xE5LU5L5T5Ĺ:ع:::: :: :,:4:<:L:X:d:l:|:::::X f(  pt""(4I@@@@1` #U3UCU4QF              @@@@@@@@@@@@@@@@@@@>@$@eaQ@X@W@@0@ w@Q2@U@4@F s%^^Hx555Hx555tد5(5,5(5,5X55=(R9RT9 FU9]ZU9V9JW9IX9Y9J,Y9RY97dZ9 Z9 Z9 [9 2[9KB[9[9@#[9[9[9[9[9[9 [9[9H@[9 N(\9 _\9]9^9\|`9 4a9 La9 4a9Eba9 a9mb9Kb9Atc9[c9d90d9 *e9:f9jLg9 h9?@h9nh9 i9Ji9Bj9abcde f g h i jklmnopqrstuvwxyz1!2@ 3#!4$"5%#6^$7&%8*&9('0)( ) *!+ , --_.=+/[{0]}1\|2\|3;:4'"5`~6,<7.>8/?9:;<=>?@ABC D E FG HIJK,L.MN-OPQRS T/U*V-W+X Y1Z2[3\4]5^6_7`8a9b0c.eh i jklmnopqrstuvwx yz{|}~ mMqQ@zy2" 3#6&$7/{%8([&9)]'0=}-?\./0+*1#'2#'345 6,;7.:8-_d<>| .'`0+*~5^q,?azw&12~ "3#!'4{"(5[#-6|$7`%_8\&9^'0@-)].=+}/0$1*2*3m4%56;.7:/8!d<> bBeE hH iI jJkKlL|,?nN~aArR,sSzZyY2 "3!'4"(5{[#6$7%!8&9%!8'0-)}].-_/0$*2`@#3mM4%5@#7:/\8=+g= aAkK~xX}iIpP& eE ,; c d tsrqQ'?ljbB|oOuUv.:yY{!\"12< 3>!(4[")5]#@6$+7%-8&/9'*0, _-=^.%`/z0w123n4m5$#6gG7h8fd/ 2"@ 3#!4$#6&$7/{%8([&9)]'0=}-+?.|/01'*2'*3456,;7.:8-_d<>\ .'`|0^~2" 3"5%#6&$7/%8(&9)'0=-'?.^/{[0+*}]123@4#5\|6,;7.:8-_d<> 1!2" 3!4$"5%#6^$7&%8*&9('0)--_.=+1#~2#~4'@5``d\|2"#6&$7'%8(&9)'0--=.^~/@`0[{1]}2]}3;+4:*5\_\|-+?\0345d<>| .'`|0^~.\0345|d<>.\`0^~xje.> u i d c htnbrl'"poygk,<qf;:-[{.]}//?0=+3s4-_6w7v8z9: ;<=>?@ABCD E 1!|2"@ 3#!4$~#6&$7/%8(&9)'0=-'?./[0+*]1}2}34{5\6,;7.:8-_d<> q,?azw&1|2@ "3#!'4"(5#6^$7%!8&9{'0}-).-_/[0$*]1`2`3m4%56;.7:/8=+~d<>\ aAD$bB8cCA!dD2eEC# fF0 gG? hH@  iIH( jJ>kK;lL4mML,nNB"oOI)pP7qQ9rR:sSK+tT5uU3vV<wWF&xXG'yY=zZO/#6^6,$7&7./[{E%0]}J*3;:64'"M-6,<17.>N.8/?Q aAD$bB8cCA!dD2eEC# fF0 gG? hH@  iIH( jJ>kK;lL4mML,nNB"oOI)pP7qQ9rR:sSK+tT5uU3vV<wWF&xXG'yY=zZO/#6^6,$7&7.--_V.=+T/[{E%0]}J*1\|W2\|W3;:64'"M-5`~6,<17.>N.8/?Q eEzy1+|2"@ 3*#!4#6&$7/%8(&9)'0=-'?./[0!]1$}2$}34{5 6,;7.:8-_d<>\ -'?.^`~0!]/[34{2"@ 3##6&$7/{%8([&9)]'0=}-'?.<>/+*012345\|6,;7.:8-_d<> .+*/2\|4eE a`~}kj!1@-2_ /3#!;4$":5#,6^$.7&%=8*&[9(']0), -?+'.xX%//.{0wW}1qQ|2qQ|3sr4"5`~6   7fF 8\ qQ@1!2" 3##6&$7/%8(&9)'0=-'?\./0+*~1}]2}]34{[5|6,;7.:8-_d<> 1!2@ 3#!4$"5%#6.=+/0[{1]}2]}345'"8;:c.d\|/? 1IqQ@2' 3^#!4+$"5%#6&$7/{%8([&9)]'0=}-*?\.-_/0~1,;2,;3_^4i05"678.:d<>| /1,;`2,;`3_^'aAcCeElLBAnNDCoOsS[ZxXzyzZ|{ bB{cC& fF[ gG] iI jJnN}qQ\vV@wW|xX#zZyY>1'~2" 3+^!4!"5%#6/$7=`%8(&9)'-./QP01qp2qp3$4506,?;7.:8-_*d< bB{ fF[ gG]kKBlLAmMnN}qQ\vV@wW|zZyY1!~2" 3#^!4$"5%#6&$7/`%8(&9)'0=-'?.+*/a`01~}2~}3  456,;<7.:>8-_d<> mMoOpP1!2"@ 3/!4$"5%#6?$7&%8*&9('0)--_.=+/[0']1<>}2<>}3;:~4{5#|\6,'7..8d /^^[0]4``{8aAcC  eE gG#" iI+*kK76lL<;nNFEoOMLsSa`uUkjzZ~} cCmMrRsSxXzZ1!2" 3#!4$"5%#6&$7_%8({&9)}'0'-/?\.'/0*|1<>2<>3+45@6,;7.:8-=d][ .~/"^4'`eEqQ@2"#6&$7/{%8([&9)]'0=}-\.-_/0'?~1+*`2+*`3456,;7.:8d<>| 4^    H55555555P55dd55dd5(I*LBCDOMPJQNRK(I*LCDEOMPJQNRK5585,5 5P5$555(  2 v      W 1 Q `  5@  0 2 A@ A   @  @ @   P0 P  A   h }  } } } @  85   <5  L+ L 5L2 D   O  {5o  A f F  @@@ @ @AA@:F:FP 43W  !      @ @ @ @ A n@n n@n @nn@0Df @  * Q k k"k"k"k"k @^z BF 9 |55l5 B  w *w +w +~ W UP  < 1b0 0rk {&"79n= wF@W wn a- 6<66  JK0 r"64.6d76?6I6P6$$0$0$$$$$$$$$$$$$$ $P^6(_6(f6@ 'W W@ @EEE }WQ  k"BFFeeeZZ Z 048u6t6 t62V{%1" `"'`~%ZP `,6660w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-6 6ħ6hF F hF fF @6T660`66h6666url_int_miibus_writeregurl_int_miibus_readreg@@9WP P Q@ R6H686:5g hahh! !(3P@3vK #(-2>'()*+,-./@ABCF'()*+,-./@ABCF/@ABCDEFGHIJKN'()*+,-./@ABCFMNO`abcdefghik*++,,--../-@@A&''(())**++,,-   Pp < %dcould not requeue I/O%s: sr_wu_enqueue_ccb got active wu%s: sr_wu_init got active wu%s: invalid target on wu: %p%s: i/o error on block %lld target %d b_error %d unknown optional metadata type%02x%02x%02x%02x-%02x%02x-%02x%02x-%02x%02x-%02x%02x%02x%02x%02x%02x%s%s%s: %s: %s: invalid chunk state transition %d -> %d%s: sr_startwu_callbacksr_schedule_wu: work unit not in progress (state %i) sr_sync%s: invalid optional metadata checksumunknown old optional metadata type %u %s: no in memory copy of metadata %s: could not allocate metadata scratch area %s: could not write metadata to %s %s: save metadata failed OPENBSDSR %s%03dsr_shutdownsr_down%s: roaming device %s -> %s %s: sr_scsi_cmd NULL discipline%s: %s device is being deleted, failing io %s: wu %p not on pending queueunable to allocate work unitsunable to allocate ccbsvolume %s not foundcould not allocate memory for metadatacould not allocate memory for foreign metadata%s: sr_rw: failed to allocate vnode %s: I/O error %d on dev 0x%x at block %llu failed to get DUID for softraid volumeinsufficient boot storagefailed to write boot blockfailed to write boot loadercould not save metadata to %s%s: sr_meta_rw: invalid metadata pointer cannot clear foreign metadatanot enough memory for metadata buffercould not read native metadatanot part of the same volumenot all chunks are of the native metadata formatsrc_dev_mm == NODEV%s%d%cdiscipline does not support rebuildrebuild already in progressvolume not degradedno offline chunks available to rebuildno online chunks available for rebuild%s: sr_rebuild_init: can't allocate vnode %s partition not of type RAID (%d)%s: %s partition too small%s: %s partition too large%s partition too small, at least %lld bytes required%s partition too large, wasting %lld bytes%s sector size too large, <= %u bytes required%s is already in userebuild of %s started on %s%s: no offline chunk found on %s! %s: %s volume degraded, will attempt to rebuild on hotspare %s sr_hotspare%s: pending I/O failed to complete on failed chunk %s, hotspare rebuild aborted... %s is already a hotsparesr_hotspare: cannot allocate vnodeHOTSPAREcould not save metadata for %sunsupported state request %dchunk not part of arrayinvalid foreign metadatanot valid softraid metadatainvalid metadata checksumcannot read metadata version %u on %s, expected version %u or earliersr_meta_native_bootprobe: cannot allocate vnodenot enough memory for fake disciplinesr_meta_native_bootprobe: cannot allocate vnode for partitionnative bootprobe could not read native metadatasr_meta_probe: cannot allocate vnodesrdiscould not create discipline taskqcould not initialize disciplinechunk %s already in useinvalid metadata formatdisk %s is currently in use; cannot force createfailed to clear metadataone of the chunks has corrupt metadata; aborting assemblychunk sizes are not equal; up to %llu blocks wasted per chunkvolume level does not match metadata leveldisk %s already assembledtrying to bring up %s degraded%s was not shutdown properly%s is offline, will not be brought onlineno free target for %sscsi_probe_lun failedvolume %s is roaming, it used to be %s, updating metadata%s volume attached as %ssdwd%s: failed to allocate boot volume %s: failed to allocate device array %s: failed to allocate ondisk array %s: failed to allocate hotspare %s: found duplicate chunk %u for volume %u on device %s %s: not all chunks were provided; attempting to bring volume %d online sr_locksr_hs_lock%s: controller registration failed%s: bogus rebuild restart offset, starting from 0 %s: resuming rebuild on %s at %d%% %s: could not create read io %s: could not create write io sr_rebuild%s: could not save metadata to %s sr_yieldsoftraidsr_concat_rw%s: %s: too many ccbs queued %s requires two or more chunksCONCATsr_crypto_rwcannot open key disk %s%s is not a key diskCRYPTOKEYDISKunknown crypto algorithmunable to allocate CCBsincorrect key or passphrase%s requires exactly one chunksr_raid0_rwinvalid strip sizeRAID 0%s: retrying read on block %lld %s: sr_raid1_intr_cb%s: permanently failing write on block %lld sr_raid1_rw%s: is offline, cannot read invalid volume state%s: %s: invalid volume state transition %d -> %d %s: %s: %s: invalid chunk state transition %d -> %d RAID 1%s: permanently fail write on block %lld sr_raid5_rw%s: %s failed to get read work unit%s: is offline, can't read %s requires three or more chunksRAID 5sr_raid6_rw%s: can't get wu_rDisk %llx offline, regenerating Dx+P Disk %llx & %llx offline, regenerating Dx+Dy +Q singleDisk %llx offline, regenerating Dx%s old_state = %d, %d = %d, invalid new_state%s requires four or more chunksRAID 6RAM diskfictitiousrdattach: out of memoryrd%drdattach: device name too long%s: insufficient message buffers %s: %s /mnt/etc/firmware/%s%s: device enable failed : failed to clear NIC buffer at offset %x - check configuration , address %s dp8390_start: no header mbuf%s: NIC memory corrupt - invalid packet length %d RRIP without PX field? SPIEEE_1282IEEE_P1282RRIP_1991ARRIP with incorrect NM flags? RRIP with incorrect flags?isoinodefhtovp: lbn exceed volume space %d fhtovp: crosses block boundary %d fhtovp: bread error %d fhtovp: directory crosses block boundary %d[off=%d/len=%d] cd9660_vget: alien ino_t %lluCD001%/@%/C%/Ecd9660_mountroot: can't setup bdevvp'scd9660root_devicetag VT_ISOFS, isofs vnode cd9660_strategy: spec%s(%d): W^X binary outside wxallowed mountpoint OpenBSD#!/dev/fd/%d/dev/consolewarning: /dev/console does not exist warning: /dev/console error %d initexecinit: couldn't allocate argument spaceexec %s: error %d init: not found no initswapperfork initcfpendcannot mount rootcannot find root vnodepagedaemonfork pagedaemonreaperfork reapercleanerfork cleanerupdatefork updateaiodonedfork aiodonedzerothreadfork zerothreadscheduler/sbin/init/sbin/oinit/sbin/init.bakbqquiesbqqueuebqwaitbqdestbufq_init: type %i unknownbufq init failbqinitinitclocks: unable to register softclock intrfdlockfileplfdescpldup2: fdallockqreadkqueueplknoteplwaitinit died (signal %d, exit %d)thrdeathcpu_exit returnedprocprocessppwaitunable to allocate kthread_qWARNING: thread `%s' (%d) exits with status %d %d,malloc: allocation too large, type = %d, size = %lu malloc: out of space in kmem_mapmallocarray: overflow %zu * %zuphysiochgproccnt: procs < 0procinit: mallocprocplprocessplzombieplucredplpgrpplsessionplplimitpl%s/%s%s(%d): syscall %d "%s" %s(%d): sysctl %d: %d %d %d %d %d %d ni_pledge/tmp//etc/localtime/var/run/ypbind.lock/dev/null/dev/tty/etc/spwd.db/etc/pwd.db/etc/group/etc/netid/etc/resolv.conf/etc/hosts/etc/services/var/yp/binding//usr/share/zoneinfo//etc/malloc.confaudiochowncpathdnsdpathdrmfattrflockgetpwinetmcastpfprot_execpsrecvfdrouterpathsendfdsettimestdiotmppathttyunixvminfovmmwpathprotexeccpu_switchto returnedfork idleidle%dsensorssensorsuspendpauseissignal sigaplsigwaithashinit: bad cnt%s:%s,sysctllksysctldlkthrsleep%s%s(%d)Timecounter "%s" frequency %lu Hz -- Insufficient hz, needs at least %u Time stepped from %lld.%09ld to %lld.%09ld dummynanosleepdenied attempt to set clock forward to %lld denied attempt to set clock back %lld seconds boredunexpected %s tq state %dunable to create thread for "%s" taskq unexpected %s tq state %utqdestroysystqsystqmpsrpfinipreempt: cpu_preempt not yet implementedsetrunnablefailing resume cannot be handled resume %s config_mountroot: can't allocate defer structureconfig_defer: can't defer config of a root deviceconfig_defer: can't allocate defer structureautoconfconfig_detach: forced detach of %s failed (%d)%s detached config_make_softcconfig_make_softc: allocation for device softc failed%s%dconfig_make_softc: device name too longexpandcreatconfig_make_softc: %sing dev arrayconfig_make_softc: duplicate %s>>> probing for %s* mapply: no match function for '%s' device>>> %s probe returned %d >>> %s probe won >>> no winning probe %s at root%s at %sroot device %s not configured not configured unsupported %02hx%02hx%02hx%02hx%02hx%02hx%02hx%02hx/dev/%s%s%ccannot obtain vnode for 0x%x/0x%xcannot open disk, 0x%x/0x%x, error %dcannot read disk label, 0x%x/0x%x, error %droot filesystem has size 0filesystem type %d not known.. assuming ffs use one of: exit %s[a-p]dkopendisklabels not read:root device (default %sswap device (default %s%s)root device (%s) not foundnetbootroot on %s%ccan't figure root, hope your kernel is right (%s.%c) swap on %s%d%c dump on %s%d%cdisk_unbusy: %s: dk_busy < 0 disk_detach: disk_count < 0dklkdisk_attach: can't allocate storage for disklabelwrit%s%d%c: %s %sing fsbn %lld%lld of %lld-%lld (%s%d bn %lld; cn %lld tn %lld sn %lld)extnt%s: start 0x%lx, end 0x%lx %s: region not foundextentpl klog<%d>klog: dropped %ld byte%s, message buffer full <%d>sendsyslog: dropped %d message%s, error %d%s: %s: page empty%s: %s free list modified: page %p; item addr %p; offset 0x%x=0x%lx != 0x%lx%s: %s: page header missing%s: %s: incorrect page%s: %s free list modified: page %p; item addr %p; offset 0x%x=0x%lxphpool%s: too much uptimepoolsdma%d0123456789abcdef%llo%llx(null)0123456789ABCDEFbug in kprintf: bad base%s: table is full panic: splassert: %s: want %d have %d spl assertion failure in %skernel %sassertion "%s" failed: file "%s", line %d*FOUND**UNKNOWN*%ld0%lo%3d free slot (for add) %3d %s count %d disable (pseudo device) Unknown devno (max is %d) %3d at ??? %s flags 0x%x %s [] ? Unknown argument command args description [count] number of lines before moredev add a device8|10|16 base on large numbersdevno|dev change devicesattr val|devno|dev disable devicesattr val|devno|dev enable devicesdevno|dev find devices this message list configuration leave UKC[attr [val]] show attributes (or devices with an attribute)[mins [dst]] set timezone/dst toggle verbose booting don't know--- more --- %ldError unknown state already enabled %3d can't enable free slot %3d %s disabled %3d can't disable free slot already Unknown routine /%c/ Value missing for attribute Unknown attribute change (y/n) ?out of memory. flags changed %3d can't change free slot count%3d %s changed Unknown pseudo routine /%c/ %s ? Not same device type No more space for new devices. Device not complete number or * is missing No device of this type exists. Clone Device (DevNo, 'q' or '?')Insert before Device (DevNo, 'q' or '?')Unknown command, try help Argument expected Dev expected 8|10|16 expected DevNo or Dev expected Attr, DevNo or Dev expected timezone = %d, dst = %d disautoconf verbose %sabled Unknown command User Kernel Config UKC> Continuing... addchangedisableenablefindhelplinesquitshowtimezoneverbose?pollselectpipeplpipelkpipeclpiperdpipewrttckoutqload: %d.%02d not a controlling terminal no foreground process group empty foreground process group runningrunnableiowait cmd: %s %d [%s] %lld.%02ldu %lld.%02lds %d%% %ldk ttyrub: would panic c = %d, val = %d m_copydata: off %d < 0m_copydata: len %d < 0m_copydata: short mbuf chainm_copydata: null mbufm_copym0: off %d, len %dm_copym0: short mbuf chainm_copym0: m == NULL and not COPYALLmbuf prepend length too bigmbufplmtagplmcl%dkm_apply: len %d < 0m_apply: off %d < 0m_apply: null mbuf in skipm_apply: null mbufWARNING: mclpools limit reached; increase kern.maxclustersrequested tag size for pool %#x is too bigm == NULL in m_pulldown()soaccept !NOFDREF: so %p, so_type %dnetclssoclose NOFDREF: so %p, so_type %dsockplsbcreatecontrol: message too large %d sbdropsbappendcontrolsemi-panic: sbcompressnetiosbsndlsbrcvlsbappendaddrnetcon2netconacceptunp_connect2unp_attachuipc 1uipc 2uipc 4piusrreqinconsistent bufpage countsbiowaitbufplbiodone alreadyneedbuffernobuffersbuf_get: dup lblk vp %p bp %pgetblkuvm_pagealloc_multi unable to allocate an buf_object of size %lubuf_needvabufinit: can't reserve VM for buffersnchplwtf? leak?vop_generic_revokeallnameilf_findoverlap: defaultlockfplrelookup: null namerelookup: lookup on dot-dotbrelvp: NULLbgetvp: not freevflushbuf: not dirtyvflushbufvinvalbufvinvalbuf: dirty bufsvinvalbuf: flush failedvwakeup: neg numoutputsoftdep %d vclean: deadlockvclean: cannot reclaimvclean: not cleanvgonemissing aliasvgonel: not cleanmissing bdevvgetvnodevfslockunmount of %s failed with error %d WARNING: some file systems would not unmount retrying syncing disks... giving up done vnodesuvmvnodessyncer vnode syncermount: lost mountunmount: dangling vnodeNon dma reachable buffer passed to VOP_STRATEGYvn_lockspec_badop calledspec_ioctltag VT_NON, dev %d, %d spec_close: not specialspec_fsync: not dirtyspec_fsyncspec_read typespec_write typechkvnlockdead_badop calleddead_write: lockdead_read: locktag VT_NON, dead vnode dos2unixtime(): month value out of range (%u) detrunc(): can't truncate root directory, clust %u, offset %u deextend: file too largedenodedeget(): pcbmap returned %d extendfile(): attempt to extend root directory extendfile: pcbmap. .. doscheckpath(): .. not a directory? msdosfs_sync: rofs modRRaArrAatag VT_MSDOSFS, startcluster %u, dircluster %u, diroffset %u (LOCKED) dev %d, %d, %s msdosfs_strategy: specmsdosfs_rename: lost to startdirmsdosfs_rename: lost from startdirmsdosfs_rename: updating .. in root directory?msdosfs_write(): bad file typebpfattachbpf_mcopybpf: ifpromisc failedbpfbpfszunhandled af %difa_update_broadaddr does not support dynamic lengthegressifihrmifidxrmtoo many interfaces%s: can't handle af%d allsoftnetunable to create softnet taskqifqbarlooutput: no header mbuflo%dunable to create lo0loifmedia_add: can't malloc entryifmedia_set: no match for 0x%llx/0x%llx ifmedia_set failedrtmaskcannot initialize a radix tree without memoryfailed to initialize the mask treern_delete: inconsistent normal annotation rn_delete: inconsistent mklist refcount rn_delete: inconsistent dupedkey list rn_delete: inconsistent annotation rn_delete: couldn't find our annotation Mask for route not entered rn_addmask: mask impossibly already in tree %s %p at %p rn_delete: Orphaned MaskNon-unique normal route, mask not entered raw_usrreqactive node flags=%xrt_timer_remove_all: rtq_count reached 0 rt_timer_add: rtq_count reached 0 ifafreertfree: %p not freed (neg refs) rt_timer_init: already initializedrttmr%s RTM_RESOLVE: wrong ifa (%p) was (%p) rt_timer_timer: rtq_count reached 0 rt_timer_queue_destroy: rtq_count reached 0 rtentryroute_init rtable_addroute_outputunexpected mode %uunexpected mode %d%s: invalid channel freq %u flags %x %s: invalid channel (NULL) Bad IBSS channel %u%s: bad channel ignored; freq %u flags %x number %u Pairwise key expansionPMK Name%s: Michael MIC failure %s: %sassociation failed (status %d) for %s %s: received %s from %s rssi %d mode %s 80211scanfreeing bss nodeunable to setup inital BSS nodepassive%s: end %s scan %s: begin %s scan invalid group data cipher!invalid integrity group cipher!management frame too large: %unull node%s: sending %s to %s on channel %u mode %s %s: no node for dst %s, discard raw tx frame %s: station %s deauthenticate (reason %d) %s: station %s disassociate (reason %d) %s: received msg %d/%d of the %s handshake from %s group key4-wayEAPOL-Key frame too large: %u%s: sending EAPOL-Key request to %s %s: sending msg %d/%d of the %s handshake to %s %s: open authentication failed (reason %d) for %s "0x%s: no recent beacons from %s; rescanning %s: bogus xmit rate %u setupassociatedsynchronized%s: %s with %s ssid channel %d start MCS %u.5 start %u%sMbshortlong protection enabled HT enabled %s preamble %s slot time%s%s assoc_reqassoc_respreassoc_reqreassoc_respprobe_reqprobe_respreserved#6reserved#7beaconatimdisassocauthdeauthactionaction_noackreserved#15INITSCANAUTHASSOCRUNauto11a11b11g11naeamatauazbebgbhbnbobrbybzcacncocrcyczdodzegf2fifrgrgthkhnhrhuiqisj1j2j3j4j5jmjojpk2kekpkrkwkzlbliltlvmamkmomxmyninlnzpaphpkprpyqarusasgsisvtntrtttwuaukuyuzvnyezazwAPL1APL1AAPL1_ETSICAPL1_FCCAAPL1WAPL2APL2CAPL2DAPL2_ETSICAPL2WAPL3APL3WAPL4APL4WAPL5APL5WAPLDAPLDEBUGETSI1ETSI1WETSI2ETSI2WETSI3ETSI3AETSI3W,ETSI4ETSI4CETSI4WETSI5ETSI5WETSI6ETSI6WETSIAETSIBETSICETSIEU1WFCC1FCC1AFCC1WFCC2FCC2CFCC2AFCC2WFCC3FCC3AFCCAFRANCEMKK1MKK1_FCCAMKK1AMKK1A1MKK1A2MKK1BMKK2MKK2AMKKANONEWOR01WWOR02WWOR0WWOR1WWOR2WWOR3WWOR4WWOR5_ETSICWOR9WWORAWWORLDarp: attempt to overwrite permanent entry for %s by %s on %s arp: attempt to overwrite entry for %s on %s by %s on %s arp info overwritten for %s by %s on %s arp: attempt to add entry for %s on %s by %s on %s arp: ether address is broadcast for IP address %s! duplicate IP address %s sent from ethernet address %s arp%s: bad gateway value: %s %s: pool get failed %s: %s: route contains no arp information %s: %s: incorrect arp information %s: no mbuf invalid argument to in_lifaddr_ioctlin_pcbinit: hashinit failedin_pcbinit: hashinit failed for lportIPv6 pcb passed into in_pcbconnectinpcbplinternet%u.%u.%u.%uicmp_do_exthdr: m_getptr failureicmp_erroricmp lenipqeipqip_initaeshmac-sha1deflaterip_attachrip_detachrip_usrreqsyncachetcp_pulloutofbandm_pulldown malfunctiontcp_output REXMTtcp_outputtcpcbtcpqetcp_inittcp_usrrequdp_usrreqipip_input: should never reach herecryptocrynlkcryptopcryptodesccuio_copyback: off %d < 0cuio_copyback: len %d < 0cuio_copyback: empty in skipuio_copyback: emptycuio_copydata: off %d < 0cuio_copydata: len %d < 0iov_copydata: empty in skipcuio_copydata: emptycuio_apply: len %d < 0cuio_apply: off %d < 0cuio_apply: ind %d >= uio_iovcnt %d for offcuio_apply: ind %d >= uio_iovcnt %d for lenSoftware crypto device cannot initialize!3DESBlowfishCAST-128Rijndael-128/AESAES-CTRAES-GCMAES-GMACAES-XTSCHACHA20-POLY1305HMAC-MD5HMAC-SHA1HMAC-RIPEMD-160HMAC-SHA2-256HMAC-SHA2-384HMAC-SHA2-512GMAC-AES-128GMAC-AES-192GMAC-AES-256DeflateLZS1.2.3start = %d, len = %d, fs = %s ffs_alloccg: map corruptedbno = %lld, fs = %s ffs_alloccg: block not in mapffs_freefile: range: dev = 0x%x, ino = %d, fs = %sdev = 0x%x, ino = %u, fs = %s ffs_freefile: freeing free inodedev = 0x%x, bsize = %d, size = %ld, fs = %s ffs_blkfree: bad sizebad block %lld, ino %u uid %u on %s: %s bad blockdev = 0x%x, block = %lld, fs = %s ffs_blkfree: freeing free blockffs_blkfree: freeing free fragcg = %d, irotor = %d, fs = %s ffs_nodealloccg: map corruptedffs_nodealloccg: block not in mapmode = 0%o, inum = %u, fs = %s ffs_valloc: dup allocfree inode %s/%d had %lld blocks out of inodes %s: create/symlink failed, no inodes free dev = 0x%x, bsize = %d, bprev = %lld, fs = %s ffs_realloccg: bad bprevffs_realloccg: bad blocknodev = 0x%x, optim = %d, fs = %s ffs_realloccg: bad optimfile system full %s: write failed, file system is full ffs1_balloc: blk too bigCould not unwind indirect block, error %dffs_indirtrunc: bad buffer sizeffs_truncate: newspaceffs_update: bad link cntsoftdep_flushfiles calledffsinodino1plffs_vget: alien ino_t %lluupdate: rofs modffs_statfsWARNING: %s was not properly unmounted WARNING: R/W mount of %s denied. Filesystem is not clean - run fsck ffs_reload: dirty1ffs_reload: dirty2WARNING: soft updates isn't compiled in ffs_mountroot: can't setup bdevvp's ffsffs_fsync: not dirtyffs_fsyncffs_write: nonsync dir writeffs_write: typecheckpath: .. not a directory First bad Second bad %s: bad dir ino %u at offset %d: %s bad dirufs_direnter: newblkufs_direnter: compact1ufs_direnter: compact2mangled entryi_ffs_size too smallufs_strategy: specufs_rename: lost from startdirufs_rename: lost to startdirrename: EXDEVufs_rename: same fileufs_rename: lost dir entrychown: lost quotaifree: range: dev = 0x%x, ino = %u, fs = %sdev = 0x%x, ino = %d, fs = %s ifree: freeing free inodebad block %u, ino %u %s: freeing free block: dev = 0x%x, block = %u, fs = %s mode = 0%o, nlinks %u, inum = %u, fs = %s ext2fs_valloc: dup allocext2fs_alloccg: map corruptedext2fs_mapsearch: block not in mapcg = %d, ipref = %u, fs = %s ext2fs_nodealloccg: map corruptedext2fs_nodealloccg: block not in mapext2fs_indirtrunc: bad buffer sizecheckpathrec_len is smaller than minimalrec_len % 4 != 0reclen is too small for name_lendirectory entry across blocksinode out of boundsbad directory entry: %s offset=%d, inode=%u, rec_len=%d, name_len=%d i_size too smallext2fs_direnter: newblkext2fs_direnter: frag size%s: nonsync dir writeext2fs_write%s: typeext2fs_vget: alien ino_t %lluext2fs: wrong magic number 0x%x ext2fs: wrong log2(block size) %d ext2fs: zero blocks per group ext2fs: wrong revision number 0x%x ext2fs: first inode at 0x%x ext2fs: unsupported incompat features 0x%x ext4fs: only read-only support right now ext2fs: your file system says it needs recovery ext2fs: unsupported R/O compat features 0x%x ext2fs_statfsext2fs_reload: dirty1ext2fs_reload: dirty2%s: file system not clean; please fsck(8) ext2fs_mountroot: can't setup bdevvp'sext2fsext2inoplext2dinoplext2fs_mkdir: blksizeext2fs_rename: lost from startdirext2fs_rename: lost to startdirrename: linked directoryext2fs_rename: lost dir entryext2fs_rename: mangled diruvm_addr_invoke: address selector %p (%s 0x%lx-0x%lx) returned unavailable address 0x%lx sz 0x%lxuaddruaddrhintuaddrbestuaddrpivotuaddrrnduaddr_rnduaddr_hintuaddr_kbootstrapamap_splitref: split at zero offsetamap_splitref: map size check failedamap_cow_now: non-resident wired page in anon %pcownowcownowpageamap_add: offset out of rangeamap_add: replacing null anonamap_add: slot in useamap_populate: offset out of rangeamap_lookups: offset out of rangeamap_lookup: offset out of rangeamap_unadd: offset out of rangeamap_unadd: chunk for slot %d not presentamap_unadd: nothing thereamap_wipeout: corrupt amapamapplamappl%damapchunkplamap_pp_adjref: overshot targetamap_pp_adjref: negative reference countanonpl%s: can't allocate entryuao_set_swslot: uobj = %p uao_set_swslot: attempt to set a slot on a NOSWAP objectuao_flush: strange, got an out of range flush (fixed) uaoflshuao_flush: weird flagsuao_detuaoeltplaobjpluao_create: kernel object already allocateduao_create: asked to enable swap on kernel objectuao_create: hashinit swhash faileduao_create: malloc swslots faileduao_getpageuao_getudv_faultudv_detachudv_attachuvm_fault_unwire_locked: address not in mapanonget2flt_noram1fltamapcopyflt_noram3flt_pmfail1fltagain2flt_noram5flt_pmfail2uvm_init: page size not setkm_allocvauvm_km_pgremove_intrsafe: no pagekmallockmthreadvallocwaitkm_alloc1wkm_pgrmuvm_km_suballoc: unable to allocate space in parent mapuvm_km_suballoc: unable to create submapuvm_km_suballoc: submap allocation faileduvm_km_init: could not reserve space for kernelkm_free: unmanaged page 0x%lx uvm_map_clean: weird flagsuvm_mapent_addr_removeuvm_mapent_addr_insert: entry still in addr listuvm_mapent_addr_insert: map %p entry %p (0x%lx-0x%lx G=0x%lx F=0x%lx) insert collision with entry %p (0x%lx-0x%lx G=0x%lx F=0x%lx)vmspplvmmpeplvmmpekpluvm_map_splitentry: split address 0x%lx not on page boundary!uvm_mapent_alloc: cannot allocate map entryuvm_mapent_alloc: out of static map entries vmmaplkuvm_map_protect: kernel map W^X violation requesteduvmspace_fork: no space in map for entry in empty mapfork: encountered a submap during fork (illegal)fork: non-copy_on_write map entry marked needs_copy (illegal)uvm_share: encountered a submap (illegal)uvm_share: non-copy_on_write map entries marked needs_copy (illegal)uvm_map: kernel map W^X violation requested%s(%d): %s W^X violation mprotectmmapuvm_page_physget: called _after_ bootstrapuvm_page_physget: out of memory!uvm_setpagesize: page size not a power of twouvm_pglistallocuvm_pglistalloc: Upper boundary 0x%lx not on pagemask. uvm_page_physload: unable to load physical memory segment %d segments allocated, ignoring 0x%llx -> 0x%llx increase VM_PHYSSEG_MAX uvm_page_physload: can not malloc vm_page structs for segment ignoring 0x%lx -> 0x%lx uvm_page_physload: tried to add RAM after vm_mem_inituvm_pageboot_alloc: out of virtual spaceuvm_pageboot_alloc: pmap_growkernel() faileduvm_pageboot_alloc: out of memoryuvm_page_bootstrap: no memory pre-allocateduvm_page_init: lost %ld page(s) in initsize 0 uvm_pagereallocpagersegpgdaemonuvm_wait emergency bufbackoff pagedaemon: deadlock detected! pagedaemon: wait_pla deadlock detected! pmrwaituvm_wait: failed to free %ld pages between 0x%lx-0x%lx uvm_pmr_split: lost one pmr Flags: 0x%x, will panic now. pgzerowarning: resource shortage: %d pages of swap lost swapdrum_addsw_reg_strategy: swap to sparse fileswstrategy: vnode type 0x%xswap_off: swapdev not in listswap0x%04xdisklabel reserve/dev/%s%d%cblkdev0x%xuvm_swap_init: can't get vnode for swap deviceswapmapuvm_swap_init: extent_create failedswp vnxswp vndswplksbrk: grow %ld failed, error = %d uvm_deallocate with null mapuvn_iosyncuvn_cluster: offset out of rangeuvn_flshuvn_flush: obj=%p, offset=0x%llx. error during pageout. uvn_flush: WARNING: changes to page may be lost! uvn_flushuvn_termuvm_vnp_terminate: io sync wanted bit setuvn_attachuvnsyncuvn_getpageuvn_getNULL pointer passed to ip_ecn_egressNULL pointer passed to ip_ecn_ingressin6_prefixlen2mask: invalid prefix length(%d) in6_are_prefix_equal: invalid prefix length(%d) in6_purgeaddr: failed to remove a route to the p2p destination: %s on %s, errno=%d in6_update_ifa: valid lifetime is 0 for %s in6_update_ifa: failed to remove a route to the old destination: %s invalid argument to in6_lifaddr_ioctlin6_ifawithscope: output interface is not specified %s: got interface identifier from itself %s: borrow interface identifier from %s %s: interface identifier generated by random number %s: failed to get interface identifier %s: ifid: %02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x %s: no ifid available in6_cksum: mbuf len (%d) < off+len (%d+%d)in6_cksum: out of datainternet6(src=%s dst=%s tgt=%s)ICMP6 redirect sent from %s rejected; must be from linklocal ICMP6 redirect sent from %s rejected; hlim=%d (must be 255) ICMP6 redirect rejected; redirect dst must be unicast: %s ICMP6 redirect rejected; no route with inet6 gateway found for redirect dst: %s ICMP6 redirect rejected; not equal to gw-for-src=%s (must be same): %s ICMP6 redirect rejected; no route found for redirect dst: %s ICMP6 redirect rejected; neither router case nor onlink case: %s icmp6_redirect_input: invalid ND option, rejected: %s icmp6_redirect_input: lladdrlen mismatch for %s (if %d, icmp6 packet %d): %s icmp6_notify_error: in6_embedscope failed sanity fail: off=%lx, sizeof(ip6)=%lx in %s:%d ../../../../netinet6/icmp6.cicmp6_reflect: source can't be determined: dst=%s, error=%d ICMP6 checksum error(%d|%x) %s icmp6_input: unknown type %d(src=%s, dst=%s, ifid=%u) ENOBUFS in icmp6_error %d icmp6_mtudisc_callback_registerip6_nexthdr: m == NULLip6_input: packet to an unready address %s->%s ip6_initcannot forward from %s to %s nxt %d received on inteface %u cannot forward src %s, dst %s, nxt %d, rcvif %u, outif %u assumption failed: hdr not splitndopts == NULL in nd6_optionuninitialized ndopts in nd6_optionndopts == NULL in nd6_optionsuninitialized ndopts in nd6_optionsduplicated ND6 option found (type=%d) nd6_options: unsupported option %d - option ignored too many loop in nd opt unspec%s: failed to lookup %s (if=%s) %s called more than once nd6ln->ln_rt == NULLrt_llinfo(%p) is not equal to ln(%p)dst=0 in nd6_timer(ln=%p)%s: %s: route contains no ND information %s: something odd happens %s: %s: incorrect nd6 information ifp == NULL in nd6_cache_lladdrfrom == NULL in nd6_cache_lladdrndp info overwritten for %s by %s on %s %s: failed to join %s (errno=%d) %s: DAD detected duplicate IPv6 address %s: NS in/out=%d/%d, NA in=%d %s: DAD complete for %s - duplicate found %s: manual intervention required ifa == NULL in nd6_dad_ns_inputnd6_na_output: source can't be determined: dst=%s, error=%d nd6_ns_output: source can't be determined: dst=%s, error=%d nd6_dad_timer: called with null parameter nd6_dad_timer: DAD structure not found ???nd6_dad_timer: called with duplicated address %s(%s) nd6_dad_timer: called with non-tentative address %s(%s) %s: could not run DAD, driver problem? %s: DAD complete for %s - no duplicates found nd6_dad_start: memory allocation failed for %s(%s) %s: starting DAD for %s nd6_na_input: invalid hlim (%d) from %s to %s on %s nd6_na_input: invalid target address %s nd6_na_input: a solicited adv is multicasted nd6_na_input: invalid ND option, ignored nd6_na_input: multicast adv without TLLA nd6_na_input: duplicate IP6 address %s nd6_na_input: ND packet from non-neighbor nd6_na_input: lladdrlen mismatch for %s (if %d, NA packet %d) nd6_ns_input: invalid hlim (%d) from %s to %s on %s nd6_ns_input: bad DAD packet (wrong ip6 dst) nd6_ns_input: NS packet from non-neighbor nd6_ns_input: bad NS target (multicast) nd6_ns_input: invalid ND option, ignored nd6_ns_input: bad DAD packet (link-layer address option) nd6_ns_input: lladdrlen mismatch for %s (if %d, NS packet %d) nd6_ns_input: duplicate IP6 address %s nd6_ns_input: src=%s nd6_ns_input: dst=%s nd6_ns_input: tgt=%s in6_init_prefix_ltimes: preferred lifetime(%d) is greater than valid lifetime(%d) in6_ifadd: wrong prefixlen for %s (prefix=%d ifid=%d) in6_ifadd: failed to make ifaddr %s on %s (errno=%d) nd6_prefix_onlink: failed to find any ifaddr to add route for a prefix(%s/%d) on %s nd6_prefix_offlink: %s/%d is already off-link nd6_prefix_offlink: failed to recover a prefix %s/%d from %s to %s (errno = %d) pfxlist_onlink_check: failed to make %s/%d offlink, errno=%d prelist_remove: failed to make %s/%d offlink on %s, errno=%d prelist_remove: negative count on %s nd6_prelist_add: failed to make the prefix %s/%d on-link on %s (errno=%d) prelist_update: failed to make the prefix %s/%d on-link on %s (errno=%d) prelist_update: nd6_prelist_add failed for %s/%d on %s errno=%d, returnpr=%p defrouter_select: more than one router is installed defrtrlist_del: negative count on %s nd6_rs_input: invalid hlim (%d) from %s to %s on %u nd6_rs_input: invalid ND option, ignored nd6_rs_input: lladdrlen mismatch for %s (if %d, RS packet %d) nd6_ra_input: invalid hlim (%d) from %s to %s on %s nd6_ra_input: src %s is not link-local nd6_ra_input: invalid ND option, ignored nd6_ra_input: invalid option len %d for prefix information option, ignored nd6_ra_input: invalid prefix len %d for prefix information option, ignored nd6_ra_input: invalid prefix %s, ignored nd6_ra_input: invalid prefixlen %d for rfc2374 prefix %s, ignored nd6_ra_input: lladdrlen mismatch for %s (if %d, RA packet %d) rip6_attachrip6_detachrip6_usrreq invalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect header checkunknown compression methodinvalid window sizeunknown header flags setheader crc mismatchincorrect data checkincorrect length checkneed dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible versioncompatiblestatus: no device tree #address-cells#size-cellsmodel: unknown model cpumainbusnamephandlelinux,phandlerangesreg#gpio-cellsNo support for this CPU type (%08x) in kernelUndefined instruction in kernel real mem = %lu (%luMB) avail mem = %lu (%luMB) Warning IRQ's disabled during boot() WARNING: not updating battery clock _bus_dmamap_load_raw: not implemented_bus_dmamem_map: size botch_bus_dmamap_sync: mix PRE and POST%s: curaddr %#lx not in range_bus_dmamap_sync: ARM32_BUFTYPE_INVALIDunknown buffer type %d _bus_dmamap_syncProcessor failed probe - no CPU ID %s %s (%s core)%s: DC disabled DC enabled IC disabled IC enabled WB disabled WB enabled LABT EABT branch prediction enabled%s: %dKB/%dB %d-way %s unified cache %s: %dKB(%db/l,%dway) I-cache, %dKB(%db/l,%dway) %s D-cache %s: %s does not fully support this CPU. %s: This kernel does not fully support this CPU. %s: Recompile with "options %s" to correct this. unknown CPU (ID = 0x%x)i80321 400MHzi80321 600MHzi80219 400MHzi80219 600MHzPXA250PXA210PXA27xARM Cortex A5ARM Cortex A7ARM Cortex A8ARM Cortex A8 R1ARM Cortex A8 R2ARM Cortex A8 R3ARM Cortex A9ARM Cortex A9 R1ARM Cortex A9 R2ARM Cortex A9 R3ARM Cortex A9 R4ARM Cortex A15ARM Cortex A15 R1ARM Cortex A15 R2ARM Cortex A15 R3ARM Cortex A15 R4ARM Cortex A17ARM Cortex A17 R1ARM Cortex A53ARM Cortex A53 R1ARM Cortex A57ARM Cortex A57 R1ARM Cortex A72ARM Cortex A72 R1unknownXScaleCPU_XSCALE_...CPU_ARMv7wr-thruwr-back**unknown 3****unknown 4**wr-back-lockwr-back-lock-Awr-back-lock-B**unknown 8****unknown 9****unknown 10****unknown 11****unknown 12****unknown 13****unknown 14****unknown 15**step A-0step B-0rev 2rev 3rev 4rev 5rev 6rev 7rev 8rev 9rev 10rev 11rev 12rev 13rev 14rev 15rev 1step A-1step B-1step B-2step C-0step ?step C-5rev 0badaddr: invalid size (%lu)userkernelFatal %s mode data abort: '%s' trapframe: %p DFSR=%08x, DFAR=%08x (imprecise), spsr=%08lx Fatal %s mode prefetch abort at 0x%08lx trapframe: %p IFSR=%08x, IFAR=%08x, spsr=%08lx r0 =%08lx, r1 =%08lx, r2 =%08lx, r3 =%08lx r4 =%08lx, r5 =%08lx, r6 =%08lx, r7 =%08lx r8 =%08lx, r9 =%08lx, r10=%08lx, r11=%08lx r12=%08lx, usp=%08lx, ulr=%08lxssp=%08lx, slr=%08lx, pc =%08lx Fatal abortUVM: pid %d (%s), uid %d killed: out of swap data_abort_fault: Misaligned Kernel-mode Program Counter Non-emulated page fault with intr_depth > 0 uvm_fault(%p, %lx, %x, 0) -> %x Vector ExceptionAlignment Fault 1Terminal ExceptionAlignment Fault 3External Linefetch Abort (S)Translation Fault (S)External Linefetch Abort (P)Translation Fault (P)External Non-Linefetch Abort (S)Domain Fault (S)External Non-Linefetch Abort (P)Domain Fault (P)External Translation Abort (L1)Permission Fault (S)External Translation Abort (L2)Permission Fault (P)mmrwpmap_map_chunk: no L1 table providedpmap_map_chunk: no L2 table for VA 0x%08lxpmap_map_chunk: can't find L2 table for VA0x%08lxpmap_alloc_specials: no l2b for 0x%lxpmap_bootstrap: No L2 for L2 @ va %ppmap_init_l1: can't get PA of L1 at %pCannot allocate L1 KVMCannot allocate L1 physical pagespmap_bootstrap: No L2 for va 0x%x, pa 0x%lxpmap_bootstrap: out of static L2spmap_bootstrap: WARNING! wrong cache mode for L2 pte @ %p pmap_bootstrap: WARNING! wrong cache mode for primary L1 @ 0x%lx pmapplpvepll2dtblpll2ptpplxscale_setup_minidata: can't find L2 table for VA 0x%08lxpmap_map_entry: no L2 table for VA 0x%08lxpmap_map_entry: can't find L2 table for VA 0x%08lxpmap_enter: failed to allocate L2 bucketpmap_enter: no pv entries dump to dev %u,%u not possible dumping to dev %u,%u offset %ld dump area unavailable device bad device not ready area improper i/o error aborted from console succeeded vunmapbufvmapbufglassattempting to switch console to lcd screen ffuartbtuartstuartbootfile: %s bootargs: %s unknown option `%c' cpu not recognized!%08lx -> %08lx @ %08lx OpenBSD/zaurus booting ... initarm: Configuring system ... physmemory: %d pages at 0x%08lx -> 0x%08lx Allocating page tables freestart = 0x%08lx, free_pages = %d (0x%08x) initarm: out of memoryinitarm: Failed to align the kernel page directoryIRQ stack: p0x%08lx v0x%08lx ABT stack: p0x%08lx v0x%08lx UND stack: p0x%08lx v0x%08lx SVC stack: p0x%08lx v0x%08lx Creating L1 page table at 0x%08lx Mapping kernel Constructing L2 page tables freestart = 0x%08lx, free_pages = %d (0x%x) switching to new L1 page table @%#lx...bootstrap done. init subsystems: stacks vectors undefined page pmap Attempting to power down... The operating system has halted. Please press any key to reboot. rebooting... reboot failed; spinning Diagnostic Failure on Component 0x%02xTagged Overlapped Commands (0x%02x = TASK TAG)Decompression Exception Short Algorithm ID OF 0x%02xASC 0x%02x ASCQ 0x%02xCDBParametersError in %s, Offset %d, bit %dActual Retry Count: %dProgress Indicator: %dprobe%s(%s:%d:%d): %sCheck Condition (error %#x) on opcode 0x%x AT BLOCK #: %d (decimal) SENSE KEY: %s %c Filemark Detected%c EOM Detected%c Incorrect Length Indicator Set INFO: 0x%x (VALID flag %s) COMMAND INFO: 0x%x ASC/ASCQ: %s FRU CODE: 0x%x SKSV: %s DEFERRED scbusyunknown error category (0x%x) from scsi driver scsi_done called twice on xs(%p)unexpected xsh state %usyncxspendxsscsiiomvscsi_xfer pool exhausted! scxsplscsiplugscsi_cmd_rw_decode: bad opcode 0x%02xNo Additional SenseSoft ErrorNot ReadyMedia ErrorHardware ErrorIllegal RequestUnit AttentionWrite ProtectedBlank CheckVendor UniqueCopy AbortedAborted CommandEqual ErrorVolume OverflowMiscompare ErrorNo Additional Sense InformationFilemark DetectedEnd-Of-Partition/Medium DetectedSetmark DetectedBeginning-Of-Partition/Medium DetectedEnd-Of-Data DetectedI/O Process TerminatedAudio Play Operation In ProgressAudio Play Operation PausedAudio Play Operation Successfully CompletedAudio Play Operation Stopped Due to ErrorNo Current Audio Status To ReturnCleaning RequestedErase Operation In ProgressLocate Operation In ProgressRewind Operation In ProgressSet Capacity Operation In ProgressVerify Operation In ProgressNo Index/Sector SignalNo Seek CompletePeripheral Device Write FaultNo Write CurrentExcessive Write ErrorsLogical Unit Not Ready, Cause Not ReportableLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Initialization Command RequiredLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Format In ProgressLogical Unit Not Ready, Rebuild In ProgressLogical Unit Not Ready, Recalculation In ProgressLogical Unit Not Ready, Operation In ProgressLogical Unit Not Ready, Long Write In ProgressLogical Unit Not Ready, Self-Test In ProgressLogical Unit Not Accessible, Asymmetric Access State TransitionLogical Unit Not Accessible, Target Port In Standby StateLogical Unit Not Accessible, Target Port In Unavailable StateLogical Unit Not Ready, Structure Check RequiredLogical Unit Not Ready, Auxiliary Memory Not AccessibleLogical Unit Not Ready, Notify (Enable Spinup) RequiredLogical Unit Not Ready, OfflineLogical Unit Not Ready, SA Creation In ProgressLogical Unit Not Ready, Space Allocation In ProgressLogical Unit Not Ready, Robotics DisabledLogical Unit Not Ready, Configuration RequiredLogical Unit Not Ready, Calibration RequiredLogical Unit Not Ready, A Door Is OpenLogical Unit Not Ready, Operating In Sequential ModeLogical Unit Not Ready, Start Stop Unit Command In ProgressLogical Unit Does Not Respond To SelectionNo Reference Position FoundMultiple Peripheral Devices SelectedLogical Unit Communication FailureLogical Unit Communication TimeoutLogical Unit Communication Parity ErrorLogical Unit Communication CRC Error (ULTRA-DMA/32)Unreachable Copy TargetTrack Following ErrorTracking Servo FailureFocus Servo FailureSpindle Servo FailureHead Select FaultError Log OverflowWarningWarning - Specified Temperature ExceededWarning - Enclosure DegradedWarning - Background Self-Test FailedWarning - Background Pre-Scan Detected Medium ErrorWarning - Background Medium Scan Detected Medium ErrorWarning - Non-Volatile Cache Now VolatileWarning - Degraded Power To Non-Volatile CacheWarning - Power Loss ExpectedWrite ErrorWrite Error Recovered with Auto ReallocationWrite Error - Auto Reallocate FailedWrite Error - Recommend ReassignmentCompression Check Miscompare ErrorData Expansion Occurred During CompressionBlock Not CompressibleWrite Error - Recovery NeededWrite Error - Recovery FailedWrite Error - Loss Of StreamingWrite Error - Padding Blocks AddedAuxiliary Memory Write ErrorWrite Error - Unexpected Unsolicited DataWrite Error - Not Enough Unsolicited DataDefects In Error WindowError Detected By Third Party Temporary InitiatorThird Party Device FailureCopy Target Device Not ReachableIncorrect Copy Target Device TypeCopy Target Device Data UnderrunCopy Target Device Data OverrunInvalid Information UnitInformation Unit Too ShortInformation Unit Too LongID CRC Or ECC ErrorLogical Block Guard Check FailedLogical Block Application Tag Check FailedLogical Block Reference Tag Check FailedLogical Block Protection Error On Recover Buffered DataLogical Block Protection Method ErrorUnrecovered Read ErrorRead Retries ExhaustedError Too Long To CorrectMultiple Read ErrorsUnrecovered Read Error - Auto Reallocate FailedL-EC Uncorrectable ErrorCIRC Unrecovered ErrorData Resynchronization ErrorIncomplete Block ReadNo Gap FoundMiscorrected ErrorUncorrected Read Error - Recommend ReassignmentUncorrected Read Error - Recommend Rewrite The DataDe-Compression CRC ErrorCannot Decompress Using Declared AlgorithmError Reading UPC/EAN NumberError Reading ISRC NumberRead Error - Loss Of StreamingAuxiliary Memory Read ErrorRead Error - Failed Retransmission RequestRead Error - LBA Marked Bad By Application ClientAddress Mark Not Found for ID FieldAddress Mark Not Found for Data FieldRecorded Entity Not FoundRecord Not FoundFilemark or Setmark Not FoundEnd-Of-Data Not FoundBlock Sequence ErrorRecord Not Found - Recommend ReassignmentRecord Not Found - Data Auto-ReallocatedLocate Operation FailureRandom Positioning ErrorMechanical Positioning ErrorPositioning Error Detected By Read of MediumData Synchronization Mark ErrorData Sync Error - Data RewrittenData Sync Error - Recommend RewriteData Sync Error - Data Auto-ReallocatedData Sync Error - Recommend ReassignmentRecovered Data With No Error Correction AppliedRecovered Data With RetriesRecovered Data With Positive Head OffsetRecovered Data With Negative Head OffsetRecovered Data With Retries and/or CIRC AppliedRecovered Data Using Previous Sector IDRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Recommend RewriteRecovered Data Without ECC - Data RewrittenRecovered Data With Error Correction AppliedRecovered Data With Error Correction & Retries AppliedRecovered Data - Data Auto-ReallocatedRecovered Data With CIRCRecovered Data With L-ECRecovered Data - Recommend ReassignmentRecovered Data - Recommend RewriteRecovered Data With ECC - Data RewrittenRecovered Data With LinkingDefect List ErrorDefect List Not AvailableDefect List Error in Primary ListDefect List Error in Grown ListParameter List Length ErrorSynchronous Data Transfer ErrorPrimary Defect List Not FoundGrown Defect List Not FoundMiscompare During Verify OperationMiscompare Verify Of Unmapped LbaRecovered ID with ECCPartial Defect List TransferInvalid Command Operation CodeAccess Denied - Initiator Pending-EnrolledAccess Denied - No Access rightsAccess Denied - Invalid Mgmt ID KeyIllegal Command While In Write Capable StateObsoleteIllegal Command While In Explicit Address ModeIllegal Command While In Implicit Address ModeAccess Denied - Enrollment ConflictAccess Denied - Invalid LU IdentifierAccess Denied - Invalid Proxy TokenAccess Denied - ACL LUN ConflictIllegal Command When Not In Append-Only ModeLogical Block Address Out of RangeInvalid Element AddressInvalid Address For WriteInvalid Write Crossing Layer JumpIllegal Function (Should 20 00, 24 00, or 26 00)Illegal Field in CDBCDB Decryption ErrorSecurity Audit Value FrozenSecurity Working Key FrozenNonce Not UniqueNonce Timestamp Out Of RangeInvalid XCDBLogical Unit Not SupportedInvalid Field In Parameter ListThreshold Parameters Not SupportedInvalid Release Of Persistent ReservationData Decryption ErrorToo Many Target DescriptorsUnsupported Target Descriptor Type CodeToo Many Segment DescriptorsUnsupported Segment Descriptor Type CodeUnexpected Inexact SegmentInline Data Length ExceededInvalid Operation For Copy Source Or DestinationCopy Segment Granularity ViolationInvalid Parameter While Port Is EnabledInvalid Data-Out Buffer Integrity Check ValueData Decryption Key Fail Limit ReachedIncomplete Key-Associated Data SetVendor Specific Key Reference Not FoundHardware Write ProtectedLogical Unit Software Write ProtectedAssociated Write ProtectPersistent Write ProtectPermanent Write ProtectConditional Write ProtectSpace Allocation Failed Write ProtectNot Ready To Ready Transition (Medium May Have Changed)Import Or Export Element AccessedFormat-Layer May Have ChangedImport/Export Element Accessed, Medium ChangedPower On, Reset, or Bus Device Reset OccurredPower On OccurredSCSI Bus Reset OccurredBus Device Reset Function OccurredDevice Internal ResetTransceiver Mode Changed to Single EndedTransceiver Mode Changed to LVDI_T Nexus Loss OccurredMode Parameters ChangedLog Parameters ChangedReservations PreemptedReservations ReleasedRegistrations PreemptedAsymmetric Access State ChangedImplicit Asymmetric Access State Transition FailedPriority ChangedCapacity Data Has ChangedError History I_T Nexus ClearedError History Snapshot ReleasedError Recovery Attributes Have ChangedData Encryption Capabilities ChangedTimestamp ChangedData Encryption Parameters Changed By Another I_T NexusData Encryption Parameters Changed By Vendor Specific EventData Encryption Key Instance Counter Has ChangedSA Creation Capabilities Data Has ChangedCopy Cannot Execute Since Host Cannot DisconnectCommand Sequence ErrorToo Many Windows SpecifiedInvalid Combination of Windows SpecifiedCurrent Program Area Is Not EmptyCurrent Program Area Is EmptyIllegal Power Condition RequestPersistent Prevent ConflictPrevious Busy StatusPrevious Task Set Full StatusPrevious Reservation Conflict StatusPartition Or Collection Contains User ObjectsNot ReservedORWrite Generation Does Not MatchOverwrite Error On Update In PlaceInsufficient Time For OperationCommands Cleared By Another InitiatorCommands Cleared By Power Loss NotificationCommands Cleared By Device ServerIncompatible Medium InstalledCannot Read Medium - Unknown FormatCannot Read Medium - Incompatible FormatCleaning Cartridge InstalledCannot Write Medium - Unknown FormatCannot Write Medium - Incompatible FormatCannot Format Medium - Incompatible MediumCleaning FailureCannot Write - Application Code MismatchCurrent Session Not Fixated For AppendCleaning Request RejectedMedium Not FormattedIncompatible Volume TypeIncompatible Volume QualifierCleaning Volume ExpiredMedium Format CorruptedFormat Command FailedZoned Formatting Failed Due To Spare LinkingNo Defect Spare Location AvailableDefect List Update FailureTape Length ErrorEnclosure FailureEnclosure Services FailureUnsupported Enclosure FunctionEnclosure Services UnavailableEnclosure Services Transfer FailureEnclosure Services Transfer RefusedRibbon, Ink, or Toner FailureRounded ParameterEvent Status NotificationESN - Power Management Class EventESN - Media Class EventESN - Device Busy Class EventSaving Parameters Not SupportedMedium Not PresentMedium Not Present - Tray ClosedMedium Not Present - Tray OpenMedium Not Present - LoadableMedium Not Present - Medium Auxiliary Memory AccessibleSequential Positioning ErrorTape Position Error At Beginning-of-MediumTape Position Error At End-of-MediumTape or Electronic Vertical Forms Unit Not ReadySlew FailurePaper JamFailed To Sense Top-Of-FormFailed To Sense Bottom-Of-FormReposition ErrorRead Past End Of MediumRead Past Beginning Of MediumPosition Past End Of MediumPosition Past Beginning Of MediumMedium Destination Element FullMedium Source Element EmptyEnd Of Medium ReachedMedium Magazine Not AccessibleMedium Magazine RemovedMedium Magazine InsertedMedium Magazine LockedMedium Magazine UnlockedMechanical Positioning Or Changer ErrorRead Past End Of User ObjectElement DisabledElement EnabledData Transfer Device RemovedData Transfer Device InsertedInvalid Bits In IDENTIFY MessageLogical Unit Has Not Self-Configured YetLogical Unit FailureTimeout On Logical UnitLogical Unit Failed Self-TestLogical Unit Unable To Update Self-Test LogTarget Operating Conditions Have ChangedMicrocode Has ChangedChanged Operating DefinitionINQUIRY Data Has Changedcomponent Device AttachedDevice Identifier ChangedRedundancy Group Created Or ModifiedRedundancy Group DeletedSpare Created Or ModifiedSpare DeletedVolume Set Created Or ModifiedVolume Set DeletedVolume Set DeassignedVolume Set ReassignedReported LUNs Data Has ChangedEcho Buffer OverwrittenMedium LoadableMedium Auxiliary Memory AccessibleiSCSI IP Address AddediSCSI IP Address RemovediSCSI IP Address ChangedRAM FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)Power-On or Self-Test FAILURE (Should Use 40 NN)Internal Target FailureATA Device Failed Set FeaturesSelect Or Reselect FailureUnsuccessful Soft ResetSCSI Parity ErrorData Phase CRC Error DetectedSCSI Parity Error Detected During ST Data PhaseInformation Unit iuCRC Error DetectedAsynchronous Information Protection Error DetectedProtocol Service CRC ErrorPHY Test Function In ProgressSome Commands Cleared By iSCSI Protocol EventInitiator Detected Error Message ReceivedInvalid Message ErrorCommand Phase ErrorData Phase ErrorInvalid Target Port Transfer Tag ReceivedToo Much Write DataACK/NAK TimeoutNAK ReceivedData Offset ErrorInitiator Response TimeoutConnection LostLogical Unit Failed Self-ConfigurationOverlapped Commands AttemptedWrite Append ErrorWrite Append Position ErrorPosition Error Related To TimingErase FailureErase Failure - Incomplete Erase Operation DetectedCartridge FaultMedia Load or Eject FailedUnload Tape FailureMedium Removal PreventedMedium Removal Prevented By Data Transfer ElementMedium Thread Or Unthread FailureVolume Identifier InvalidVolume Identifier MissingDuplicate Volume IdentifierElement Status UnknownSCSI To Host System Interface FailureSystem Resource FailureSystem Buffer FullInsufficient Reservation ResourcesInsufficient ResourcesInsufficient Registration ResourcesInsufficient Access Control ResourcesAuxiliary Memory Out Of SpaceQuota ErrorMaximum Number Of Supplemental Decryption Keys ExceededMedium Auxiliary Memory Not AccessibleData Currently UnavailableInsufficient Power For OperationUnable To Recover Table-Of-ContentsGeneration Does Not ExistUpdated Block ReadOperator Request or State Change InputOperator Medium Removal RequestedOperator Selected Write ProtectOperator Selected Write PermitLog ExceptionThreshold Condition MetLog Counter At MaximumLog List Codes ExhaustedRPL Status ChangeSpindles SynchronizedSpindles Not SynchronizedFailure Prediction Threshold ExceededMedia Failure Prediction Threshold ExceededLogical Unit Failure Prediction Threshold ExceededSpare Area Exhaustion Prediction Threshold ExceededHardware Impending Failure General Hard Drive FailureHardware Impending Failure Drive Error Rate Too HighHardware Impending Failure Data Error Rate Too HighHardware Impending Failure Seek Error Rate Too HighHardware Impending Failure Too Many Block ReassignsHardware Impending Failure Access Times Too HighHardware Impending Failure Start Unit Times Too HighHardware Impending Failure Channel ParametricsHardware Impending Failure Controller DetectedHardware Impending Failure Throughput PerformanceHardware Impending Failure Seek Time PerformanceHardware Impending Failure Spin-Up Retry CountHardware Impending Failure Drive Calibration Retry CountController Impending Failure General Hard Drive FailureController Impending Failure Drive Error Rate Too HighController Impending Failure Data Error Rate Too HighController Impending Failure Seek Error Rate Too HighController Impending Failure Too Many Block ReassignsController Impending Failure Access Times Too HighController Impending Failure Start Unit Times Too HighController Impending Failure Channel ParametricsController Impending Failure Controller DetectedController Impending Failure Throughput PerformanceController Impending Failure Seek Time PerformanceController Impending Failure Spin-Up Retry CountController Impending Failure Drive Calibration Retry CountData Channel Impending Failure General Hard Drive FailureData Channel Impending Failure Drive Error Rate Too HighData Channel Impending Failure Data Error Rate Too HighData Channel Impending Failure Seek Error Rate Too HighData Channel Impending Failure Too Many Block ReassignsData Channel Impending Failure Access Times Too HighData Channel Impending Failure Start Unit Times Too HighData Channel Impending Failure Channel ParametricsData Channel Impending Failure Controller DetectedData Channel Impending Failure Throughput PerformanceData Channel Impending Failure Seek Time PerformanceData Channel Impending Failure Spin-Up Retry CountData Channel Impending Failure Drive Calibration Retry CountServo Impending Failure General Hard Drive FailureServo Impending Failure Drive Error Rate Too HighServo Impending Failure Data Error Rate Too HighServo Impending Failure Seek Error Rate Too HighServo Impending Failure Too Many Block ReassignsServo Impending Failure Access Times Too HighServo Impending Failure Start Unit Times Too HighServo Impending Failure Channel ParametricsServo Impending Failure Controller DetectedServo Impending Failure Throughput PerformanceServo Impending Failure Seek Time PerformanceServo Impending Failure Spin-Up Retry CountServo Impending Failure Drive Calibration Retry CountSpindle Impending Failure General Hard Drive FailureSpindle Impending Failure Drive Error Rate Too HighSpindle Impending Failure Data Error Rate Too HighSpindle Impending Failure Seek Error Rate Too HighSpindle Impending Failure Too Many Block ReassignsSpindle Impending Failure Access Times Too HighSpindle Impending Failure Start Unit Times Too HighSpindle Impending Failure Channel ParametricsSpindle Impending Failure Controller DetectedSpindle Impending Failure Throughput PerformanceSpindle Impending Failure Seek Time PerformanceSpindle Impending Failure Spin-Up Retry CountSpindle Impending Failure Drive Calibration Retry CountFirmware Impending Failure General Hard Drive FailureFirmware Impending Failure Drive Error Rate Too HighFirmware Impending Failure Data Error Rate Too HighFirmware Impending Failure Seek Error Rate Too HighFirmware Impending Failure Too Many Block ReassignsFirmware Impending Failure Access Times Too HighFirmware Impending Failure Start Unit Times Too HighFirmware Impending Failure Channel ParametricsFirmware Impending Failure Controller DetectedFirmware Impending Failure Throughput PerformanceFirmware Impending Failure Seek Time PerformanceFirmware Impending Failure Spin-Up Retry CountFirmware Impending Failure Drive Calibration Retry CountFailure Prediction Threshold Exceeded (false)Low Power Condition OnIdle Condition Activated By TimerStandby Condition Activated By TimerIdle Condition Activated By CommandStandby Condition Activated By CommandIDLE_B Condition Activated By TimerIDLE_B Condition Activated By CommandIDLE_C Condition Activated By TimerIDLE_C Condition Activated By CommandSTANDBY_Y Condition Activated By TimerSTANDBY_Y Condition Activated By CommandPower State Change To ActivePower State Change To IdlePower State Change To StandbyPower State Change To SleepPower State Change To Device ControlLamp FailureVideo Acquisition ErrorUnable To Acquire VideoOut Of FocusScan Head Positioning ErrorEnd Of User Area Encountered On This TrackPacket Does Not Fit In Available SpaceIllegal Mode For This TrackInvalid Packet SizeVoltage FaultAutomatic Document Feeder Cover UpAutomatic Document Feeder Lift UpDocument Jam In Automatic Document FeederDocument Miss Feed Automatic In Document FeederConfiguration FailureConfiguration Of Incapable Logical Units FailedAdd Logical Unit FailedModification Of Logical Unit FailedExchange Of Logical Unit FailedRemove Of Logical Unit FailedAttachment Of Logical Unit FailedCreation Of Logical Unit FailedAssign Failure OccurredMultiply Assigned Logical UnitSet Target Port Groups Command FailedATA Device Feature Not EnabledLogical Unit Not ConfiguredData Loss On Logical UnitMultiple Logical Unit FailuresParity/Data MismatchInformational, Refer To LogState Change Has OccurredRedundancy Level Got BetterRedundancy Level Got WorseRebuild Failure OccurredRecalculate Failure OccurredCommand To Logical Unit FailedCopy Protection Key Exchange Failure - Authentication FailureCopy Protection Key Exchange Failure - Key Not PresentCopy Protection Key Exchange Failure - Key Not EstablishedRead Of Scrambled Sector Without AuthenticationMedia Region Code Is Mismatched To Logical Unit RegionDrive Region Must Be Permanent/Region Reset Count ErrorDecompression Exception Long Algorithm IDSession Fixation ErrorSession Fixation Error Writing Lead-InSession Fixation Error Writing Lead-OutSession Fixation Error - Incomplete Track In SessionEmpty Or Partially Written Reserved TrackNo More Track Reservations AllowedRMZ Extension Is Not AllowedNo More Test Zone Extensions Are AllowedCD Control ErrorPower Calibration Area ErrorProgram Memory Area Update FailureProgram Memory Area Is FullRMA/PMA Is Almost FullCurrent Power Calibration Area Almost FullCurrent Power Calibration Area Is FullRDZ Is FullSecurity ErrorUnable To Decrypt DataUnencrypted Data Encountered While DecryptingIncorrect Data Encryption KeyCryptographic Integrity Validation FailedError Decrypting DataUnknown Signature Verification KeyEncryption Parameters Not UseableDigital Signature Validation FailureEncryption Mode Mismatch On ReadEncrypted Block Not Raw Read EnabledIncorrect Encryption ParametersUnable To Decrypt Parameter ListEncryption Algorithm DisabledSA Creation Parameter Value InvalidSA Creation Parameter Value RejectedInvalid SA UsageData Encryption Configuration PreventedSA Creation Parameter Not SupportedAuthentication FailedExternal Data Encryption Key Manager Access ErrorExternal Data Encryption Key Manager ErrorExternal Data Encryption Key Not FoundExternal Data Encryption Request Not AuthorizedExternal Data Encryption Control TimeoutExternal Data Encryption Control ErrorLogical Unit Access Not AuthorizedSecurity Conflict In Translated DeviceXS_SHORTSENSE scsibus at %sscsibusprint: qualifier == SID_QUAL_RSVDscsibusprint: qualifier == SID_QUAL_BAD_LUdirectsequentialprinterprocessorcdromwormscanneropticalchangercommunicationenclosure servicessimplified directscsibusprint: device type T_NODEVICEvendor-unique targ %d lun %d: <%s, %s, %s> ATAPISCSI%dremovablefixed %d/%s %s%s naa. eui. t10. serial. wwn._ offline: %d targets, initiator %d, WWPN %016llx, WWNN %016llx%s: unable to register bio scsibusPLEXTORCD-ROM PX-40TS1.01MICROP 1588-15MBSUN0669DEC RZ55 (C) DECEMULEX MD21/S2 ESDIA00IBMRAID 0662SIBM 0663HIBM0664H3171-S2KZ-CDFRSS2FQUANTUM ELS85S iomegajaz 1GBMICROP4421-07SEAGATEST150176LW0002HPC3725SDCASSONY SDT-5000 3.WangDAT Model 1300 02.4Model 2600 01.7Model 3200 02.2CR-2801TE1.07CREATIVECD3630EAC101FX320Sq01GCD-R580B1.00MATSHITA CR-5741.021.06Memorex CRW-26421.0gSANYO CRD-256PSANYO CRD-254PSANYO CRD-S54P1.08CD-ROM CDR-S11.70CD-ROM CDR-N161.25UJDCD87301.14ATAPI CD-ROMSCSI CD-ROMcdNEC CD-ROM DRIVE:260SCSI opticalSCSI disk%s %s(unknown)%s: %lluMB, %lu bytes/sector, %llu sectors, thin, readonlysoftintr_establish: unknown soft IPL %d addr 0x%lx intr %dWARNING: using filesystem date -- CHECK AND RESET THE DATE! pxa2x0_probe_sdram: impossiblepxaip_attach_critical: failed to attach INTC!pxaip_attach_critical: failed to attach GPIO!pxaip_attach: failed to map CLKMANpxaip_attach: failed to map RTC: CPU clock = %d.%03d MHz pxaippxa2x0_io_bs_free(): not implementedpxa2x0_io_bs_alloc(): not implementedcouldn't establish interruptirq %dintr_establish: bogus irq number %dintr_establish: can't malloc handler info: Interrupt Controller stray interrupt %d pxaintcpxagpio_reg_write: not bootstrappedpxagpio_reg_read: not bootstrappedpxa2x0_gpio_set_intr_level: bad level: %d%s: unhandled GPIO interrupt. GPIO#%d %s: failed to hook main GPIO interrupt pxa2x0_gpio_intr_establish: Pin %d not GPIO_IN: GPIO Controller %s: Can't map registers! pxagpioclock%s: Cannot map registerspxaostendpoint %d already used by %cfifo full when trying to set short packet pxaudc_read_epN: ep %d, no xfer ep%d: fifo error : cannot map mem space : USB Device Controller : unable to establish interrupt usbc: unable to establish connect interrupt pxaudc%s: init failed, error=%d %s: Unknown depth (%d) : failed to map registers %d%s: unable to establish interrupt at irq %d%s: battery life expectancy %d%% %s: AC off,on,backup power,unknown, battery is highCRITICALchargingundecoded (%x)bogus new frequency 0 for rate %d maxclock %d pxa2x0_apm_sleep: can't map OST pxa2x0_apm_attach_sub: failed to map POWMAN apmlk%s: failed to map CLKMAN %s: failed to map MEMCTL %s: can't map GPIO %s: failed to create kernel thread, disabledapmevapmpcmcia_function_enable: function not initializedpcmcia_function_init: function is enabled, (manufacturer 0x%x%sproduct 0x%x function %d "%s: error %d detaching %s (function %d) pcmcia_card_attachpcmciapcmcia_parse_cis_tuple%s: CIS version PCMCIA 1.0 PCMCIA 2.0 or 2.1 PC Card Standard %d.%d unknown (major=%d, minor=%d) %s: CIS info: %s: Manufacturer code 0x%x, product 0x%x %s: function %d: unspecifiedmulti-functionserial portparallel portfixed diskvideo adapternetwork adapterauto incrementing mass storageSCSI bridgeSecurity servicesInstrumentSerial I/O Bus Adapterunknown (%d), ccr addr %lx mask %lx %s: function %d, config table entry %d: memory cardI/O cardcard type unknown; irq mask %x; iomask %lx, iospace %lx%s%lx; memspace@ %lx%s%lx%s%lx; maxtwins %d; mwait_required rdybsy_active wp_active bvd_active io8 io16 irqshare irqpulse irqlevel powerdown readonly audio%s: %d errors found while parsing CIS %s: CIS checksum failed %s: using CIS quirks for SVECFD605 PCMCIA EtherNet CardV1-1%s: can't alloc mem for LAN iobase %s: can't map mem for LAN iobase %s: can't alloc mem for enet addr %s: can't map mem for enet addr : unexpected I/O space configuration : can't get subregion for asic : function enable failed : can't map NIC I/O space : can't map ASIC I/O space port 0x%lx/%d: can't match ethernet vendor code , %s: no suitable config entry AmbiCom IncAMB8002TPMX PE-200DIGITALDEPCM-XXPCMCIAUE2212D-LinkDE-660DE-660+RPTI LTD.EP400CISV100RPTIEP401 Ethernet NE2000 CompatibleACCTONEN2212ETHERNETW89C926Seiko Epson Corp.P/N: EEN10B Rev. 00CNetCN40BC EthernetNE2000FastEthernetLNT-10TNNDC004743118001TAMARACKGVCNIC-2000pR01Ethernet CardiPort10/100 Ethernet CardFast-EthernetETHER-C16Fast EthernetPCMCIA LANCF10Base-EthernetLinksysEtherFast 10/100 Integrated PC Card (PCM100)Ver 1.0DE-650I-O DATAPCET/TX-RDFE-670TXDLINKSYSE-CARDPCLAcorega K.K.corega Ether PCC-Tcorega Ether PCC-TDcorega EtherII PCC-Tcorega EtherII PCC-TDcorega FastEther PCC-TXcoregaFEther PCC-TXFcorega FEther PCC-TXDSMC8041TX-10/100-PC-Card-V2XircomCompactCard EthernetCFE-10: can't map first i/o space : can't map second i/o space port 0x%lx/%lu,0x%lx/%lucannot allocate channel queue : %s: can't handle card info Digital Mobile Media CD-ROMPortable CD-ROM DriveNinjaATA-EXP PnPIDEF1SHUTTLE TECHNOLOGY LTD.PCCARD-IDE/ATAPI Adapterwipwr: can't alloc i/o space : can't map i/o space %s: can't establish interrupt %s%s Wireless LAN PCC-11Wireless LAN PCCA-11corega_K.K.Wireless_LAN_PCCB-11WL PCCL-11ISL37300PWLCFL-11INTERSILHFA384x/IEEEVersion 01.02SMC2632WNANOSPEEDNECWireless Card CMZ-RT-WPVersion 01.01NTT-ME11Mbps Wireless LAN PC CardAddtronAWP-100 Wireless PCMCIACabletronRoamAbout 802.11 DSIntersilPRISM 2_5 PCMCIA ADAPTEREval-RevASymbol TechnologiesLA4111 Spectrum24 Wireless LAN PC CardPLANEXGW-NS11H Wireless LAN PC CardD-Link CorporationD-Link DWL-650H 11Mbps WLAN AdapterAllied Telesis K.K.WR211PCMpxapcic_mem_map: bogus kindpcic_attach_card: already attachedpxapcicevpxapcicss%s-%d%s: unable to create event thread for %s : %d slot%s pxapcicmmclk%s: data not a multiple of %d bytes mmcmd%s: unsupported bus frequency of %d KHz : can't map regs mmccd: can't establish card interrupt : can't establish MMC interrupt : MMC/SD/SDIO controller sdmmc%s: can't attach bus pxammclcdzkbdwd0: failed to map %s : PCMCIA/GPIO controller scoopscoop_pcic_set_power: bogus power statescoop_pcic_write: bogus registerscoop_pcic_read: bogus register%s: invalid CF slot %d%s: can't map memory %lx for scoopscoop_mmc_set_power: unsupported OCR (%#x) zssp_read_ads7846: not configured zssp_ic_send: invalid IC %d : can't map bus space zsspapm_acapm_bczts%s: standby command didn't complete %s: standby command timeout %s: standby command: drive fault %s: flush cache command didn't complete %s: flush cache command timeout %s: flush cache command: drive fault ST506wd_get_params: bad return code from ata_get_paramswddump: try againwddump: polled command has been queuedwddump: device timed outwddump: drive faultwddump: DMA errorwddump: %swddump: unknown error typeST506/MFM/RLLESDI/IDE disk__wdstart: bad return code from wdc_ata_bio()device faultdevice timeout, retrying %s: soft error (corrected) %s: IDENTIFY failed : <%s> %s: %d-sector PIO, LBA48, %lluMB, %llu sectors LBA, %lluMB, %llu sectors CHS, %lluMB, %d cyl, %d head, %d sec, %llu sectors %s: enable look ahead command didn't complete %s: enable write cache command didn't complete %s: freeze lock command didn't complete %s:%d:%d: bad state %d in _wdc_ata_bio_start _wdc_ata_bio_start: bad state%s:%d:%d: timeout waiting for DRQ, st=0x%b, err=0x%02x BSYDRDYDWFDSCDRQCORRIDXERR%s:%d:%d: not ready, st=0x%b, err=0x%02x wdc_ata_ctrl_intr: state==RECALpiomodedmamodegeometrysetmultirecal%s:%d:%d: %s timed out %s:%d:%d: %s drive fault error (%x) %s:%d:%d: bad state %d in wdc_ata_bio_intr wdc_ata_bio_intr: bad state%s:%d:%d: device timeout, c_bcount=%d, c_skip%d %s:%d:%d: intr with DRQ (st=0x%b) %s:%d:%d: read intr before drq error not notifiedno media/write protectedaborted commandmedia change requestedid not foundmedia changeduncorrectable data errorinterface CRC erroraddress mark not foundtrack 0 not foundbad block detectedwd0aboot device: lookup '%s' failed. boot device: %s wswaitwswait2wsdisplay at %s%s: screen %d-%d added (%s, %s emulation) wsdisplay_switch2: not switching wsdisplay_switch2: invalid screen %dwsdisplay_switch2: screen %d disappeared wsdisplay_switch2: giving up wsdisplay_switch1: not switching wsdisplay_switch1: invalid screen %dwsdisplay_switch1: screen %d disappeared wsrestorewsdisplaytty() on ctl device%s: screen %d deleted dmuxwsdisplay_common_attach: no memory mux %d: console (%s, %s emulation), using %swsdisplaywsevent_read%s: connecting to %s %s: disconnecting from %s wskbd at %s%s: can't attach mux (error=%d) %s: event queue overflow wskdetwskbd_detach: %s didn't detach cannot load keymap %s: cannot load keymap, falling back to default %s: console keyboard%s: attach error=%d wskbdwskbd_get_mapentry: %d(%d): bad entrywskbd_load_keymap: %d: recursion too deepwskbd_load_keymap: %d(%d): bad entrywsmouse at %s attach error=%dwsmouse_set_param: invalid parameter type wsmdetwsmouse_detach: %s didn't detach wsmousewsmux_getmux: no memory for mux %d wsmux: attach out of memory wsemul_vt100_output_c0c1: ESC in kernel output ignored [>24;20;0cP2$u\P0!u%5\[?62;6c[%d;%dR[?13n[?21n[?27;1nOIOMOjOkOlOmOnOo[28~[29~[1~[2~[3~[4~[5~[6~[7~[8~OAOBODOC[11~[12~[13~[14~[15~[17~[18~[19~[20~[21~[23~[24~[25~[26~[31~[32~[33~[34~[35~[36~[37~[38~OPOQOROSOpOqOrOsOtOuOvOwOxOyrasops_init: fontwidth assumptions botched!rasops_init: font table is empty rasops_init: couldn't lock font fontwidth not 8/12/16 or RASOPS_SMALL - fixme!wsfont_unlock: font not lockedno usable key codes array%s: was console keyboard usb at %sendtaskusbatskusbtskunable to create usb abort task threadusbtaskunable to create usb task thread%s: root hub problem %s: root device is not a hub usbpalock: USB revision %s, not supported %s: can't register softintr pre 1.01.12.03.0usbusbd_desc_iter_next: bad descriptor usbd_desc_iter_next: descriptor length = 0 usbd_desc_iter_next: descriptor length too large usbd_start_next: error=%d usbd_transfer: not doneusbsynusbrefusbdetusb_detach_wait: %s didn't detach out of dataiface desc0 lengthusbd_fill_iface_data: bad descriptor(s): %s usbdly%s: device addr %d (config %d) exceeds power budget, %d mA > %d mA %s: port %d, set config %d at addr %d failed %x.%02xvendor 0x%04xproduct 0x%04x"%s %s", class %d/%d rev addr %d port %d configuration %d interface %d%s: No free USB addresses, new device ignored. usbd_new_device: cannot find HS portNORMAL_COMPLETIONIN_PROGRESSPENDING_REQUESTSNOT_STARTEDINVALNOMEMCANCELLEDBAD_ADDRESSIN_USENO_ADDRSET_ADDR_FAILEDNO_POWERTOO_DEEPIOERRORNOT_CONFIGUREDTIMEOUTSHORT_XFERSTALLEDINTERRUPTEDXXX%s: connected port %d has no power %s: port %d reset failed %s: device problem, disabling port %d %s: illegal enable change, port %d %s: port error, restarting port %d %s: port error, giving up port %d %s: hub depth (%d) exceeded, hub ignored %s: unable to set HUB depth %s: no ports, hub ignored %s: bus powered hub connected to bus powered hub, ignored %s: no interface handle %s: no endpoint descriptor %s: bad interrupt endpoint %s: cannot open interrupt pipe %s: port %d power on failed, %s uhubuhidev_intr: bad repid %d uhid at %s reportid %d%s: could not read endpoint descriptor %s: unexpected endpoint %s: no input interrupt endpoint %s: no HID descriptor %s: no memory %s: no report descriptor %s: iclass %d/%d, %d report id%suhidevuhidrea: input=%d, output=%d, feature=%d uhidukbd%s: got polled xfer %p, but %p already pending %s: CBI bulk-in/out stall clear failed, %s %s: CBI intr-in stall clear failed, %s %s: CBI reset failed, %s %s: CBI bulk-in stall clear failed, %s %s: CBI bulk-out stall clear failed, %s %s: Unknown state %d%s: Invalid CSW: sig 0x%08x should be 0x%08x %s: Invalid CSW: tag %d should be %d %s: Invalid CSW: status %d > %d %s: Phase Error, residue = %d %s: transferred %d bytes instead of %d bytesBulk-OnlyCBICBI with CCIISD-ATARBCSCSIUFI%s: using %s over %s %s: isdata not configured %s: command protocol=0x%x not supported %s: bus attach failed umass%s: Unknown status %d in umass_scsi_cbumass_cmd: large datalen, %d %04x%04x%s%s: open rx pipe failed: %s %s: open tx pipe failed: %s %s: open intr pipe failed: %s %s: aue_send error=%s %s: usb error on tx: %s %s: watchdog timeout %s: %u usb errors on intr: %s %s: no memory for rx list -- packet dropped! %s: %u usb errors on rx: %s %s: reset failed %s: close rx pipe failed: %s %s: close tx pipe failed: %s %s: close intr pipe failed: %s %s: tx list init failed %s: rx list init failed %s: MII read timed out %s: EEPROM read timed out auemii%s: couldn't get endpoint descriptor %d %s: missing endpoint %s: address %s aue%s: usb errors on rx: %s axe%d: close rx pipe failed: %s axe%d: close tx pipe failed: %s axe%d: close intr pipe failed: %s axe%d: usb error on tx: %s axe%d: watchdog timeout axe%d: rx list init failed axe%d: tx list init failed axe%d: open rx pipe failed: %s axe%d: open tx pipe failed: %s %s: media change failed axe%d: write PHY failed axe%d: read PHY failed axemii%s: couldn't get ep %d no valid PHY address found, assuming PHY address 0 AX88178 AX88772B AX88772 AX88172axerxeof: too large transfer invalid buffer(pkt#%d), continue checksum err (pkt#%d) axen%d: write PHY failed axen%d: read PHY failed enable auto detach (0x%04x) unknown uplink bus:0x%02x axenmii%s: not supported usb bus type AX88178a AX88179axen%d: close rx pipe failed: %s axen%d: close tx pipe failed: %s axen%d: close intr pipe failed: %s axen%d: usb error on tx: %s axen%d: watchdog timeout axen%d: rx list init failed axen%d: tx list init failed axen%d: open rx pipe failed: %s axen%d: open tx pipe failed: %s axen%s: warning: Failed to write register 0x%0x %s: warning: Failed to read register 0x%0x %s: warning: failed to read SMSC_COE_CTRL (err=%d) %s: warning: failed to write SMSC_COE_CTRL (err=%d) %s: warning: failed to read initial AFC_CFG, error %d %s: warning: media change failed, error %d %s: warning: timed-out waiting for reset to complete %s: warning: timed-out waiting for phy reset to complete %s: warning: failed to set the MAC address %s: warning: failed to read HW_CFG: %d %s: warning: failed to read HW_CFG: (err = %d) %s: warning: failed to read ID_REV (err = %d) %s: warning: failed to read MAC_CSR (err=%d) %s: error: smsc_chip_init failed (err=%d) smscmii%s: warning: MII is busy %s: warning: MII write timeout %s: warning: MII read timeout smsc%s: cue_send error=%s %s: read MAC address failed %s: setting config no failed %s: getting interface handle failed cue%s: kue_send error=%s %s: warm boot, no firmware download kue%s: failed loadfirmware of file %s: errno %d %s: cold boot, downloading firmware %s: failed to load code segment: %s %s: failed to load fixup segment: %s %s: failed to load trigger segment: %s %s: loading firmware failed %s: could not read Ethernet descriptor %s: no memory for multicast filter buffer %s: usb error on rx: %s %s: too many errors, disabling %s: open interrupt pipe failed: %s %s: close interrupt pipe failed: %s %s: extra ethernet descriptor %s: no data interface %s: no descriptor for interrupt endpoint %d %s: interface alternate setting %d failed %s: no descriptor for bulk endpoint %d %s: could not find data bulk in %s: could not find data bulk out cdce%s: udav_send error=%s udavmiiudav%s: upl_send error=%s upl%s: ugl_send error=%s %s: bad header (length=%d) %s: bad packet count (%d) %s: bad packet size(%d), length=%d ugl%s: url_send error=%s %s: %s: bad register %04x urlmii%s: failed to get interface, err=%s %s: couldn't get endpoint %d url%s: reset never completed %s timeout waiting for OOB control %s: timeout waiting for OOB control uremiiver 4c00ver 4c01, unknown ver %02xwiusbthrwitxlwiIDLwi_usb: received USB_BUFAVAIL packet wi_usb: received USB_ERROR packet %s: %s error=%s wiTXsyncUGH TX UGH RX write_record buf size err %x %x invalid packet len: %x memsz %x max %x %s: %s: error=%s %s:%s: invalid packet id sent %x %s: already detached %s: open pipes failed wi_usbRT5222RT2522RT2523RT2524RT2525RT2525eRT2526%s: could not retrieve Tx statistics - cancelling automatic rate control %s: could not write MAC register: %s %s: could not read MAC register: %s %s: could not write to RF %s: could not read BBP %s: could not write to BBP %s: timeout waiting for BBP %s: could not read EEPROM: %s %s: could not allocate protection frame %s: could not transmit buffer: %s %s: could not allocate rx mbuf %s: could not allocate rx mbuf cluster %s: could not allocate rx xfer %s: could not allocate rx buffer %s: could not allocate tx xfer %s: could not allocate tx buffer %s: timeout waiting for BBP/RF to wakeup %s: could not allocate AMRR xfer %s: could not open Tx pipe: %s %s: could not open Rx pipe: %s %s: could not allocate Tx list %s: could not allocate Rx list %s: could not queue Rx transfer %s: could not set configuration no %s: could not get interface handle %s: no endpoint descriptor for iface %d %s: MAC/BBP RT%04x (rev 0x%02x), RF %s, address %s uralset config activated %s: can't create task thread %s: can't establish softintr %s: usbf_new_device failed, %s usbf%s %s, rev %d.%02d/%d.%02dusbf_start_next: %s encap error cdcef_do_request %s: usbf_transfer failed OpenBSD.orgCDC Ethernet Emulation: usbf_add_config failed : usbf_add_interface failed : usbf_add_endpoint failed : usbf_add_config_desc failed : usbf_end_config failed : usbf_alloc_buffer failed : usbf_open_pipe failed : usbf_transfer failed : address %s cdcefOUI 0x%06x model 0x%04x rev %d at %s phy %dmii_detach: phyloc and offloc specifiedmii_attach: phyloc and offloc specifiedmiiautmii_phy_setmedia: MASTER on wrong media: %s, rev. %d nsphyDP83840 10/100 PHYnsphyterDP83815 10/100 PHYDP83843 10/100 PHYDP83847 10/100 PHYqsphyQS6612 10/100 PHYinphyi82555 10/100 PHYi82562EM 10/100 PHYi82562ET 10/100 PHYi82562G 10/100 PHYiophyi82553 10/100 PHYeephy88E1000 1 Gigabit PHY88E1000 2 Gigabit PHY88E1000 3 Gigabit PHY88E1000 4 Gigabit PHY88E1000S Gigabit PHY88E1011 Gigabit PHY88E1111 Gigabit PHY88E1112 Gigabit PHY88E1116 Gigabit PHY88E1116R Gigabit PHY88E1118 Gigabit PHY88E1149 Gigabit PHY88E3016 10/100 PHY88E3082 10/100 PHYPHYG65G Gigabit PHY88E1000 5 Gigabit PHY88E1000 6 Gigabit PHY88E1000 7 Gigabit PHYexphy_service: can't isolate 3Com PHY: 3Com internal media interface %s: ignoring this PHY, non-zero instance xlexphyrlrlphy_service: attempt to isolate phy: RTL internal PHY rlphyRTL8201L 10/100 PHYRTL8201E 10/100 PHYIP101 10/100 PHYlxtphyLXT970 10/100 PHYLXT971 10/100 PHYmtdphyMTD972 10/100 PHYicsphyICS1890 10/100 PHYICS1892 10/100 PHYICS1893 10/100 PHYsqphy80220 10/100 PHY80225 10/100 PHY84220 10/100 PHYtqphy78Q2120 10/100 PHY: Generic IEEE 802.3u media interface, rev. %d: OUI 0x%06x, model 0x%04x %s: no media present ukphybmtphy3C905B internal PHY3C905C internal PHYBCM4401 10/100baseTX PHYBCM5201 10/100 PHYBCM5214 Quad 10/100 PHYBCM5220 10/100 PHYBCM5221 100baseTX PHYBCM5222 Dual 10/100 PHYamphyAm79C873 10/100 PHYDM9101 10/100 PHYDM9102 10/100 PHYDM9601 10/100 PHYAm79C875 quad PHYacphyAC101 10/100 PHYAC101L 10/100 PHYAC_UNKNOWN 10/100 PHYnsgphyDP83861 10/100/1000 PHYDP83865 10/100/1000 PHYDP83891 10/100/1000 PHY%s: %s: enter down%s: %s: link %s : RTL internal phy urlphyrgephyRTL8169S/8110S/8211 PHYRTL8251 PHYmmcdiemmcdly%s: i/o init failed %s: mem init failed %s: can't identify card %s: can't supply bus power %s: can't supply clock %s: can't enable card %s: no functions mmctsk: 8-bit: 4-bit: 1-bit, sd high-speed, mmc high-speed, dma%s: can't create DMA map SpectecSDIO WLAN CardSDW-820%s: CIS version %d.%d SDIO%s: bad CIS ptr %#x %s: CIS parse error at %d, tuple code %#x, length %d %s: bad CISTPL_FUNCID length %s: bad CISTPL_MANFID length %s: CISTPL_VERS_1 too short %s(%sat %s%s: can't read CIS %s: can't set I/O RCA %s: can't select I/O RCA %d %s: can't supply voltage requested by card %s: can't send I/O OCR %s: can't read EXT_CSD %s: unknown CARD_TYPE 0x%x %s: can't change high speed %s: can't change bus clock %s: can't re-read EXT_CSD %s, HS_TIMING set failed %s: can't switch to DDR %s: can't switch signalling voltage %s: SD_SEND_SCR send failed %s: can't change bus width %s: switch func mode 0 failed %s: switch func mode 1 failed: group 1 function %d(0x%2x) %s: unknown MMC version %d %s: unknown SD CSD structure version 0x%x %s: unknown MMC CSD structure version 0x%x %s: can't set mem RCA SandiskToshibaMicronSamsungKingstonSD/MMC%04X%s: can't allocate ccbs %s: can't attach scsibus (Pjd'({^~: Ȅ9Є99Ԅ9܄99999 999 9(9:,9<9H9P9X9`9l9 /10-)('&K% !$" 64;; ;;NcNc ;; Oc Oc ;;ococ ;;ococ$ ;;ocpc$ ;;pc0pc ;;8qcLqc ;;`qctqc ;;qcqc ;;qc;, ;;qc;< ;;qc;L ;;rc\; ;;xucduc$ ;; zc ;$ ;; zcl ;$ ;; zc ;$ ;; {c{c ;;{c{c ;;<|cP|c ;;<|cP|c ;;h|czc ;;|ch{c ;;|c|c ;;|c0sc ;;}c}c ;;4}cH}c$ ;;}c}c\ ;;<~c(~c\ ;;ccd ;;J9c ;;N9c ;;N9c ;;N9c ;;N9cX ;;+j9HcX ;;+4k9\c ;;r9c ;;s9c ;; t9c ;;4t9Ģc ;;t9c ;;Hu9c ;;u9 c ;;y9 c ;;4z9q R%KrI\ y(#i&, ;= , g/WzoohnB}\<T)rųc8Aŋ;xnAGbj:Ck/FafgMup=98PPO{4߀o'y/ bFǫ}Pv5pB6(<rDI}MxzZEtzVQ}ƒmaqOe@7T\X]Cъa:}N_)!b2[p z.y ~*X6ix6ÌHZ82vc[.\y!hf tS;/dw{h.~;@}$u^KFw9fN.X TCʂaM[BEd faجPQσHhXH̹)Dx}'b+p-"&Rp?oHS / }.Xn-;-Js Mq .@.. export VNAME=$(sysctl -n kern.osrelease) export VERSION="${VNAME%.*}${VNAME#*.}" export ARCH=$(sysctl -n hw.machine) export OBSD="OpenBSD/$ARCH $VNAME" export PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ umask 022 set -o emacs rootdisk=$(dmesg | sed -E '/^root on ([^ ]+) .*$/h;$!d;g;s//\1/') if [[ -z $DONEPROFILE ]]; then DONEPROFILE=YES mount -u /dev/${rootdisk:-rd0a} / echo ! : >/etc/rc echo 'erase ^?, werase ^W, kill ^U, intr ^C, status ^T' stty newcrt werase ^W intr ^C kill ^U erase ^? status ^T cat <<__EOT Welcome to the $OBSD installation program. __EOT timeout=false timer_pid= if [[ ! -f /tmp/noai ]] && { ifconfig netboot >/dev/null 2>&1 || [[ -f /auto_install.conf ]] || [[ -f /auto_upgrade.conf ]]; }; then echo "Starting non-interactive mode in 5 seconds..." >/tmp/noai trap 'kill $timeout_pid 2>/dev/null' EXIT trap 'exit 1' INT trap 'timeout=true' TERM set +m exec 3<&1 4<&2 >/dev/null 2>&1 (sleep 5; kill $$) & timer_pid=$! exec 1<&3 2<&4 3<&- 4<&- set +m fi while :; do echo -n '(I)nstall, (U)pgrade, (A)utoinstall or (S)hell? ' read REPLY if $timeout; then timeout=false echo REPLY=a else [[ -n $timer_pid ]] && kill $timer_pid 2>/dev/null timer_pid= fi case $REPLY in [aA]*) /autoinstall && break ;; [iI]*) /install && break ;; [uU]*) /upgrade && break ;; [sS]*) break ;; !) echo "Type 'exit' to return to install." ksh ;; !*) eval "${REPLY#?}" ;; esac done fi  . .. bin dev@ etc mntmnt2;Bsbin'X tmp usrvarinstbin.profile install.md install.sub autoinstall  install  upgrade MDXDM=y md_installboot() { } md_prep_fdisk() { local _disk=$1 _q _d while :; do _d=whole if disk_has $_disk mbr; then fdisk $_disk if disk_has $_disk mbr openbsd; then _q=", use the (O)penBSD area" _d=OpenBSD fi else echo "MBR has invalid signature; not showing it." fi ask "Use (W)hole disk$_q or (E)dit the MBR?" "$_d" case $resp in [wW]*) echo -n "Setting OpenBSD MBR partition to whole $_disk..." fdisk -iy $_disk >/dev/null echo "done." return ;; [eE]*) cat <<__EOT You will now create a single MBR partition to contain your OpenBSD data. This partition must have an id of 'A6'; must *NOT* overlap other partitions; and must be marked as the only active partition. Inside the fdisk command, the 'manual' command describes all the fdisk commands in detail. $(fdisk ${_disk}) __EOT fdisk -e ${_disk} disk_has $_disk mbr openbsd && return echo No OpenBSD partition in MBR, try again. ;; [oO]*) [[ $_d == OpenBSD ]] || continue return ;; esac done } md_prep_disklabel() { local _disk=$1 _f=/tmp/fstab.$1 md_prep_fdisk $_disk disklabel_autolayout $_disk $_f || return [[ -s $_f ]] && return disklabel -F $_f -E $_disk } md_congrats() { val=`ztsscale` case $? in 0) echo grep -v '^mouse\.scale.*$' /mnt/etc/wsconsctl.conf \ >/tmp/wsconsctl.conf 2>/dev/null echo $val "# see ztsscale(8)" >> /tmp/wsconsctl.conf cp /tmp/wsconsctl.conf /mnt/etc/wsconsctl.conf ;; esac } md_consoleinfo() { local _u _d=com for _u in $(scan_dmesg "/^$_d\([0-9]\) .*/s//\1/p"); do if [[ $_d$_u == $CONSOLE || -z $CONSOLE ]]; then CDEV=$_d$_u CPROM=com$_u CTTY=tty0$_u return fi done } ELFa(4`"4 (((FxQTTTۣeOpenBSD -L_0! MP@ p-LM@` P MЍ/ 0-dL`M 0 R0   1S0B@Ct1P0 @D03/t0 -404 0LM R @2/ R  , , 0MS Ѝ/00Ѝ0 -x@LMp @0S``00T0H 0S 800S 3/$0h\|,d p-LM A0P `P dp6P @POU8 z (4'PP z~^q -LMPP`p 0S h0Q @Q  P 0 i^ p-PLM@P`D 0ph-0 M  Ѝ aMЍN0/,`0/d` -"L<M̂0r"`8K01P@I =u P  P0Sp ]KdŸ \08@ / P8  0` (8 000P  10S000 B  z1 0S0 S"K10S 1!0!0S !l 7000@1@1@0,10S0(!1 P R `@T00SRT!0$0S 0S  0v$0S 0Sl 1J(K,` `(`d`xx (D``xd( -TL@ PD 05 4 P 050  J(`$  -LM K `᝙p@Pq1 味 0Sc bR KR MR% GRkR gR=mR wR8+ $+UKTH0@P%$+U?T<@P%$+U5T2U![RE-Q*0 0 !$/U"T0 0 @P 0xS S`p *S d1#pU T 00 ,J00" d `L58 -Lp0 $,` -Lg0 $d` 0-LM-P @PT @Km9p@~0"SD1 <0S? bR KR MR GRkR gR  mR wR $T0@ '%T$@%T ER00 !T00 @0xS S0 *ST0$0 I00" =d `L58 -0L00(`d` -0L0~0(`,` -Lu0( -Lm P00` -Lb0` -LZ 00d`,` -LM$`K✠p圀&奂 @PK P @Q` 0 D $I 0R00 (0S(``Tl0 R0 /,`d` -L IL5 -L HL5 -L HL5 -L HL5 0-t0LP d0  a0R00BAq 8@0P 0R0 08 0`,`d` -X1P``DqDL  ~PP   1 K0S  庱P00OU0@0V 0000 00 0U0 0 0 0S00mw0  d|He0 f` R*R b0 00d``L5$` 0-LMPKP  \h0: S D4 K@fP0: S S000K0L5m @ -PELP<50  PE 50S0x DP4000 T0$ 4P 0 4$0000ShTTD`$t4 0S 0@PH8d0S 0P 0P밣S $0    $0 dp l0; S 0 @c$ #"0\c`V PGD@Y8Y0,#0sz3Q 0St*0  Q  bP b #0  兰6=0  0 \(=0 0 0 0  P0 0 0 0000000 0 00 00r` 0 B000Q Q@0A AP0 00H1ؐ8q @00Cs0}1 1R1R 0R00 p R R *t bQ 4 00(00S !ㅽ,`<($d`P(`X`hx`hP`L5``( -d2LuM0Pb4K4K 0( P,04 0  bR, 0@=94 0 =,0 4K 1@,P 0 0!MyOKP PP0!dPPT@ x P R T1TRMKd0㐳^ -LM(`K@|p&PC Q -Q1@1@P@T4v0P@, p-LM`PP 0S @@@P , 0P @ B@Mp0 0-<@PL 0S @0S0 -PPL 0S<nS0oSP  0@ @,x`P 㐮X0P@Dtp`Pp`,aP$@ 0-d0P@LT0{P<00s300S @00S0 -0PLM` ū PKp%`  T<`p`3u$@0v03T0S -LMp$K0$`PP P U@oP@ -L0MP`O(80S NOZ P dA(t 0T;(@8 0DSH ((((.(ppX 0SpW   (0@PT 0S0D'7p 7W0(lW0S N@K4Kl 4 00 0`60K'TP1D' @7 W@ T'P fP pW  6Qp& 6W'1 p6|W&l T60S p\6WD|&@'1@ p06WL&'1 p6W$&'1 p5W%'50S1 S 5pW%1'`50S1 S `5pWH%1s' 50S1 S 5pWLP%1c'40S1 S 4pW %1S'40S1 S 4pW$1C'`40S1S `4pWH$13' 40S1S 4pWL`$1#'30S 3pW8$1'!$$'!'!bP4K,KEEph3P4W`C@ 0#P&PG0S1S2S 3pWpßlh#1P&20S"H3R 2pW0,#2&2 p|2Wh`#&2 pP2W<4"&2| p$2W" &sLP1 p1Wt"&1 p1WL"&1U p1xW," 'PI0S1S1S 81pW!1Pf&00S!1R 1 p:W#:!S&00S!1  0pWP 1B&\00S!1  X0pW@ !11&1W,&(KL58!h Ld4tp|x(xy4@\HX`@C<l|t|A <PSd -)MLMh KA A`P@BP+ #T@U0SSP@NK@D @D`poP \$P;H`60S3 _KqP /K Z rP!K  kpP20S @K_K%Z \P %Ÿ 0 %@ :PP\!@(K@! <0~K, h pG0 pGq2, A0S ^%@Y%@,0T }Q]p@ P ).OeNK@Dxa @D0p! @ab0S @ .0SW0S {.I \Z0K 㬤Pm.b00#4 P KA AgQX00S NK@D @D_K4qPA(Kp  L5@q D -AMLM`P-Up <B^KPEPPE) \P@, C 0  pP@h@P 6P\ ,0@t00,000,0 ,0$'h@P :h@P6h@P PAP <P 7P 7H! 0 0  0`10S @0P<P@ 0@@u`0V0X0S ZP堨PP 0 K P@ 0P Tpu0S;ᱧpL@lglt t\\8p@4 dį( MЍ -L E!^ -L0GM@K0$D1 K 0C 0C8 J6\\lgpg!!p,H"$"!\" -LM@pPg o`P 0S nS0oS` =(PP00 @ʑP @Q  0U0P P00 00 X 0000X  5U 0 00 ,K, ?R0S@pq0"S4 05@P,Hd -LMp`XP@( P(K,KÞ  0mP(0SQ$KMЍ -$0L0S 3^l"" -0Lp0p3 P``0PP @@ kP sP aP @h@ P CdpL00S <0U8 0! a"""\\" "MЍ -L"MЍk0@-XP @0 S S 00 ӑR\00 \00N- 0S Br Q-0L(  Q: 5$$ -LMP`pᗪ $K}$@ᐪ0S 0S $00TS#T 04% -0L u a^% -kMLMDQp4) B0@3S00Xt@`L>  @> 1 0> PP P " =gh? X?`PU@ 0!0T ePP U0U0T0S| L4 ?`@?PT >@u<=.5,=b(= .=[ ='= < << <<<.<@ <<. <6<-P  XpZ x6 0<Vv & 6 @ r *0D0 & n&F0G@$f6@C#&R 3R:Z6XV2 ?R|2L@LG6vC#00W #*Y/ L0S 2嬆X H0XL  Lp2Q &R@FH RD2TH@ (2R R H 2R T@F|0S~ Z P3T@1|@ w4&dTP&d&p&&&&L&HnD@&&<X&8*44*0& ,'( 'x* 0'D'lg$4\\T'\'p''"''edA''4(L(l((*(()4)`)))))*(*D*p**** +<+ p+++++++,,$,4y,,0,8,PT,\,d\d,`L5p,S35e: Z t0S<t0 @t@y0 S9Z:;Dn*16 v00 倀X㐆 '0 Z|D! H!Z"x0 Z6 Ԁ Z|6`pF0Av0 Y% `F6c# X0R@Q Z T0S#%*T|0匆Yx 0@1X TP`S@0!p0S0a @*  ("!0㟌 Zp2 2Z2P2: Z 2Z0G0 Y`x0 @!T  &XbT@ 0qPs@UP!T*D^ Z0 Z0:U * Z Zʠ 0/ Z3 3Z2U ZS 3ZRP0H #X0 ^0R 00U, Tl0S\0S00l0 Z0X P0 \00 S0X0 p ZT0xh0 0T0  |0tQ pQ lhQ d` \0XQ h0SP TL U E P H Q G@5`VDK)D0K8K80 4@ #pPP h g>KR0C6 |T x0"& A c% Z``0S00S H0S &R X :@X  0ᛰ &@4&0ST#3* p&\'0P &0' ~X ZH 6R X0 # 00V0|$!40x00t!40p!4 0l0 0h!4 0 d!40 `!40\0#̠##0X0###Ƞ0 T $0""Ƞ"$ P @""̠"  L!$ H!$ )0 `<00SH80 @0 <D0v> $ 0@0 (  4 (08Q 0( 10S 00 o0)0 9Q @(T U01U01hL0HS X R 0XU0 RaAr1U0!1!!!!!!!C| X030#X0#S hbQTPl0 0 Z0S0 00 V00R:&Xx:Q (0 0 520#$ 00 0 P B240#$ 0 p, ٖ0P , 0- Z600X:T+>(KMЍ  -LM04PKpa@d 04 `&PD 0`PG p00@Th\P`uU<UP 0(0' 0FS(K iP@ G\(00S x?\00(@ ^U 0(P?P@ -P 0(0 0$K0,-H4l4t4|44 P-L --*-45P5 -LMp0 :)P0 000K0,K00 g {fPPe 0Sb =@Pp `cVXPC,00IiV4P,00@ P2  g,0$04lVP$,0 0*oVP,00! P H,0(00SP0, 0  @T@Q0Su00S(K-h5l5t5|5hP555, 0-LMP 0XP@00  08S @8T@4 0h5,55$ 0 0~0 +00C -0000$ /0 0~0+00-0/0S $::  00 $ 0/0S <<  00 0/$ 80 0= 0  K$00  0/$@+0S  $", 0 0 $/ -LM0@S00 K0 J0 0`t -LJPot 5 -LyJPnt 5 -LM K00"hJPt6 -L4h@m0$: 6 p-L MP@`0KP uz0S  ˔00Kp6 p-L MP@`0KP Yz0S  寔00Kp6 -0LS@ hI 0 << 0 p-L M@0K`P +z0S  傔.H0 0Kp$6 p-L M@0K`P z0S  eD!0 0Kp06 D0 D0 -LM0Pp0`-S000P(K 0(P @P 00S `Zu0 0 0S0(YgKd<6H4 p-0PQ`L@ P  00 0 0 0: P0SP P  000 00& P0SP P  $00$0 0$0 P0S`PP  000 00 p P0Sp-D/0L3 0-,PL0@S .C000@0pt -0L0CS0 Ql M00-00Q0^   ?00Q@0 0^0 000hįt4 p-l`L@PTX0 PJHP80 ppt;L5q -RLMp`P 0BS( 0 8 @ H PQ@W2T yuZ@ n@T Bl @WZ T8 Z48Z 8 Z7vZ 7mZ 7dZ 0\Z x7SZ@ X7@JZ  87 AZ  7 8ZPP?  /U 6&U 6U 6U x6 U  X6 U 86(@U  6 U 5 U@ 5@U 5U  5 U p5 U  P5 U 05 U 5 U 0U4U 4U 4U t4yd@3UL0nU04eU 4\U@ 3@SU 3JU  3 AU38U p3/`@U H3 #< S S$  S  S2  U  2 U 2 U  2 U  |2 U \2U <2Z R`K 0 P0d!S@Tx.uaPKZ  \ <0vP0t!2 UK P `A0Kdpd0\4!U KK(K;$;0;<;L;X;d;;;;99L98899\9l998999::<:;h:;8088 8@8P8h88877777;x:::::::;;6666677d7|7677;,;; -0L ސ< a^; - 3吣L\Mp| x a0@S(TTT p p 1Px  p#0S|`A3@P^U">Vp2x@K |01x |0 EPxlEPD xtEPh|W'<0S |0Q (.' Cp xKD0t QCpZxKDt vxpK0|K`,Kl0 h0 >P6_P1P,|0@000C S1 u,0@SP |0 C Pl U)|00|0 |0Ql0S x` KDP|Џh0S xd4 K9EPTy(KX\lg\\$<,<t@4<@<ht@P<\<xL5x<<<gt<MЍ -0L 0я/ a^< -MML MT20`S@P<2<"K\0203/P0: S %NR2!1Q0TK3/P0: SBpP_NNK @D@D0!p{ P`1: 0?lM)KP&410S"(1(!Q1K03/P8 0R 0R  |0R 00S* U%00S P0Sh00S 8 L0c\ 09P  K脅|=L5|==x= -LlM`@hBpTfP LP PPA nP sP hP:1P P PP쐟젟pP Tp00 cR1P R R 1@KYP  d妎0: S`  P`P$@=x|T=\\HzL5MЍ` -LP(@`pB@D 0Tp 0@8P 040 ,0 $0  0P?>>p= *Q-LI7< @@0Pຈ`p 0@0  VUP`Wp(0 4p 0QPK 0QPM  0QPGTQ000ӑN -@L|tld `c T TH@88 K^ XdXXX0YtYYYY,ZpZZ -LMe_~K@ oK. *t K l0 d d0 \ 0 D31 2 ,1 2$1 2 1 2`1 2\1 K`$& -LM(Q ,QpES0Q\ 4Q0 D8S0 80S00, 807< @@00@4 80CW@<PS0PP0P ( P SP S0``0` (P tSQp 4p [T R9 @@004@a00,0 9 @P@`0`  ,R9@@<0P ` 0@VU,R0pp0p p9@p@W0<p `p `P0@XW,R00 44 84 R20P `0`@p 0p`@P@ @@P8 0zR84p\a W4 00S(KZZZZ[[D[X[[[[\L\ 0-LMP@dP%00 0 00A0a A S WAR A0A0S7 A? K Q02^0A@ 0K K0 M-LM`0 PP@T t 0 00 0q@K] 0-HLP᧒0@S @00;0S00\ - L@;0P\ -BML:M 0D 0'e0P@4 " PK``P@UBKLL4d H 8d Hŗ8$P0 8$ 0H#P 00P<  0/S 0<4 HPP :PL 8Qt004`P-Vj R~:P`J@PP H~P90cC10X @T,K9 C,00 PS  8dQ#[ @|P0  "O`@P000 @xP00000  8CQ44044 `V 0S00X0_PP@ !,K0 ,00 S 8 Q00\0P@`V 00S0U0SD0 KP 0 0BS(ȑ 8P4$0 4$ 8!ǟV `P P L PP aP0,K ,00 SP;;S( J8P 0,K ,00 S, 7P 0,K y,00 S8} $P 0,K f,00 S0j `P0,K S,00 S4W  08sP4$ 4$ NPI PD P? P: P5 ~P0 yP+ tP& |oP! 0aC0 S0S8Y :Y08ȑ 08/P44044 V8 &P44 ,Kp0 ,\  8P4$ 4$  "W8P44044 ,KP0 ,\  08O4$ 4$  "U 2`P1 C`XpP |P3 "0cC1 @T000C S000 0,K 0 ,0S00S T8O000 00 "0 2pW Wx.Vu ,K@0 qPP`g TR ,K0 b000  0` a0 /o?o b 0c1 2HV3 k,K@0 @PP`6 T! Y,K0 p.000 p 0` a0 /o?o b 0c1 2@Wt8?O4$ 4$ 0,K0 <$R ޏ|0  8#O44 HD$nP\4$@T$@d @$T(KxČv\\&\\\\<\\\] ](]8]< t~X]&D't]]]`]]]]]]]]^ ^^8^P^p^^^ -1LM$8 :4 67< @@0 0 *7< @@0 0h 0@PǪP0B Y     L4P @@0 0 P4T @@00 (   @0`l 0CR`V*`PX U P@  L,Q ( ֆ  0ц@z T  0@ (Ko[|````````a] a a4aLadataaaaaaaayb -LM0S`  0⚆0S  0⒆p囆 pR`2`!\P( ၆D, }80 y,4 u 8 q7< @@0 0e@\0@S  \pWpX0 @@00@0M V0@@0 a P0X P:0 @@0 (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpxhpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x    h p x 0P@  P+ 0S S1  0S 0S1  03  P 00C   0 xp8Y Ko鍞$b,bbbTb\bdblbtb|bbbbbbbbb -L M(K a0jp ,KGpBCD@EPF`@ A0P@ P`pjp㐅EL밠p`p(0aPPP,@h@PD(kMP,gMP `VL,(,00S $K輌bbČ0 p-0008L`@00S l :P\pD0PUp88 :P(6pWEV gdcedA ` -LM  app FPPw  0G|DՌpXp H\奍P 8,8n/Ke:P$ KvP6PTP ! ! @pd!`1 w?KQ Ph1|!`pQ a y?KP`nKQ a `APP0 KV@@`Q弆F4@!dQ hq |! nKPP<e/nK:MPPv~3p@e0S 00CS00PӤ0 mi 6.P`0S 00CS00Ӥ0 Yi ". PpNUnUl I$KxJL5,c8c^drdA_d]dl^ p-L`P@P @Be/@ Vp ph1Fe 0-LM D K8 0K0 @ P pK0l=0e -LXeXu{eP0 RP# EP1 FP< APncP  5TPf?pPE hP3 nPW fP\ vPU wP3 tPU+4 0S 04 H0S 00A0S 0\4  P$4@4  44-,$*00) $0#$0S 0P@P 0S PT#00@ӑ3@#0#00 #jIp}@|#0 S0 Pb0Uq ,30S 0SS 30S0SЂCQß 0`P }0S20Sx2@T X200CSP2 R @2Qll7p< Y !0ES88"8Pb 6p) U"M100CSKKK$LLPXU =oU 6oU 06pt2$10S \L1H 40(o0ES嚋P @0PPD0@0PP  N8Pق$ᢊ|UPPlollgDeTe^N  le\\ee4&edAxl^dL5 `8 200 "P:/@-0@@0` p @ `PpW 0VUT p- R`0L0@0 ӑPkR gR. mR tR) 0 + 0"5 ;%"  0 80@PPX00pNC p-L M@@`P0K%S00d0 g@T $ GKpf 0-PPL0@@@T0h -L@p+P`` 0vP0S  0㽦P0S 0S0 -0LM`@<0 8@ 40 0@ -(` ,` p@PP0` 4K( Kp8 U 0S *S0@ <K, Kp( (0S,0S" (0 (04K 0&p <@K0 0uP,0 0p   #$K 0-@PL0000C00S r 000 ^p@0000C00S r 000;P0O0]PQ/Q/C p-L`P@0 SRR 2P@@Tpp -L M`ʼnP4  }1P P1 ,pK0K Jx!P@ PD!00@oP 0/S P bP  p 0 TP p 0  0R 0Rx 004P0 dY 8040Pz(KdL5  lffg -LM4P @@0`d0p4T @@0P<0@0 ,00S 0 P Dg -LM@ p 0P`CP, iBT 0 @4a -LP`p 0@-/ 0P 0d 0LLL @ T0 0@ggggybl^ -@hpLP` @T`7< @@`p@`{Č p-LlM`KPᚮpP eQ@P4, Q5P@KphxrdA_ -@LP`pepP RP@@Tx -Lh$h8h -d2LJM0S @K +8Ÿ 0S00Q0SP @10S 1@G`A BCDEFP  P`@P`@TJK0!@'@ tP 0rSJKL!D1@z/ٌ@P@ PrU<000JK0@ ePJ~KpG*(0K@K 0LM0ۇ`P P$K2\a0 tT@T ^ PJPU(K謌ČlT'!RJ=ll-0 CR 0R0 S_E00 0-LPH r0S S 9 @@00@0 20018\Q$ 0P ~0訆Mm -LM (R  P`P`20 @P`x0 @@0P` V U`,` 1Z,  0 @@00@0 @P0`@P@0` P` P`ZY P `VUP` R 0 0 @@0 0ZY  S Q R Q,P2 `, \,P 0 2  -R`pL`b9 @@p S R  QPP   0  p-L;P`00S@P`0 0 p -MLM, 0Sfhp0@p@P0p `p ` P0XFWD,00 c 0c#r"Raa  !, 0, 0}BNK@D   (KbP 00S  C'4[($[ SSa B RR,2ࠐ, ^\(K$mybal^Lm^] M-AML M@ @DB^K8@PEfЖU S+00?S ^] `ql^ S-Lp!0Pc UP DP\dP uPWX 7< @@0(P4P8`p@ !R `Px 3k@P(A @QT pP @T a 0ttx0/S @@ ~P8W(0x謌Čh<rn^rxr -LM2, pR,A,!(P( @P` jP`, 2 @2 @ PXV& `@P 00 PpqWx pq``Nx, 2  @c,0" 00 (Kt=rsDs0sn^$ns -LHM2P L R1PF 50S 00C C`p$  `@P0@P @PDPH0P$Pbp@PqwtuhhwkQPd@ 0wWVVW X\TP @Q< R XY  0w0 kP@5#0 `0d 0/o?o b 0c1P@LPP2H#H0NSnS PL2  \ 8 0@40 0 0C C  KP (7"0@00 ,@ 0 S0 S( 0 K j0pK0PpW@  W0X 00 PL0 @@0P`PU` p `P弉pP L0r0@@0P  ` 0@0 K j@ PU``P9 @@0Y@PZ <10S0,0KP5PL 42 80 P@@` 0@ST 0@T00K`0O&'"< 0H D Q@ঞᆁ@P X0 T@ D (Knsn^$ntDttxottu -LMCDE@FPG`@A B0ptP@ P`` \0P 0S<<KhvP$$ vKDuuX]n^u -L)@P 0rS@|q0`0NP` !0S`Ppa00C8S𯝘 /T-PLQ@DT@44evT(10S  m<젟p PP hP00@hP@@TX|7v@dQT@TT-vT0S8 ( 6<|Jp>euv,>vhl^]v$v\lvv -LMe/oKXH5H"044!0. P!   (KouXhP@P u@` P@ PT`U" EhP`@ PUTu@ PTpUhT0ST xD ; e7`p,@ $P0 0 `ppq pqu,`p0@#P0 0 `ppqi pq@h}u0`p8@T#P0 H0 `ppqM pqau8`p4@"P0 0 `ppq1 pq`Euꘒ484 7b@< @0pQ@PP@P`p `p0 (("p0PppP` qu oKe/c[uvx u7< @@0pV  U x0S)0S&h#R Q0S0S 7< @@0p 0 R0SRt 0S0S`dTP@@(vn^\0>(wwvhl^]lwD'$nw]wt]xx]Dxpxxlvv -QLMp  P Kita`HV008V(` 20 @ P0TX KiYt 0,z Ki xyn^Dyyy Qp-L`  xPph@t*PphaP@U00?8U(` "Q 9 @@0@0 L@pht<@ aq01pzzn^DyyČ p-QLM`  LL/P@@KphsaP@U00?8U(` "\ 9 @@0@0 Kphs2(K0P{P.PP PP †(0KKpLz`zn^Dyy Q0-LP  P0hsa@Q00?8Q(` "\ 9 @@0@0 `T0his \\ \ \2 00 !(0hrzzn^Dyyt=z -LMPTT& U&*PK0 @@00@00 0P00Sa0*PK*0KP 0)0K`PP)sap@W00ϓWڔp "0S 9 @@0@0 \ <sW8088S 20000 F @080 4@   R0 SR8P 4`  0`@ 04R`ⲐᔀW80@0J PA uP<0 (@P@`0@ Sb& P0; VU0VU0 S:! 0b0?o0c10 2 P P  P PP 0 (K^zp5,{nDyT{ -LvM @oKe/T HH@P; @aDY00A 8Y1(` FrJK "0 @p@P 0SS``a @0"P @PpP`w0 @@1HP`0 S:0S*coOK Ẁpa2V>C 0C` F   ! \1SU 0SSPPQ N 0@@0@0  B 0P@`@1p p p,Z#Y!0!@`@v_K`0@0@ TḀp S P `PU`A `P qlqoK r  !1 R! oKe/(K{zDy^{{{{n0|@|d| -LuM D7 <747`9 @@0   Y 0ᘠ' 0@@0 X 0WSR K 0SR V U\6   ! Y 1A0@1 A PvP@Ue/oKxş0A K#A00 1 y0P1 O u!00`ȁXJ0ş SFx`Vu0OXu?  4;0D@0@ 0$@0Ou?  4;D  ğt`0O?  4;DH 00@0 @oKP` @  !$0cp!$0cV UP`PU`@Zd 0c!  P BQ  ! 9 @@00@0 10S1 h ATd \ !P`R&1S"w_K`AqT` /!1"P@` VUP`wKP  oKH    R0SR  0 V U w?K0@0S@1 A P`A0S 0Sqm0āXW(Ko@ḯ@Q!0@! R0; QP0QP0!0b0?o0c1q0(@K00"0B岏B00/SB0oK0B p-1vAPxw P oK! -oKe/(KČ   x -LgNK@D*M@D e/0,0 P P  P ,$:$ ,K GU`P %쉟(K0S)0%@@0@0 (K0(KS )(K0D&@@9t)`0C` eKe eK5gNKS:5 5@DS:@D 05 +e/qKe/K 9KN.KA0 BA B:  * "o ()TPȟ0S  &5q0:K0:K 7P p 70`uSUS OKe/ K e/G   hQC #XQ MQ AQ<  Q ?Q4DQRRQ UQZcQG aQ= bQ>eQ] X:gQ\qQ mQ` iQZ lQsnQ\ pQcuQ] rQ sQxQ zQ wQi #P Ke/r 00000C0y 4u Dr n x #P l&0} }~N,~@~xod~|~~~~(Tth|MЍ( -T0L0S@840P(0 0 08 Xԍd -LM, ,0Q 8P60P00S.00΄Qp P0 `DV U@0`, 0S@P,0P0 0㯄Q x4 8 0 ! !̀ p-1LM0SZta0SV h100CSXHTQL1  D1\5\\1Q0000.1@ KK@ \!P@#0T@0T0\ L` 0[Q_ 0R@TP 0NQ T0T0 <00SP#8@8Kp!,$ !m,\ -?MLMC`pP30S9 SQV7QVp3 0Q xP#$800 Q R30SŔ 20Qw"]P ?KK(@DR@D?+$P78@K0 3K4 Pw0 : LK4 Pw0," -?KK(@D@D?+PPʮw0! ?+P @w!8K0@ 3K4@ y Pw0x!7><1Y@B P K 4 \ P0sw0 !40 @_ 0Q <7 0K[0, 0 K9 PPw ,0h7  ,0 `0WPV(K! ! m<\ ܂8ԍ 0-0L@T 500S _Pڼ 0P0# ;;S 0@ JPp0 @ L0P@TPv0D  7 06@0! !ԍ \ 0-T0L?M0S@00S ?KK0P@D?+P 0K0 !! -lb0LPPP2 P@8"000"0P002PU GUE&Pڀ;;SB a 0㊂Q8pPď GP01@P1+v0S! v0S {v0ESPuv0 SDJ6 $1 iv0S ev0S av0S  0@TT0 0 00TSPP T0 6=v|00t T6 l00Q PL686!!  Ѓ 0$,d -t0 0LSd0 \@ 0 RPu$ 6  ! - 3LM0S2 2 2nP220S 20S 2"2Q 220=R0S d2BߗP 0: SH0D@@d2@X20S L20S @BP#0012P K k 0#4 1 10S 10S1 t1 X1 0S<1 41 R(1 DhQp0S1X!p0p00000S2 @0S 0 p`V 0 0 =PP0 \0 B00 @00@P0  0|<0pK!Ѝ@$ 0PS D$d !ȍ,$4!,0$ T  p-LMP K`@<P 1P oh T I( 00S 00SS) p !T  /(,(@'($(h@ ˿ɿXY 0(P 01hKp`!p,$f܅ -L M4U@p  5 005 5 5 5 5 4 QdpTT$4@  $圿P|t0$4h4pG 4Q !ATp \*0/S0C7SC-p 0RP`C!CR00 Q0%2>&B P`L 0S W*` P0@ 0P!00*0@00P*-S0!P \P0307 p-x0LM0@SP }c[P`K 0O0S OKp] -LTMpNa=0`0@0@TSVUd@`@a tpPK 0@<0PpK0@K} 0K -0 CR 0R0 S00 -LlMDŸ@Ÿ^ \P`p^q Op28KAa=0  RQTSAAa  0@xK⠦1PxK0C@&t1P 0P8 KP PKO8100CS (1 ,8,$8 #4;Oa=0 4OxK=O00S y G0 0BSR#O h00S [ )g$K$ ,0$4<H]PX p-4L0S$1`@ PP>000-S 00 00 00S  phn 0P0P! P ጦP00:U0S ll00:SLQ10 0 $(0N?Pp謍lg\\^`x P00/$/ Q-L0BS 0ZS 0hS 0[蔖Ԗ Q-L 0S 0S z0[蔖< Q-L 0S 0S Z0[蔖ܖ Q-L$ tPy[ 0P-L 0STpPАРP(_,`P=@P 㽮 P|M@P0VPPS0    Up 0Sg $$ L -L MM[d^ -L MC[넘^ -LlM@P㐀K/p_@T`0@I|P #Z0pSP  P0: S 0( *Vp$KL5 -LM K`q3 00s@PIrF 0SC kR bR&mR wR!$+%$+*$&U*T'0@P 0 !$/UT0 0 @P 0xS S *S d1#pUT@P@P -0LM@ 0 $0 p `K$PK Rp 埪 0 C0 Sp 0S K -?LM0O8 < 0P,op 0 00@JS''((''('((((((((((('(((($'0'(('('%'((((((('('(((((((%&( &,&('(X&((h&(t&&&&&&&&&&(&H^HNP ,040 D? }H? = 0-S0Spb pl=0k= = -00-M=  l=PUS t-00<h= D-00d.4L=1H-0 004=0= 00X  0 DU P`< I00< 00< < << <\,0<0 ,<|, 78<h,4p4=WPK0S 0S0 hP 0S;0 -S 0Sp W<0S, +;8 < 0BSQXUY0BS< 0a40 nxP@UH J`巣PFPUc *`@4嫣P,{ $HTpP*X0 +0AP4 vP0S0#3 .PP X@~P:0 |*TsP :S@PLiP  R `00 )09P`4 XP4Q \9P9Z9@* <:P v PrnpPUH M<.PIPU `P PUPx SpP W(0P>P(0S0#3 -PP ~WX@PX80L( $P R@PݢP Pz P 0`00P`HXPa7P0i00@JSd222222222222222222 121122(22228222D2P2222`2x222222222222....2.22..//2 /0/H/2 0(0@0P0`0p0p.21pP@}P5PP | 6P 6P  85P\5 P ,%5@P 5P 5\ (P\@蔟܄u`*a0BS!////////////////`00000 ` 00P$00iE@ R[[yPZ4Z 4Y 3Y X3`P P @ T 4X` $7 | Jc@ R `I@@ THIp4#3kB3QP 3@3@00 ,WQt3W J@dᚡcP0V0C ,K 1+/, R6 1PV-+,U0 U00T0"PTPSS0x"R0lR00\"Q008<@"pB @X2$!1 P   " R  1R  B P 1Q 0 LIq` `0 S5\BI0e0?o s00Sg00CS0\ i` adXȍlgԖ̍8$h\4@< $$` T<$PܖԚDl^@$L41^dP]<d|`"T`!(4$8qpY؍̛  č $$n9  0T8x^"0$,$H\\!0  0 @H00S\ \0 `00S9 6 666$6<P000@08 S#080S8 <0 B8 !0 <"P0000A08 S@1 (K -L@L0S 8 0R, 00 qH$М^ -0L`p0 PA?R R *RJ[RG!QQG (10SE /QP@0QS50@0*S SP0 0S P*Q^' 0!S@@TR 0-S 0S ]S R^R ]R\ P0QS  p-P/Q`00C@ nL R  0T p0P0 P0A*00AQ@*00p p-@P`L 0P <000CS   0Ppp - L@ P 0P/S0S/S{P x 0-P0L@P 0 U(P G@T0 $^< -LcMbMKKM(@D"@D 8 3 ( p#.3mK`F`F K*K  0KҾPm0 0R0A`KpRV1 :*K(:KVx P,&RP \R0/S 9SK00CS& KP2SP  0KQ S @`T K 0fT  ` KV* R V ZKQC :K(6=K 0` c Vp]  K0SX 0PSU 3KLL X0I  KP(v0@P *0S0R00S :K8S  K( 00(KQ 0 <[S:K(F3=K0CK0Cll(F<[S 3K*KAA(^K0(K$ ,Hl^ -CMLM`Pp.0S 1 }00C00ST0S 0/S  <S   }<0C<0S KPrВ @ P.0S1 P#*PP 0SSጮ@ @DT 0r/S lLcP<T   /003 0S80S50S-10S(  0R# 0R!  0R S  0R 0R   0R 0R\ppT$,=P$0H$ -L@p  Q.SW|p 0S0C W` PPl 0##!>C=S0Hbp0H S]pQQLQQQQPQPQhP 0 <#d !>Cv.B B0 @#!>C0  0#"!>BDS0@k?B0  0!!!.A0r03 R0S )0B0@ 0#"!.B0r03R0S @ 0##!>CS0@ 0#!>C;S0:pq -pPL 0Sd&/O`P00  S,UXB .UQ   w PR00EU09@P ZV 0SP00MR CR cR mR00000X $0` R 0S P 000X% 0S" P  ᶞ#000  0R  0R 0pn ᠞\0P P0@@@@,Z ء(LhH$L$ 0-@PLD 0SA Q0SAP4 0#S \S0#S@LyP@  ) # 4@w|坩p0Q0 R 0S  }P 00@ 00  0P$=@ 0-@PLD 0SA Q0SP4 0#S \S0#S@{P@   # @my|Kp0Q0 R 0S  +P 00@ 00  0T$=d -@Q@0@L@ M@!Qp$`K 0^0\$0 QT 0 K0.00P:$0  -` LM0S PHp`0@T  0`(@PU`$ - LM0pS 0尐P,0,`C0@ 0S 0"S2S0pW f,`FPU*W0^ 00 0X$\$0@-t0P0S0`0@ P $0S 0S0S0 00@:,^0X$\$ -` L0S`Lp0PU p@ TP` Vt$' -0LpW00S𩝘00S0CS𩝘; 0`F@Td0S0S 0R 0@S00it$(  -L@LP @08, 0IHP X$ܣ -MLMx10pS`V `10S 0/S BKAA3P`0 & $1$Q0QX HP 0@K,K O00 0G0开 ,0%uEP  H ,0 0000@K$00,K:2 Ẓ!00 0(KX$ $ \$$ -L M@PTp5 呧`V- 0S0S$0S (0(`S Q ᙖP P0 0@KP(K00! ܺ(00 ֺ (K`$= -1L@`Tp  Q@@T _PPYP' DP  @P DP DP @0 00@͛˛$ d$` -@@L0S 0マP{ `$=Ф -@@L0S 0lPd d$ -@@L0S 0UPM t$ < -x0L@`TPpX ATЕP ḨP0E"0%@Td$ -1L@`T^ 10S\ |10SX; 0dኦ P @U, H0S0S 0R 0@PS  ! }0  S;00 S00000CS000DPP CP p0+0 0L00040 00P( t$(  h -0L: SpLD H0 H@00!$%010a:0S60S30S0@PI  00S 0/S 1PI0x  CPIT  ᙚ00@`V=h$ $  -8LO,0PlI  =h$ĥ -"LtM0S K, `KtkPj0: SfP L0 b 0S^ 0SZ 0SVvP 6I0S XU0I!I MZ p c  0P: IpP X:W1I1px!`( ,l!@0S | PKD!0S ,!0S !0S 0K 0FWW/ -WW, X   P X0 }{X ܙڙؙT !PU00jOYXə0PX(Kh$ԥ \4$8$ -LpMp ,-Pồp@ Kjp`uᓓwᏓ10S 0/S 0PH!0zBPvH!uUmBPiHT! u 4@`K0(!&'\/10P0S0S0S X V`RP`VPU P 5H N |u < :0K0P0H0 00 0 0(K  $  =h$8 -MLMD2@T p`("- PUL NK@D@D0S 0S0S0S G!  'P  G!YmP PU! a=0STD!0 R  T S Ra=02@P& P 0SQ ǦP a=0l0 00@G` GP @Yቘ(Kl$Gp$H`Lx 0-@LPU0?Pl7d0d@` UtP0PNG08 f0t0l$GܦLDp$ -L M4 @PT`; 儣qP 0S0S$0 S+ ((K00!0 K,[@P 4AP  0`$0L00K 0(0 @Ƕ0K (K`$=< /0S P  P/R/00S0/-SN S S  L0 00N L0 L 00N00N L 00L0B 0R00*0B00R*Pp@-^P`@L ^ ^ A0 00LA0A 00L 00LA 00AP @0@ 0P!00*0@00P*@pp@- @0R\  0R: -5L~MP0C  Pp50SU0@PS<:864;0Q ꤓxtplhdi'T!PhH0 $#$(,"(hU Q Q  0SAhD <8#"h( 4Txԭ@hخ,<P`ȯد,Ld,@Tl -$3LMM $KP 30S  UI K$@*LK2$HjK0$`F"嬢ᙘ*="r厘*2l"儘*(L200 @"0Pv*0* WV!eLy@PGy 0L 1吀 0| 0 K$@!J KK$@$A*K$J d*\10S< 41K 1yP0$@ Sp` 0L @P0V 0  0㤚 0$H00 @P *㥚 Ś  㑛$K]l^ȱY@4PS$$$$H -@LT00  009 00== -LMP <K@pL/T P  `VY ;0  d0010 0U :0  +& Pp@Pg0SP 匀 0 R*0@Up6T@K0pPK,K0@  `媛0  @夛`0  0`K圛  9@喛 0ᆛ &P Y/P00S@ R ; 0 @p00Px (0@P (K$$$Я$$ 0-LMP' 0 00 0 0Bz0 bz 0  0@ X00@ 0 @ PD0@,0 (@ $P P L,K 1K0$@@$ -ML@M`  $ 0 )0K4@ *@KL` E>^P vpp*h>h0d 6 0f  & 6 f 4D0@3S/ 0xHxĭ <H <T`l0 H@K@-H 4=R 0$0; 0@00090:<PW0  & @KY p0S @00S pA h<(OPP 㠒H 20L`P`Cs 0Hy BS4  & 6F 40K;00@000 ' 0)[R0@  0Q0 0 x0& 0 6 0050 ! 50<2Sタ@K(P 0%K K0 KPW;P[9(50 4@ *0K@E;Pp40 4@ )0K@5;P440 T4 x0K%;Pp$DDKP$<0KDP ;Pb< 80R@$80KP ;PT0;CS0xKclDPd$0P:P D4Q<##S0S@ 0^ Y 30p U@P& q & r*'20@l 2KK <3 00(3#_KIs I"PU 2 P0@B0R00S*2 0 Sh@T P"PLŸ0S 4@(!0  P@0\K\0 EKV:Pl0K0 00 80P0 T0K0 10 `K(6 T0 @ 堐 P30S  (\0@ 0S0S: 004 $lg,l^T?p$.A''(L5$д!$,D\\h|Яĵ$@0dxжܶ$ Ll$@^ MЍ] -0LS1P`@v( 0S3T 00,`T'%X% L0S `00S 0 T$0/S 0S : 0 S /S R - @L R000 h -LM0 ,  )] P`6 0CL 100R 00 `0001  L0 S  `0 X1  00H 0P',1p(0@S0  ތ0001U V   q0p '@0 00C0S  q 0000S Pq0 p 0000K101L(K$px M-LX3 @@d @3w0: S= D}@.P 3 Ÿ0"@_P`0f"0 PzPYR0,0K\p X 2 `0 @dKA0<"5,2 X200S H8wE~KpG82 pG0p@P 0EKH`G H @ PG 0 0f@PV 0dQ# 0F@P|x&BP1 h4S00C08 HA   p|l$r @!@101>00 00 p4sl| GKN000S r(Kxиܸ$$$Pp|px̹PSx  -ML Mp`@P @AK @ @0=W  V V0W 00 0S:0S:_@P A.KHH0 Q B B4[AK AA UKp.x,  -LM0 -LMXb0&p, 0 (@JP4$0S0 0S-,0T*0P]PP#0So W,@(0 TP0PPP0(0 0(06PQo0@ 0$@O$0SJ 0SG(,`YC00 P`  (0 PU` P$`0P1 ,0Z00,V)U'  P"Pf(P 0 ``0SOPR(P 0$@ L,@=0T00000(K4 -QLp埂P"U/8Q ,0SV 0E0 @0 o 0 ;i5!"@ 0$@$!0& P 0 0SO 0$@ 15(`"P 0 (0@  e`tl0` P $0S 0Sx^H  -0L`00qP`00 0S0S 0 P0V:T 0Q 0 0S Q Px 0-L@4(!PL00S' `0$ 1 000C S 08(@(H(P(X( 0 0 0000000S0 0 0 a0R08#80 0cP 0 4Z 0T 0 00/` 0-LM@P0`P ;P00 0AS dlx0000 0px 0-X0L @?P%@000S0S0P t 0-P0L@T 4{xP T00T0S 4 0S0S: 00 p-0 0LR@`PU p 4׆40Pp 0-h0L0S0XX 0 0CAP} T@D*@}}0000 -@LP }00褽 -!LM0P`@0@U V!0S:0S* t?pXJWGXQX(0@ 8 4 0@ @i8&1" 0 ƈ&P, (f0 0P0O0 0P0O 8 K O ?C00, S|@|0 0J d0 8X0L R50 <0 (K訽Ľ, -L(@6&8`!0 11 0L0X`|0(@PPd0ppN0X50 P0@|0|0  P0`S'PT3(@Q𭝈P0ĽԺ -QLMp  P W0X 00!0S:0S* hYd10 R QD1(6PoV;U8 a(0@P 0 ~862 0R,0 0(f00  0 w ?k, 0`(Vo 0 \5!"@0 @@ <0<(&0@?@Q 0 0` -0p0LWP0`$`ࠇ@D # U*W"00S  0x$" @#0WH00S @ 04$" ١茽 4Ph -0LL@Tt=d0X00S L$DP$ 4@d00d000ػ  -0L: SpP` R@l  q PRq hP p-0 : SLP`l0@@0P`Vup 0-PLM @`U  T T0U 00- 0S):0S%:@B7=|:t00S `2 L,0K@ Te ("K0$08<HT -Lp`<1&0B?5 P4|~PP1 ?00V 0 P0 00W0 0@0@0@ 0$@`p \!(,0 (4 l0l 0R \@d0 0&P8$(00 Q tصl -ML MH 8`\(< H( <( 2/ H8PPBHc6`F#@ 0h ` 0`p08 PA0 ZY8 0 0@ @ 08 H02 R'8Q$*@(0D 0S H8BK!@00@PBKAHP@  D8X:1@@K8(A!A4( L K R 08HS H<1/H0 0o5 @(0;H80S00  ) H(L@00 0@L7PPH8q@  Q Y嘠|0@Pt0 0  P Y4X:@(000(KDԼ` -KML M0S000,0PF $0: S S  S S9Q;P@K -RKK&H0B?  ,` Hp Rg80(S00Q0S+ @0 040($P@1&C1/!0@@ S  <dp W`@PK@pK>K&0C4 Pß\P @D `T   R    0 , <80S00  ! @00 0_ VPP@ Q yx帟t0 l0PP@P 6 #1@`pX(KԼ` -L`p@]TP  *0 R  O v@0S|P0S dq` 00C0H <00  ,00 xP Xx` -L0S4  嫝0000 $000000$ p0t4P0eS yP Ht4D0S 0m  P' 30S 0S  gp P30S  0S L0S Y P 30S P30S p l,C0ST۝O0S@՝&0S,ϝ0SɝR@ C 3  0 20S 0" 0 0bQ P20S7 prP@H P 6`Ux2 0 j0bQ TB0S @4@T B0S ߜۜ@T 1 1Q 1 +0S 0K AT10 @ 0 00d1v1v1v0S' 00S`H\10S PB` P @KP " ( 0K bP \00S'd0P&llg h <$\\X>1̽ؽ  PDdȾ (<Pxܵd |xp,Ƚ -@LP0P !0!0 S00)`倁pTZ  PpGT 1S1<0001118 !0!0 S00 t 00S 堜*yyPt %P  @ R000  0R 0S R,0@0,0`FVp8d|<L4h@< P -h圈LTM@pa  86$%00S# * 860  111,6\86P% "1'2!1'860P% "1'2!1'L0S d0 T 0 TT T RQS 121 111$6\T  121P@ 6T< lK040K6Vh0 6@@@W x@ t p WVW  V V0W 00l@ 0S$ 1S (< OPT   6Pr 5~%0 0 A50S @(K _E0 V 0S h僛X0ST P G00 Q$0ƒ @_@ PGQ P D0S < 弚0S YP 4L$0/ !(4&0B? P@P 80S 0 $叚 Y Y Y# Q;P 00@@# Q pC6# 0` 0CS 1(0 0  Y) Q L0ST R H6@#@P1(00 00Q "0Sm =j@T Pc tB0 0001S wPLPtt l"00 Y "A00  00   00 )&0 0 1 1lK d` `p T!6@ 4 @ 0 S, \A L0S @y8P @@00X E0 0 P 0 * |0@`pl0t@( 0dS*TW0@iVgxt` pp x x@ 6Tt`K(K|D|Xx0(p@@< ܵT8<\ -L st: 0  P$` P, 0   00C0 P 0 0000C0@0 @$P0PW%X: (Kxp@<  @Tȸpx -ML M,0S0 R0 0S-0.S*0@ST H)0@ 0 P8  8 )L0Sh `0e 0Sb (00 P89089 U(0L 01 R0*1K `000JK )1K~0*a[S @dkP T8 / 0@`T0%TK8(K @\z8(K` Uz,0@f0,07 00C0 C~@< P8  8 ,0S pP L0S0! *K `0)K0)1K(JK ~,Q0 0 0PF0b(K0 ,00,06 00C0 ~(K@@@T4 `V kP+0@ 0$@L&L0SW `0T 0SQ @&`  P8 8 EV%0 S Ɵ w 0 S ş i0@ 0$@0 $ş Y\%(K>K$ P88 ,00,0P4 5 00C0-0S(  R(0.S%,0S"R$00| P8 8 8 0.S$n00@j P89089 8,0X$0,00S`p0S: QQP ğ 0CSsc< 0 0ASH | | ,0Sڴß0+ < ,0SQ 0S 0T P< S0 : S0000 0 0 ) ,0S&ڒ~KpG pG@0 00RnK@`FP `F 000xx"T20S dJH P< p ,0S00@!L0SU `0R 2 0 0B S pxhhhhh`0 0 000000Q, 0B S  0 0 000000 00%pv P8 8 |0  00C00$<Q89008 (KHzx pLdx ,8`Tl| -HH1 0 BLF`PQ>  0  !000S4 000S. p@00 000S 0Wp` 5l 0@ 0$@X0  00C00 0 0 J 0Z*xtp -Ԡp`L,P$ Q00S8 0S 00@00nT  R<0 08, 000C0`pGW P| -L@@B R R(1(!!  !w P 00C   vppWvo``Fe`u@G!_v3 0@ 6l FVu`0@ fu$\< P-L@(00S h< -3s3XL ;9@Pc  "s#l3R d pW T @TD 0@cpu@J_ 0@Ɔ & 6FV_uL0$S hur0(6(RuX? Ɨ0pb04\,0p2 0`B +K0S2X|0 000 0 00 000 ,0,00 00000 330 330 330 330 @0L@00 D0QD00 550 550 55 d00d00d0d 0 d  ` d0 10S d0\F $@`+?CP 00S Џp`@ 0R@  aA$ T ` 00  SThx4 -6kMLM@V`@6K`K:P%s 0: S p^hP -cP6P s 4Ԏ$F0Sˎ60ScP0`S 3幎50S ݺ%0@Ue5pp ppppl l0S P`,5XET PH%(0<00PPCP p% qP @:D0S!40S4-K B B0P PP@  &64# 20MP@0T0T XğXTğT$PğP4PC 4@@440S (4(543ST# 4R0Sc &(0#@3P9PP #x3#[xC2PP<3$ R XoB0S 20Sp2PB$jP8PX`p6 S  8Ɣ    P V ?P`P$6UL2 00B10@jL2P@U Bj(2P j2P>j1P0@/!0PP086 2100 6Qx1 l1 xjXAsj0S@1 P1,=T$Klt@ DedAx<`|((4<p4d?8< |x,TPpttص@-`0 X0 B@ Q<0<4 0000P茽| -L@FԲѲ@ -(L0 7u0  hȽ -LDMRl S V0W00l  PU10000C0Sl  ?tX@< dK@sl0 JP0d0 l0X ,@Kh Y0 T P 1`0 100 \` Xp dK$ 0T@K0`0 \@ XP T` Pp 0 dK sh0 @` o D0R/0h 0D:\`KVWH0 V W h ?00bh l0h  ao(K%xh:x -L`@0S!K14P@0  S;0PfPyP )qP p@T`p`  4]p@ P P808 00 (K]^l^%Խ@PL5 -0`0SLP P 0Āp0@T 1]P0SP P  \PPlБd0 00w0S U \0S]^<41L5-0 CR 0R0 SW00 -cLP p W-#0S TZ#0S 3 0T0R0Sxx 0S \``#0ST36#3 0CPP T0Sl 0S$$pP]  T"0SV 0S^^pm 0SII@9|"0S@ 0 0S@MwM,pU 0S-k-pI @t# !0  0  0S^U^p3 0ST?@|GT?@dp"0S@80pPp0S 00CS00@Ӥ0ǭ@t:00S0#3 PP 0忐l0 0S0 0`00 B <00ST06#3 0PP@]l^ ^ܽؽ]L5P - P0ĐL0`p@T [PP j PP|t00U T 0S0`00  y 0S^<41dL5] -L`>Mpe 5b0@S*8JJJDJJJJJJJJJPJJJJJXJ`JpJJ@@@@@$1 1@@ 0圙 @ 0 1Pp萟蠟@ p0 0R000S00S h00S\00S`00S U4 P L*D0 tܽl^ a^ؽ\\PMЍ  -LL0 L \ 00 (0 $0 0 %H -0L0  -0L0  -$$ 0L00  Qd d00A00d0/<R0R hT>h]l^ p-0LxMPK`@ K1e00 @PPKRP1 K0400  @T0S H@K@ }e40 ,P Kp$i@ 0-LHM\@KPH dH ]e Ye,0 $ԯP _K0$iH 0-LHM\@KPH dH ;e 7e,0 $岯P =K0$iH p-LM*@KxPx` dh @嗯pP  d0 01Kቯp KpPi i  -L M K0, @$0 x\p  0ߐ06@K|P`x  `odd @SpL  @rKJp0 K%%Pi i  -LM"@K GdTT0 L@)p [Q"0[S "0[ S }KPi   -LM0@KQ !d!d  P d0 P <- 0|`p@P0S |0  | 0S-|-㶿0lS  P嬿PU@K$i@Thpx]l^ -81LM@8Kq`P  cV@! V/P  0xp@ 'PK 0K0C 0 ,Pp` K0 Q( K18 P|W K{10S - 0S ^KPEh@pH`5@K"4P@2W[H[w[ᴇ[ᰧ[4[[f[ 0 `{ V{$  0S  嬾@HP0T00S |G|@`PKl@{8T W L{(K$iHi@]l^<L -l@Lh cPPL0L Ꭽp01S(h |hi{P$i  p-L M.@K `bP0 @ip'  b00SA[Tc0K 0SK XƎT001K,0H Ap4KpPi %|J%i  -L M K@,0 Q$`\p  0呎 >0@0P0S  p儎hOP\0@Px`h@lP @OP,0@Pp@tP|` K@B4Hd<ldl -LM` p ,0 0  0 ` RS,P P@P p-@P`L< 0ppqp|0 $4%t -LM, E00 0@`< , ppq, d0@ T@ @L0 D0@$<L0@0 0@ p-@P`L< 0}ppqp&0 ΍  -PLP0S 0000 t㲍d` <@`p D@$<L@0 0@ -@pL`@1P;P@TP p-L$M@`P xr<@K$ dPa` kaT P@ 4` ޫP$iKpL$i$8i$L -LpP P`P 0p q0 L,D0D@P` 0t@P S0p -LP:X00L @80@<`p 0 -LPX00L @80@<`p 04 p-L$MkPP' `@ .0P 弌` @TJ{KD@K$pG@pG J[^ ^ 0P ,p _ 傩P €"4QwJKK$@D`@@DP 0STw0|S  `?P@40PUZ @$K$i i ,]Ll^48 -FLM VR^0K0 ^ 1JKp8 B^d ^\ #@K`4 4^( ^ $t@K  &^ ^ F@K  ^ }^ \@K  ^ o^ @K$ ]L a^ Pݨpwp3`v`3  2"RS XZ P7W @[ T KiZ[Q 4Q v.@K ]X:LPK *P3 4 4KKt/OKhv ]{K ヴ  ^3 (匨P[P Q[ U@ @ rF@ @ nFzFF`ZvVZ 1SWJ_K3Z/K0  0S 03 0Zp<`>AT1S1S0SQ !000C S0:S Q  ~Pv`T 0S,Fx,Q`V@P T2S0S L0S$K "R,0S) 0 0 u0 p0 uLf4a2Sd0S l`u0` ħP01S <10S  咸|010S  t僸00S 00S `p@c(KP$i i8i4iiii$@l^LT`itBl| \i ]   -FMLMP| pFu5 5%5Q 8u5Q 2u5Q ,u50S [ pU 0S 0SS0-4u05  `@K$ u eF8 0\ \ PW dt0PXgQP  t, PphtPK 08 P0R4 L0R% 40S  崷30S((婷 08K30S))t噷h30S\  H厷HtbP30Sp\`34ꈡ< $ @Q R Q R 4D0@0 W upit 0h ㍠00X,P0`V Up N|4ST20SLBLR 4T0@$0$@SGNKP@D/`RK`QKa[x [1 APR_4[S_nK`[ <PP-P ,[_[t1_[p!Q``P6>K@ P@6NK>@&^K`[6K <,P ,[0.KsT $s0@ PQڤs (K$<,D]l^8i8 4@4PKiTe \xi | 0-L$M8@KP$ Z 6[0S '[0P00C S\8@K %[P<40 ,囥p&K0$i$ 0-L$M8@KP$ Z [0S Z0P00C Sl8@K ZPLD0 <ep|0S K0$i$< -LMpK@P4 `ZtH A ` XZA0K0 Z1 6@PCZBP 00S0xS 0K`# P 0 S 80A7S$㏆A0[S K Ό@ KQP00@KP 0 vZ P}h@K$ Y\ dZt P`0X X0 ֤P@KP$i L\|i4i$8i$L -LM`pK@8 P`KY@ Y0tP0 L0 0P0 b P1 P0 0 L H @ 8 T P|1PP0 00 C R0:S@L P$pK@` <0$ 4PE $0@@T0P0S+0(0 YP000S00S  (Kp(P`K $0K$ @(uLT $0D` H0 `@K\ YP0 H=p<}{ K 008$i8P 0-0LM0Q 㙅 &PKPP  @0SlFP 0S 00StPU<n 0帎0H$\I` 0-PPL0@S0s 40E 0P00@0% -LM✄p0S0+S pFP`IOK`` <(*P $,!Yq409 OK.X YK 凣P 01S z@K X032K4BKOKI_K4[ <T*P ,,X4Hq_K.rX  XK2 LPc01S zKw%qOK.OX XKL2l )P@01S% Lez"42 8q42 (p42 p42 p42 p42@ p42 pZ p10ST OK.X\ kXK(1 pP01S: Tz7,"(2 4"02 / @ PpK0 UTPpppK0 UTPpp 㯜$K $"i %i Ii $0<HT`t(%Qi [L5 0-LM@B0S0+S  RW$KDp W!TP k01S y _W 1 10 xA$0KX1|X!7P N01S DWDny W1a p1 <8#"o00 @$0K0 P 01S W@yd\ xWP 2top00Sd  PŲK0$P`%i "i #i ]l^ -L M(@K 4QV( p (L`PE(0 $0 ` 审p ( $0S$ $ 0冺p@PU 0S  xppvoP@$0UL00S@  ,]IKxi <d ]l^L5 -L0 ,V(0( cp$Pzi  -L0M@HPK`pk$ aV VV$K 0m$ R@ d层@0X-Sp@dCP4@  n000H K"p Ki$ 0-L$M8@KP+$ !V VH0 @p0(n$ n K0i$b -x1xqLP`VTnPAQV0P00C SG0 ҠPX@=  ȠP @4 ᾠP-0@ 崠P01ű0 媠P0 00d0 ᠠP0t 00<0 `喠P0T0 0  %$i zi i i D~i i  -2LM04 SP pP UP 00S00C S 4p Hp,K(P d,P 00 80 }W X 8 0R00C SBPn @ BPf000C Sb 00S .@U  aR #@P 0S <yolt| -LMp$ P'00 7 ' W @0 @PP 1 @@0S4 KⱚP3[S0&0SP00p|/P lVPfh@\6 10@GS@@@@@@@@@@@@@@@@@@\@h@@@p@@@@@|$@@@@@@@@@@@@@,@ @L4D@@4 5 55?4 44444 0s4  t4 04 4 L4x4<4d4`4 H4@4<443$4 344333 33 3 3 E3 3 3 3 3 @40@1 x3 @D3 `3 T3P3 H3 @#;4#00000#00#0"0000O"p 2 `r00h2Pf0S20S|20SxL20St20Sp20S@k20S@jZ,K垅2 R $ 1!0S 0S S S! &!10S!t1!0S110S S S!1 !(10St!1T!0S`1`1000SP!00S  0P KHh: -LH R0M`P` 0$ =&&V< P<P v,< 00< H  o[P =  0D@K@"D    RX 0L P08l0$ 00F00b< D@K@D ;R5 0t DK0PD L R0e,++L0Kpp0<1 1D@K@κD 4˟R 0$C+p;P@eTʞT %11@K0 P?    7,0K P x0 ,0dJP xPLZ P,00S 90   峚,0PU R D Y;,-]5S1 @K L?   7,0KP P Z , 0SPU `@K -;,]8 eP E80  hXP`K@)p' 0P@ p^P2)0( pTP(8 0S   E80 7) H0K7PL 7D(0S00070 7>0>40 45P  8G000  ;>D:  0KPU40  )@& P0KP@ pP`DD0s b4P<yj45  )000 00 0^W40 S 0 P0 @Ph4 r K$K0*K  ) 0/Pp#0s 0) P8L0S #L0KPPKP PP KP*R8`K@p)$ 08@ pP_0)% pPd_X20PPpD @698392,PV20  KFV`2 >V@P %5 0r % 5 s||l10@|t1xKlK T2 00 @2ONK0"0@D@D((䠟E ŸPU  P0@R!000S* 10S㆘|1@T dAP`0S_ !H@lg ,l^&T?p&.A''L5px&д!&,\\ x<PlĵжܶP 4TtT'u 8DPpxpt&@^ 0   4`P0`K`0 UKP`ڔ0K0 00 40T0 X0K0 |00 p5@K X0 P >P0SE ^h@ yP;0 8 :U4 j 1, 0S)0S%:v 00XMЍ 0-8P8@L4 <  0C^ a$  - LₗhT -LCM` E0uPP4 40 00 =rP dP jPTşP4 aP1 uP zP) tP*P0 $ 5P!Z4 tp'0,K ,04 S Hh0P4 $p40St4@00S 4KnpP LAY٠pq$ 1 dR 0+S H@TPp 00F S.VWp jP`V|W0P 0p `;P X 0RR!>C 2#=S0N;@ PUd<\@ Td0 T?#C0 2#0@0TT!>C 2"0r03 R0S 00C0@0TT!>C 2"0r03R0S @0TT!>C 2#S0 0RR!>C 2#;S0;1@PQ0Ox1pW*l10S LKfpxF D1LPK`@K0S@@0 <@ 8p (p<0 @K@@ 0@-b=D 00APPQ=-C0D 0 L0@R 0 -0L V a^` -L0LM@0@K*00$B6(0 #pc\(LWl -LD0D 0s0 404 P 0h'&$W x -L : p-LM@ K``"p,\@ 0P0:T@pL 70<0P0_*5KpLWl(@ -L`M0P@ph4><> -QL|M@ pPQPP ? 0 吠Kȟ 0P3G dP lZ0[S`,0  K,K0 i, `R ( 0G,0S(KT>4h> -p`LdpP LZH]sP@4@ TsPp4\ p-PPL8`@AP @2S @p/ -0L(p匀0O S#`@ 0PQ  /p00PP00, -0圀(pL0OS##` 0PQ#P P p00P0S  P, -LMA`B0@ 젟0 , @lF0S+ 0@Ps 0\@P   0A0 hNF, @R00 V0S 8BF000 >F$F(K/>>>\E> -鈡LlMP 0$ pp  Kop 80: S YQ #xpcO#(0 @Q0@7< @@40Q0, 00  |0 P`7H$0T 0S 0S 0S 0S 80 00$bY$KL5,rdA?/ ? p-oLHMP`@ `K(\0[00SDL0[00S?<0[00S:,0[00S5@P0  K( 0R  0R , @P  K( D0R  80R , KpEFI PART 0-LP@P0,(0 -L`@PpP,~( q0 [wsd -LP`P2E =D.E C@,p@ :TL?\? -PLM@x D(U01U01`,0pK0po` +(V K -LXMtKP @p,4`K0p`^W@ <7P @`@P`0ptK@0S S@ 0  QRs000 0S\T^ $K, M-LHM @0 `' `1!o$h@K = @ 'p@, Ό @0 @MTp(K -PpLQ$RPR\ <+)0+,! = j1娀K– !U pP pPO %T8Lq (@0<0P0@000p(0`p 0@P @Q 0pW@ P$`P` PU`8(P,`\@ &#P$w>  030 S HP K hP$KA`C`0CCCC -LDMŸ 2RP 2Rb,K0 几,pZ  04>,@ `>\ XKN@ `@ @Q /0[Sc , `D%>\pP✁< 00C  00C p 0\0!0CD1S 1  0!0C,0㔓,!1R1S!  00,0㔓#\`@P00p0pp0@x0v``XK, P(K`0EFI PARTACD(D@DTDlDDDCC -Lp P d@ ;X@  \EFF` -䐟䠟(PT@L`p S*)PP!(0@'"00pq E (0` @Tp (0PP0T $X0P,`0` p-LPP0HUpp`\ f!)b! <7@@0 PHPU@@p\ F!)phA!`0`,MЍH 0-LM Pfp ANK@D+0E P 6@P@ǿ@K0 -0LS@Yh"sMI -0LSh褾fMI -0LS0ShVMI p-0L@T PPxg0`00P@`pL50 p-@PL`l lZ`\ 0TC0P0wP@PpI0(I -0L G a^0I -2LM00 S Q 10S 1 o1 0RA00 0Y 0 00S SI|10S? p10S;00^SY,  0  00S$S00,0 (p0S00p`P@ 00Q0P, Z00QP0  @j@a ` P@Php\P`@ 00 #0 !0 0 000(K46467877 7II$ @II 0-L@c@ k PPdU 0hV -L,MH L ip]8 8 0eS fS8 8 `㬘嬈pD @ <` 8` -eU *HU BUAUk00E SOEU CUoFU GU UU LU RU IUaU VUbU cUsU lU hU iU fUoU nUqU rUpxU vU  `7uU U yU8'U 07UW00F S7 7 6Rò 0 00C00 ,K1f, RAU6P&00& ,K 1O, R P<@6,66 @55 @5z%00%0w5 q5 @5<0F@j 0㮴Y5 ]5 Z< Z008 <0 ]8 08@@ 1Lr0%00@ 0A<5 ;4%40 %04 @4 5 *4 ' 4$00#4 $0@6 P 0 P0) P00 K|4 l4D0`pSpD0 @HLH$H4@ypP(4H 0c80@ T8d3P)`p嗼@P 0 S 00K P0S0#3 hPP  hҳ᝻gPU@ @R@X00S X00SL0  :H2x304 SQ y(20Sp"00020S P2 0 S u|B|tRd2p` H"L0QP ("0B1 HHP !d |QP\  50S+d n5 0@S5@ 0P0 L@ 5@ 0H0 D@ T d T0HK0P`0@TKH0 D@ P< T R 00S S0BT0 P0K 0e@T `RP0 L@ `` jH0SX TD4X 400S 8K00K 0@8 4 00 ,@ |4X t4T@P< 80K8` 4p 0@ ,P (P840S 8 40 0 T0R,0S X00X0 8 00R4 ,0R X0 3XP0`Up30Scc0S z3Z @3\00s03P0Sd$# Z Q00S? 030S;$S0S7R* 30SQ b 0R20SR 42 2R h"2XR 0R08 KTK:^ T2(b TKR8 K-U00C0(20S 0S0`KG Z` 0S00R0S QTK000d` `d` dP 0S!0S T10Sl10S t10Sh@3`d3d0Dq@S@0S00S q4(adP00S0U0S f4T 00S0S0Sp0\`00s03V0S 00S 3\00S(d(KdI<7(7L5X0474L647D7T04444660744L77b8J@78L -L }@P⤀pP`4S S S  0`S Xn#P{P0S x(7<7L5MЍ -L 0y^PLhLL -PPL, `P( @{P# .P 00oP PphP. P p]P P@TT7 -PPL 0SFnS0oSP  0@ 00@,`PX0P@㈯p`Pp`,uP$L7\0 0-d0P@LT0P<00s300S @00S0\0L7 -LM,Kph`P-;Y Z fP Z N `P#W t ,00Y Z NPW t ,00?, ?CP@OD⍏H_E`VZ -GML MPPMK @D @DảPppKP`0: S, KpP  Sd,@K P pP zPp  spPt7`,@KJP1  @P@PP @@00 :@P P:00`P X00S H 1@0*P$B;KLL4P7LX7L5 -LM K㗱`P?p_Ct 0P@Z P tP UPp_E`VZ -L`p2@@P@"hP aPP fPtP vP0 P0 0S !E0@7 sp0@d  P00S &`00S T00SX_UA oPP@PlgX7T7\0P7M\\4MЍ] -L ,~M^ -LM0@00C0S0<0K й00#?00S  DlgN -L M@P K0a R 0DK,N -L M@0P K0F R 0DKK7:PPl -Pd P\ UKP0C!0C 4.@.@T [&(p@ P :A8$ " Rp10 NK@DhQ@D0`![k0S Y , 880S0S KAYA 8 8 R@,K 6P7 ,0#4 P   T q(Kh; <@xN`7,d7NNql0N ND -L,ML HKPP0AH0 D@ @0 <@ @0KH0 D@ HK⠝P7|^ppD h$hhth-0+0K)Kl\> b\* N\ T\Gd\ f\ t\f n\ p\ v\ y\ #00#000#000+K *Kr}4K 屏px⳪4 c4El1 0KD00(#S^ AP0SV :P 002`@  P 2=@T hH5XŸ0S pZA R8  0SLnS0oS0,"80 00Ÿ00"#8KzP 1 1 n̷L!ppJ1XL QJX1!X11=C@| FP P pP`%q0P q0PY  ` p@`pP P P @  0X* (KNN,9p;h;lg`7d7O\7OO$d0 `0 a^,OO\\T'Ot -0PLM` A PKp%`  <`p`3y$@0v03T0S6 p-0LSP9 @P P P)00S S  P Px0`@ P\000s03@T 4000S0Sppt`0p;d000 0 /0|0x00/00/t0 -LůP5 RQ-L@ @P% P-L P 0-/LPᑶ@P000+0/00$++0h7  p-LlM/`s@P KP0: S 0PrS@ FKp p-`PL@P00S 0 R  ,,%VpX00Sp ;XD0D R 4 ,(,$0$,5x0|00$ a0 --LM0 0 ! --LM0 0 K --LM0 0 K -L@ h꘨ -41LQM pK  P@`KM,8`P10: S 0R 000*YK@Pd1: Sp l+VPP S00S *@oP U@ Kt0\l| --LM0 0 H㗵^ -LM @TPp`>` 07/ P  0S0000 -L XQ%;lQ dQ fQsQ uQ pQ ,0S00A >., $ " P@ p`0` p0@P|xQ<0`80p40@00P,0(0$0 000\AA00AA aTQ^ -霐圠L`Ppp|0 0@R 00CS00Ӥ0m6O P0@`FVlALA] 0-P0L@T0@P0S 40, (6@ 0h|ZXA0A\l^A rZ A -P00 P0LMS@ PP P@0?0 <@4 000K @a 0000B-0 CR 0R0 Sk00 -d0LPT00SD e@00S4  Tk0 AA\]l^B -TTTL`H"0S0 S0$@{@0kvP U0S0S 0FS 0@_S0Sc 0S0_S] V__U0S 0SW0_ST_UP`F@p0W! 0' U00S 0S 0FS 0_S0S 0S0_S W 0 p U0S00S0S 0SJpjW p 00S `0H婤L < p`VrZ@p0]A0l^A@\hA@ 0- 1L0@S000S 00S . j*P 00S  j00S0P t }P0TP0@d0S 0ij@DT  0 0BA]l^tAA\ -LH00S <00S000S$ h h@jAtA]l^ p-0 P0 UL ` @@P ,^ T44KY0@`p00@l^pQ -0` 䠟 LPpB V:`0 0pC@0 0 @R 00CS00@Ӥ0p9M@ T t00@P 0000lA]LA -<4LMp040ğ ,4P`0@ ^, B 00CS00PӤ08MP300S0 U0S ß3P` 0@^ 00CS00PӤ0LP8``P W:<p0 0Cu "W00Dž0,, 0c0``00 U2@P u UP1"0S 0V'p0S#d"P X2@T0D"`C @2pG @ W`:p0 0C @0V 0`U00V0S`F U !0S ^00GL000`00UU`p10Vd10S$1 0@P 00CS00Ӥ0xAL Ug PpGd b00VS00S 0000V 00 S `0R  00S p00S 000, 00c00000lA]?LABAAAtA\0A000A 0-0L0@S 0 =, 0 \  tP0S T  Tm4 4e,( 0000\AA\BTAAl^A -LM`PKp+%\` \\ !\# 0S0 0(K@e0S( K|@e PD"Pp0!S%S0` \ K (KAAAAQB 0-PL@0S\h0S 00CS00 Ӥ0ᕆ^K r0]l^00S tg]l^ -ML MDeDDDuVPP0 0S0 R 0 V@Pc$T V P BK@ @L Pʬ4 P 0 KVPD- * |43[S0X! 2[PDS0< (D0S( P 4   P$000#0SP0033P 30S P #000 3$@K 30$3 3 |3t p3h d3` \#P00L P@ P 2 (@K  P3S0  cP } 2P00S20S0 2 2R "2 t2 2  "P00(@KlV P `2` O TRP 0S8E 42P   B(  @(@K4 1/ P!10' P " P 1  P!10 @1 p 3 {U?aKPP#P30LL!#10#P$ ` p  0@R 00CS00Ӥ0 3 C P0@`FTSpV<3V` 3`2pWc2pW$beŸ00 0z22~l y |2j2k$000,2V0`S//L`<2@@忲!0S   ypKN/ P3L   P10C6t0S 8*p10S" `1P TA0S  841 1 0 h RZ l00S` _ L_0   (KA????AA0]l^\AA\ SALAAlA00SBDSAmB0ATAATS|A0A - sLMP`B,Kp@i "0S ,0S0S2 "0S,00 20S 0 S0S0S p2h"d2,-0T00<20T020S$ t `FV0S A0S 1![00ɱ1 0@P 00CS00@Ӥ0}B@t 010S `1,!30S 0S 01 ' 0@0@@@`P 00S 0S]00S 00V 0S 0L | |00 @L0A0\AB0FTAA\000PS0Al^]lAA0AAAABLA 0-LMP0 @ΡP0K 0{P0[ [$t0R0CR0CX0R P0R H0R<!0 0㤡0 Ee tS -LlMK`p `\10S P1H! 0: S$P?1P@q00PP߰/P0 0@P 00CS00Ӥ0|A P00d0 0@H0K@ 1@ Kl^\AA\SLAlAd]F -L@|MPp4@ @@ 8@ <@ Kp壈 '7@07@P7p7'0?00CS000'0P> 0S; o9l 000-Sd4+S80/S<00KP <0 |&80080 H D 00L S H0K$"0 @  H D \H0K0@H0 D@ /pP`h00CS0d60S X60S 0S @60S 0S (60S 0S 65 &0S500C05 0 Q40040 50SQ5@5T,0 %` @P @@ @ TK@PT@T  v@ r@ n@%00040S  40S Q4ğ 0@P , 00CS0,{, 0p0,@p W l$P`0@,(40Sw 40S 3$<0S K P 30S000C00 80S HK0>3@@|V40#0@40 0@KJ, ,0S X#@00 @@0S <0@S ,K SP20S000C00 80S HK,0 0R20S0,0 00Sk \20S@0S l"0s0S 20S 2(" 40S@ 20S 10S 1!d10S10S  h\PA0S H1d!e0 0S 14!YL@; 00  BS0 0PU , A,0000P屮,嵝 0@0 @0 @00000`88pt 0R:M[S BAA00S\AAAAAAAXA^xA]lA\0LAFFSl^BS`ABAA -@PLp000C S 00 B00C S 0.S 0  00B S00EP@000C S0*S@7/0@SUP0 0B8 S𨝈88 70`o@7/T@DFPF p-LM`0`@K KKK`K%tPP +:0 000Kp? -0L: _sP? -$0LM KsP? -<2MLM@pPPPPIK @@$0/S PIK @@ P 0S IK @0@! P :IK @@IK @@+I>K 0C0C K 0 :S S S:S0SR B"*0S0U0 0S /S EtP(`K`  K&wPPT00S +:*P 0S` T00S $0P 3uK?`XhXXXX= P-LpQ 1`@@ f%S``03S .S5 %SW +S-2SiSK rS dS TcT U*d[d000<@ U* P0 U* /0y@+ @)0@TT TY 0S Y 0Q   P@ T U*@p@ U*00S8@@e P*X??FFQ?MЍ -L@P ] -PL` @Pp 0eS :P  0*W + P:*@ pPt  00  EP H * 8 P, e]]^$^H^h^l^ -LM04 p P@@@PP` @  4 @  0 0K  p4`*0S c (K^^^ p-LlMP@`^P Gp@Q p@` `00 PBKp 0: S  "*Kp41^t  ^_ -LpM  KP 0: SPKQP@@Pp`T 0SR )P@pl)  p DP Po@` j0`(K _L4_ -MLM`p @d^KPE` p H徒$0KN 0* :$K4_ P-L  ВԆ ˒)<^D_ 0-@PLPhP @T P@P  ,j)(* 00h|_____ -LM Fp `CpPh h )BnP% cP" VPeP mPqP pP sP xP W ` 08 ꨨ Pp"WpŸ 0@](P  0GStV Y \P PLHEp \|0u03Y0S Pq INK@D @D! 0p  PP1:(W^Y\ ~KpGV pG0K⤠KZK= `J0 p P000K0S@ 00 ,@ '00  0 K 0@K0 !IPp  ^p 墑P@`T5% j0@ J  0 K (K_lg_\\l^_41$tx`(`0`@`X`@-@|0  " 0|0  "4\ 0 ^|-0,0C/1Q0#0C/00CS00 c0 0c|0x0\0nx0A0 0b0 01 R|00|0/ 0-LM@K P 10 RK0 p-LMPK`FOK   0RQKp -b 00"00#0\ -LM@K fK00 !0 S/0 0S/-0 00\N-0|v?M0|0 1?01 R  00b0QЍ.A-0MP`  0S3 0 ##\0 ^+ @0!" |\|0|0@|0  " 0|0  "4\ 0 ^  pAЍ -LM⤀KR^KPEJNK@DpIoK iK K oK |`@@ TOK/Kf@``V/KQ`@@ TOK/K;}@y@u2TBNK@D/K%jg@`b`^dVB.K BTQ`M`I2V/K@=:74 i/K$K -LM`KJNK@D# I_KiK  oK P@@TOK/K@@ TOK/K@PPU/KP@@ TOK/K@@2TBNK@D/Ku@PPdUB.K BePP2U/KW  M$K -LM@K h0| 0C00CTK -LM K0 0 R0 0S K K0@- MtP @0 0 c / QB @ 00#00# Q0 Ѝ0DY -0L!M`PK  0BS0KK 0SK 0S| 1##0!\@!P?1!K#$1! "41 00 R5 T 1##0P@ ^+JKK0 #$ PKKK0 0`0b/40Q$K8协Kp@ KKKnK@XDY -LM CK01 R 0 0SCKy K 01 R/ -LM CK01 @R c K 00 @R0 0S@ / 10 R/ 0 S /R/ 1 BS /R/ ! 1LR*/|/-0 00\ "4\ 0 @-@  00b0n  #4\ -0LMP@K  0 S  1##\0 ^>K0 #$ 0K\ K~K` p-LM@KP`d Kp@-P`pP@0000100 "#  010 " 00000#200 #  000 " 0#1000 200\x0@0P0x010P0x "# R |0100#R0|0340P0|0#20P00000 <- 0@0#1C0T\T00T00@-@P0000 "  010 " 0#100 #  000 "  ""  020 " 0000 "#  010 " 0100\x0000x " 1 |0100#10|0#10000000 <. 00#2C02\200200@-@ 0 010 0"!#1 010 0""#2 010 0"##3 01|\0| |0 01|0| |0"!#1 01}0| |0""#2 01~0@-@ 000  |\#|0| 00|0@-@0 <0b0  |\#|0| 0b0|0-   00|Q"Ġ|0 00|0|  00|\"000G-Pp`& !0\.@0 .Q@ TPG@ G-@pP`&! 1B$0l\:  !0LJ$ ^: 01 @ 0 0:#P`@G0@-P 0@C0  # 0"00 "  \0 -ML M HK00 R)0[H [0 @0;KH K)0K A 01 R;K KA00 R02 0/K0S0H4 =K0C/KSY0HK 01 S20>  KK-K?K@A BMK@D% KK @A#mK`FK A)}KMK@DpGK A'KHK A+K- K%KJ@A1]KBPE >/MK @D%-K B 3mK5 K `F@ K%rOK-KA  RK04ş,"00|Q"$L1## 00 RK  0 0|P"0-MK@D0 K]K0 PE+-K B K K@rK!MK@D5KA;mK`F K@K  KI 0@K yXK H00 Q9}K`KpG_KROK rK oK !MK@D p`@@ TMK@D!-K BX}z@v@rT-K BChe@a@] TMK@D!-K B,QN@J@F2TMK@D-K B:7@3@/dT-K B%"@``2V-K B  9MK@D;mKr/K`F7 K @@ 10 R7 K@p rL=K!00"0 0#P1 1@0 R(KAY M-VMLM@00 Yp @h?XfKPa 00 P 0 Q 0 @ @P 0 0Q R@K 0B_KSboK` @ K 0@KH@K`KA 5P ?  ?  ?00RP` 0@Q5 R 0@Q(KDZ -LMpK@JK‐joKP 늏K J= C HP C 3  ;  7(K -LMp`ᨠKPOK  တ&  "JK  =   j_K 0-OK+t ',#  2  2 2 (KD\ -}P`L@    h 0-L@P ,0h -LMM KK(@2 " P" K(@ K(@}K! K(pG(@OKzK,(J:K0S x00 e.H0@&ǎlgRbcc\\$c,c@`cRd]L50TbHrd R 0 0KTf-0 CR 0R0 SE00 -`QLP@p$0CV3@ 0P,<S D0SD@  R@0 S0SP(00S>i>iD] -QL@B <84!010S  DpP WP Pp0 CS   ^P` W UpG t0  CS @` VP<00S$ X fDmۖhfl^l4]q p-LPL`@LD_8 U0Y$ O phl^3xff p-/QL M`Z QW "Q Q;5QP 20AS4K7Q1H@K0P uc1\%  0K1 bc@PP 0 0 MMt0 hdd0 0 S L00S $ 000, 0S00KpVfffdVxY W -LM`@  Q (KoNCQ HC P  (Ko>C 0\ p P , 5p P,p @ % Q Qp QP Q Q,   Q Q 0S0S0S0C000  ^ P @U@00R 2 pT xB0P0' `ePW 0  8ZY  (TX   M, R A @,  A  Q! Q! !5:Q! Q (Q! $Q 0Q! 8Q! !!|!|xtp! ?,Z X0@00@P LL@TP,(8<0 L L0 00S (Ko 0    00S (Kot (KoB(KYfg4ghggWgggggee8e8 eeghl^X3 h4hThhVlhl4] -T L0R S S0RS P0 `Xd0R p- 2L M0`S{ Q Bu0A0S1|0 0CS8hhg4hph(@KnP tf``XX!PY<D!O =( LQ Q DA i++  095 +|00S 0@00@P iK@TP8 <0 L L(h0 KphVg2L5xhhhhhl^3hX3hhihbi4iXi -L@p&&.laT cT gT D0S8 0 0000 T4(ß0 0c3 @  p 330 @0`0$ 0  0`P p3tC0dS0C0PP L3P0S ,8 30 $30S0C0@@ 2P0S 20 20S0C0@@ 2P0S xP20 <200S0C0@@ 82P0S 410  20S0C0@@ t1P0S 10  10S0C0@@ ]1P0S <10  x10lS0C0@@ F$1P0S 881`0@fS@ j 10S'Q WPYp@&.gP 0S 0R 0Rp8WxVtVVSdV2YYYpWhViViii$0$ ux~xЅj aj^0k P-L@H0~p4.x8 뱄P~YpkL5 -pL@P`00-S*P P P P P +P P ` ``x0@T  @Tp!`@DT 00 0VY|Y -7LM 0R`@,0 z0gS&䆟{8 < 4 0 6?P0-S0@ F6S |D}$|D}D}|D}}D}h|D}}{4|{L|z`zxz{D}|Lz{D}{{D} }zz}||D}{D}({p{|,}||{}|D}}}z}D}},|{% 000%0000%000p%$00040X%640 000`R 0SS 7v*`R 0!S`R 0!S40S v0!S 4 0!S| 0!Sd T$C{q{o@$0>8$0;0$7pezcyay_|]{[`RA  `R;  iN`R4  b080 E`R+ , KY < ;`R! 6`R  JP#000+`R 2%w#`R `R 0 "0, K& DpL 30-S.P P p&P" P +P P! PU iPL  \ PUFPEU 3 0H0 0D0 0p80 0 @ < 4 HK,PK@ 0@@Qp# ,Q P p 0@@;p0 S \,0L)p<Wu420S (F10S Wp @`g0Sb0S  10SW U1 0R 0SLL R 0SFZ 0 SA0S> T!0S:0!0` 0  0PP [) `0S 0S 0 P A0S0C000x6t0@ T:o(K`V|kpYWlYiLljhVm4m tYLmdmpV|mm -PLMp'=3cS@ nP TP dPtP vP qP22@ 22u@@"T:p|2`t2AnJh2PP p(2@0`fSZ P 1 ht PF%r 㺇1pL T0y,0  0-S]D@PV PP ,p `FVl1 ,0K pL& 10SZ (1 0p  T 6T 0  &+"'p tT T T T T `0 "|lgY|YtYWpVhVlVm\\8V`VmpYmmj$00S P"/!P /W0@-p0Q h@ .P0 a#2 B0L0R00PL0L OQ00B0SdPꐉ /////qh:$q,q0q P-L   <4("4#6  4yT41 -LQ 0S 0S Sh謯h"0 ~8qT -LJM2CP8@K 3 208PKS7`K00[S/0[0SS/0[0S S  Q"[-K04"48#8 0 .K8KS"SH i<0 K4U8TSq -L-KH $M0R 00S \:0-K0 Kd p-L`!\P@p0R0S   l T0Sꔓ,($ php$qh:$q,q0qq p-L^P@` !^p0S 00SS 00S S 0004"48#80   "10Q0S T@ph/800S (ph&0 ph L5W$qP P P !P($ qqqqql-0 CR 0R0 S600 -PL$M !P   1g!1 S10S PB !P C P !P" !P7 P   S S0  00S 00S Kh} Kho6"P   K$rr,rr\qrrrrrrrPrrrrWrshVqs]l^ -LP|0[S ]oyP 0 :SSp`  :by@P00 Kcl7T00 00 T7PK0`K 0Ӟp@$70X p@K  'P0 0@T YB 1 " =g0S 7 00P嘦0oK<0 D00000 <P T,~ ǟ0S '8 k~< <0s# < 'YPx0S w<0@wԥ0@<0  00p@K00@ 0ầPꈥPU0<0S d0<T,6  0S 5 0nk$P`@P@PUP蔟@P'k" P00  05@PUPP8@T' (50S 58 X5k"R H4Hğ ,$ 0  PL0SPKPP 1P !0 S00`ڸ'0`!0@LK P KP d0BP0 P R 00S S S R  \PP`@pPP0 OL0(!S DtPtssstttttu(uPuhuu4Ђį\uu<L5uu0vv8v Dvvvvvvlv|vv3YK0C0CLD `4 PD ,0X$:P PL,0X$nP ZP l ZP \6@ D\$@)pLD  0 Z@PH$R  \$pLD PD %,0LD PD Xp/ۿ:`׿@@ӿP00T00S4 T2*P0#03V0S+ H40@0ỿP@@ᶿPTT*(-W 0S ,0X$-,0 L$ P$ 0P -pL 0L4 P4 0[S]㍿P P0#03V0S @T 0:S+0p0@T$ :t/Pp U P00S P:R V  R0305P1 : :Y ` pPP$ L$ PW 0S V @@V 0S /tP@@@`@ #0S 4#U0 @0 t2PPp V 0S HrPPPPT 0S rPppV 00S0U0S 1@0 @K080 <` 510SB T 0S @ 1@@ 510S |1Vt!t 0fU 0`T!@`DH1 @0 <@ 8 0A01P@K@0 P\4@KS4 \$8 7000CcS,0 &,0Z0,0 ,0T$S[(00Sz  (K8` Tx`xlxssYssx a4xĂxQPx41JX x=n|xp -(@Lf IXx -(@Lxf 8X y -Lr@0@08S0 ' . r@ ]X$y(2 -@ LXTl" 0S\\000S@8@882 0P0 ,ΈPΊA1 APAϊaq0A@<10<D1D1@! 00pH1 H1d0L! L1T0P! P1D0T! T140X! X10\!\10    0+11b0b+{ +v+q  0S009/4L]g̍(t~l~t\8~@\ -/LPr@P00T 1TAJT/00Pp@+, 1`0P.000dX0de9V`0pT ``JpP 0V0U.SE 00EPEW HzTyYX`y -LD 0004 -L900 (@(0 +e}4Xy( -Lmq@\0\0S0 &@ 8 000Yq(0@0S]Xy44-0 CR 0R0 S+00 -Ld0d0S  *80_}0 0(00 00]X4 -L q0 @0S0Sq@  -0L(M`0@0V$0 $DK$ KPPp00޻C0[PS (  (0KwP(0% K耂̍4yy -AML M< BK+@$,$ m )0Kp8 4 p@4 `BKT$AP0 `T!84 @P񟗰  D  0#C  0$d|t<4S 1  30S hC|d|l#L3 TP/ D RR5V(U&4TV 0V04V0S30S0S U UR2 c"0S)U 00D S`2\ 000C00W82 0BSpRdppU00W0S 00D SW T)T,000p ,!pQ,45@4,4 5dW(TpU-T4$R4$1 4$ 04@V`S@404 5X!  P@?L0SS5V4V410S 4!0S  )|XBK04A a R+##4Q 84@T S8D 8D1V00   c T h0 TR t00S 0ZZ :/0F(K|~xXp(yyb]{(t~4 p-AML M8"0, S (P 2P j(20S1   u `BK0@!P10S10 1p$BKA 0XP mXAx by{X10SX10 H1V$,$R( K 10S,4 ,H$ !K(K puP B00S0  I ,4S 1[ BNKP@D0S,$ ,%$+FP8P<00S0. Kp((4zp<y]L=Xz' -@L0S # 1 P`P?SR𩝈dpd0 `@ `-(z0S𩝘40  14444(4 --LMP@p0T0`'0 P !L 0 @ 0 <t6bzh0 `p30PST 4/- K(4dzpxvt~z p-,DL0 M0 4 0 8 0 ѹP$@ 3#3Q0$0 3@T 30S 30S@@S0S ]P 3a30S l3ta~d3 0S >@@pP4|PP7(  c008 0 `P@  Y(T 00 0 $4 LP`B000)B% ;H24 h80Pa D2 0IP ,20S 20S R0S  @T$4 PR 31Qp30S @T $4 |P 0S8 5\A0S @1p30S! (10S 10 1"0,K , 2KsP 00S0   00S 00SD0   Kpzzzp~|zXzzp{|~dP4{Lt~]'L= -@L!M 0R,0 0S 00SS t&0KDpKK 0p ! 1 q ̟P <  s<P .0S S A)`<0S T<0SHL0P@ 0E8< 0P0CS < `!R ; qW, -䋟 ȁ  '; 00CS; u`\   ^ [@T DK崷4 00 L O!R (PP9`V E: 0B S@@R@T :0K  p 1DK jPJ { [0[[(,[ D0[@[$Č<4 4"<,`U0ݷPP: 0B S@@R@T  9``V^  ^>K  8K DK0 K40KpK P 00Sd40Sa80S^ % [0[[(,[ D0[@[$Č<4 4 "<, 0 K0 p @P`$,0( 0( ,00 K0KK4 80< 8K4 80<p@TDK`0 K40KpK@P`$DHáP $7_00S40S80S  [[0[`[ [P[[p[@[h1 [唠[lXᤀ[[[\`@p[D0[H[L P [T d4@1 D|<, ă $x q  1,(p,4Ɵ&<.  01*$t$%,.t0pOL@Pq@6D@ 00CS4 Kq<T K1@CP 85_-0[ [R~[Q}0[S o5 @ Ƞ,Ƞ0 4,40:k0S te@T 2, 00 |R`)E  CLPP0S*(0K  # ]qP8`K` ğt\pğdp H q<$P0V 0t0x0S d,0K(qPT4̓0S S ß,  ,0KqP , ) ,0KqP@CDS pP0< K<0 pP PpLPU q_[\ \'20S" 20S0H0 _[]K\ `[`K < K@@BP  0KPO 2 0S S Dt 0d@X@,18  @P` p , 00P40H10@00   @P` p$(< ! DyPX0s`00 P+V,000S(0K  #  NpP)`\@0V0  0 001 A(K̍ { 48L{pXT{z|{Ȃ{{{|~{@|||h||||<y(||}D8}@}P}h} -LMhϟ0 d?```ϟ00 TϟT?@P00Dϟ@P 0 , 00 8 T` Pp L PD D0S > 0RS 0S Q00-S D? ] R $?]>0S D0S  PX> 04 S< 0@ D00S0H0 (PN0SNPJ00<0S <80S 8= = *0<0 08 Sl坴PQ 00|SM AP>i0S i0 S  9<8= /i@P000T  T aAT/00P<0Sh0 SPp<0S h0 S L<0S  0S DQ<0S  <;0S  ;}P P[D0S ;0 PQ   t Ph 0 00S=  R'P4;,0 :)00|S <@  , ,0S  d*0S00\:: d, ,0S:X 40 :0S,0 ,yKrP0S;0 @j0 S0JS剼P0P0 dP0: S d)0S00`9  90S 5+9h90S SX9 00 d90S,0 ,2$90tQ /40 S8 8g0h(y0F@0S,0 ,  p Z@`T<(0/S' 0S 70S0Sz#!'T@K00/@0T0 P@ 0TKS#0S*s0S00 07 PPZ``u00p gpt70S3 60S 60S+6R&Q$60OTS 60S 7#% 7#1!60S6 6 $!6sU W p%0@VF Z @T >F  , oePP@",Ap50S,00#30#,.=p3P %g00 P@T@, IeP~g0S : Y 40S4 4  40,3/ TL00L0 Q N0S# *sT0K 0OT0 P@ 0S $0S 0S 0TKS#0S*0@0 P@H0S 0S,00#3 ,<PP)0S, e, r T t T 0S,U,b 0@Sh夣䒟`p0p@@30S000@0<P  30S,00@,y<P rfPPL0S BL  ZZ20S. 20S 20S&TK0S0S *D20St2#`2# 20S@2 ,2 2nr10S000#3 0+<PP U 9!0@t10S,00#3 ,<PP #40 S0 0 40,3/<8@0S @ 0P-a&Q00P @0S9P@CH0Dt 4~ z}}L(41TyHz4}PL5dl^J`S] qq@44}}}~(444LwXH~04~t~4p 4PYqD 0 000T@X0RvD0Ss RQt00Sh 4 0Rd p\ X q[ (0l h lK\0Kd0 `@ pM(1\K@P孟p 0DXA@0 S\1 d1 @ 10S1<  $Q01@P@5@40S ,0S 40,3/00S 0h`"0S0S <8(K -p4LWMPpP` X@KL 84X  00KT P LP qp!xPKfP aP#xK 0WP#xK P0jx0[S xKX K00KMP px . d\3 00H`Q,,0,$#$30P ^K H000S  ]Xy4 -AMLMP44 0P0004 @0P,4 1  Z Zp6 h10S' \100S<1BK0`Ns 0 r 0 R0 @R 00S" 9,4 04R Q|00s344dX 0@Y e800S (Kpt]N|z4@ -AMLM< 1BK1@@ @@, 4 0 HPR8 B^KPEp`ĐĠ PE4K0S0 0S 0P0 R  0 0 0@ K 0C 0C8 V\\lgpg0!p@L$"H"\" -LM@pPg =`P 0S nS0oS` =͠PP00 @o;P @Q  0U0P P00 00 X 0000X  U 0 &U00 ,KT, ?R0S@pU0"S4 0q@P,Hd -LMp`NP@( P(K,KhH  0mP(0S$KMЍ/0/0G@-PQ @p`0N S3. PP0 CS @ Tp@-PQ @` Q p0 CS @ Tp -L MPa0K00K!PU`V\2P`@R0 @(K∮(,<4("4!<@;S0 @<0@0 @ 0S0SP `0/  @a0P0@ (K]@0(,<4("4!< 0S 0R@P0 R 0b 0O?  š 1>A\0@ (K/@0(,<4("4!< 0S 0R@P0S0S* 0KppP`P0`0@0@p P`$K Pp-L@P8 PQ7 0R34 40R/8 80R+((P P% Q# RP ,,P`@PP Q CP @0@PS DD~P`@ Upp -\LMP` #p 00P  0# 0@T K -LM0 ̠# K -LM` 0K'4p00BP0@ T,Q a0"<4!4"\P ,Ki0pW,00,0  ]0 R, (,0N# R:(K -LM@   @ K@ K ~00P' 0.#K -LMP`@?ppS i  ApSܮ P* 0  IpRǮ P0 pR幮0  iؒ(P -LM\$h 0L.xHG -@̠Lp`.0'.TP! .U.S Ut! 000t0 00000s03-T0S _T _TX0n 0`@T] -LM0@S4hW f!P 0Li/Mؓ -`0 MLȠ ,Ƞ0tpcR-0  Kh ,G 0 -`0 MLȠ ,Ƞ0UpDR  Kht ,G@d -LAMJ_K, ,KOK*p`P#0S @ 18P @T T  R 0SR( K0ACp <`V440 JKp, (KhxLK p-4@LTPp(,0`@D` V@ph -!LP㪥pP`D (408 $\408 0 0 @0`$0@  KP(" ,P KP, 0P KP0@Q @uPD D@ 咫@TP @@4@` -LM, pPoBR00S ,倢0oK,0tR0S (u0dK(0P<8S 00`<S$0 00S`AD[@D 0V 0V^18SYhFdEEEa@DA01@00Aa@D7, 01@@PD@ 0!0D@ D.ꅁ`D,0@1@@PD$ D@ D @ 0!a@@0S1S @00ŤPD 0!PU `W 040$p锔LK\` -LM@ P#)JP@  P pK \0S P PU0u`P᳡0ESVȔ\ -LMP`p4K ㎮@T h@P}0 pdJ  KT (p0 0 Ⴁ0S  y K(p @ cJ 0SR0S  c4@K$ $`K PP 0S (p7@T `Pᖮ4pK@0PS @ UT 41 01P @2`71(K  (p (qP`P( B(  < @4pK0S  1@ TD0 @0Q  #K  h4DLKX00XL@4( ph4GP5@5tD56 -L Mp@"p P T P4pD@2@y(K@P R 0Ka, 000 0 2KCUp N0S N峪P 2[ Qp N0#S N堪p`P $0S DAAę0S  pN僪 @0S 0(K0(0 e!PU00@0 9o@U00@N\ tH0s n9TUO$K|0A 80P& 808Q 1 0Sz~0010S {b 0S  0#S ,KR|00P 0@T 0 1zߔp`\, K茜L52P@HB 8@R?@880S< IBp+Bp(0K* #` `hHpB0 0<0 `YHp B՝spp  'p &p 'pXn0Qlhp\@PL?408 R 000 <}(K aHKlg4G@5H585<5HG\\@K 0@ 0 1d [P {@ H$H08#8d K#d[0c0K0d`K\0K 0 [0K0dKK6K5K5KX T @H$H Ġ$Č Ƞ,Ƞ(K 0K$t0;x`,$3KC<  2K0K2K \P  0@K  0(K!x0K`t0x@tpxPpKP0 4@K ᧗P0K 0 0|0 xp tP  p@9eh(KDGp P!$W4N dSSd 0A BS@ AS?IS6 LS:3fS5 XS eS26lS) tS-#T d p Bd '3 0s \ 0 QQt0:p@p0` p @@@\3h; 0 ST(38 0T00w0S 2 0WpWڔR 20 Wbp @YX J SQD IQ LQ0 BQaLfQS XQ[JlQ tQVh 0Q 0K05 "0  4K4,<4("4!!<Ꮠ@5 8K8,<4("4!!< *K"[04"48#8T!p@@!8!00$!$S!0['pP$d0`:\Z`P` HpP`P`dZxY `08pP`P`Y)㖒(KD]DxĪL5į4y h` -0L0S 00CS00Ӥ0  P00% \ 0S000d 0p0 00 | LPQ(0  B000 ]6`KF66lK66 -PQ@`Lp ) % !0|0 `t0Pp0pl0 h0d0 `0 \0 X0 T0 P0 L0 H0PF6676lKdKhKtK666667\KpK`K -43LM, ((p` 0Pb@`p 0  0#\Qp P 2"\@2P5"@㐒唢`"U00ST P@`\U@@ V +pP0$T$2 00d   "u  1P!1 -\ Qb|` !0 00Y 0 00儡DPP`@0 -P_P p 000  1 T0  p 000DP@ T0%r 0000D@PE@000-S0 ! 0,PBBP00U0Shd0D 0  666]pK\K<7(@7\4 D6 -錠0LSt`tP 0lpl@ 0\P0 H0  0 0X,00006pK\K66lKdK7 -L@\ pp00S`0 \0 X0 T0 0000 (0 T(0 006pK6`KdK6\K7 -<18ML0A010$! Qq2   PR^000S) L@ @`PH D@ @P <` ݐ 8 PR4@ 0P  ʐ 0 S0Qd0 B,0 \0( $0 0 0  LK<0 KpK ChKpdK\KL5@5PSBtK --LM 0 T ÏH@ k@00S (嗐  c _ K CL5@5PS --LM 0 T 埏H@ G@00S (s  ? ; K CL5@5PS --LM 0 hh@ z\P "0S <O4 , 0S #>2 C@5L5PS^0p@-@P` 0S400 0 CS @ Tp p-P@L`NPʻ10#Spp 0S1010 Sp10Sp1t 0phu00Sp,G0G -00x0L0p3@00 0 ᳐p 10S1J$0Phj 00C00@S "0S y0S '"0  0p0A R:B0S `|H2 , Q%0 Q@L00r P~( 00C00C00C00@S !0S 20S 0P0p,00Cs,0 @00p 0 S d R6(A4a0 RP\00~r P900C00S100S 00S' Q0P0C00 S 00S p00S P0X@ wL0 p000%S!SU6p66t6x6PPP xP - "LM00 S3 200 r 0 R R$K!Pd 0!S 00FP\ |1$ Քh1$0 STYH Q5  Q  M`V >0S>5>FPH `0 nR pR lR 0`0`00`P \=  Q  `& =0Sd== P =f= P `0 nR pR lR 0`0`00`P x<  Q  `<0S+<<P,0 0SS0<0S <<0S` X<0S ` r ;000 `@P `p0 nR pR lR 0`0`00`P ;  Q  `t;P PEP`೅0S!S +x0S 0S@ h`q[Pk: D:<:b:0Sd Q`Z r 9000< D`MPI 0!S :`C`0 nR pR lR 0`0`00`\ D9  Q  ` 0S +h }x` 9`V ` \9PGTPPgTPVTP! 0 nR pR lR 0`0`00`\ 8  Q  ``(000wU\80S` `0 nR pR lR 0`0`00`P T7  Q  `D'0S 88? 70S`@`0 nR pR lR 0`0`00`P 6  Q  h`q&00cS0k `&0Sg TT c&`0S000 nR pR lR 0`0`00`P 5  Q  02`;$60Sy 6@ 6)P+`H0 nR pR lR 0`0`00`P 4  Q  h` \50SG L5H50Z,0  54u0娔P8 @JP4  t$00S800000 SP\mm P(00C00S40S x40S `00C00 SP 0$0S 0S { 4r0@8 TH R7ڴC,s0 RP\00#m Px00C00Sd30S P30Sz H`w0P0C00 S  30S 20S 2Pr L[r ,KPWBR0 J0 0P  c P00C00S@T20S V@20S6 `300C00S2*10S @10S! 0!@ 0R`|`0 nR pR lR 0`0`00`P 0  Q  `1t L0000d`XaD1SH 000U]66L<^d66LPShTdUlg6Th6]P H$6666UU<UUUUxp6Ut6x6V 0P 0 nR pR lR 0000P 0  Q  u`~0 0n0oPq@P`dPj410S@Z`cpWX10SdO`XUP`WE`N`0 nR pR lR 0`0`00`P 1  Q  "`+20Si (242@ T2B0T@ W0 W00`RS000  2P J   P 2 0R  P00C00S20S 30S `@30W @PP @000P003@ W3 00 b 3 30S #00C0 4R 40S 40S m44Px 0 nR pR lR 0000P 4  Q  k`t4 4d4ePg 0 nR pR lR 0000P 5  Q  <`E5 5550S(.`7`0 nR pR lR 0`0`00`P X6  Q  l `60S 6 R6 6 60S`0 nR pR lR00P 7  Q  $`70S 70SqT` ` r 7000`70S7 7 %@P `0 nR pR lR 0`0`00`P (8  Q  <`H80S 0S0!S +s0S0S@|`8nP~~ 80P8  wH yY`0gS  S &:00C S#pS rS`!0`0`0`0 1@s C`00J0`00V 5`>V 00 S :0S( '`0p(:   : 0 S 0 Sd ` 8ZV000:@  @P00C00S |:0S ":0S `ZT P f; @ :  B 0S ;0S ;0S Vt tPh;+0| S0000W0+00#0+00# 00 0nS pS lS0 00 00 0 0\ <P`P0 nR pR lR 0`0`00`P <  Q  u`~<0S= == <hPjM]PcP=0S\ S`\PUt=0S H`Q`0 nR pR lR 0`0`00`P =  Q  #`,>0Sj(N$0>@$> TPpdU0pdeh000 g000PhPP Y00C00S  0 0 @[0Q0 P+ >0S >0S `? P0 H?  B 0S\?0S p?0S `00C00 S 0S /0S pW*? pWʥ60S`ڄ`0 nR pR lR 0`0`00`P 6  Q  q`zPwupqW QW`5 `50 r 5000T`]PPY p50Sx5 Rp5 l5  X5EPG00 nR pR lR 0`0`00`P 4  Q  `&0S0!S +q0S0SP`t4WTpX4 H40qP04H$0P00 0S (40SqW`30S`0 nR pR lR00P 3  Q  p``3 X3 P010C0S  "P0V0XcPX 0fPP 0-SX0S $!PKp6 4@L Q-L@ X35PPD lP 4($0Phi6XdV Q-L@ T5PL@P 4($0PhH6XpV 0-LMPAK@A fp 0K U04B l4P `X幇A^KPE@፤P400P HK0|6XV -LM0D0S [P  D0S:[P oRp !HRB30S 430S3 x#30S 00CS00@Ӥ0I@P c0S ᇄ0;0{P |XQ \P dr4@K 0,(KP $bKZ[[ - Lv -LMK gOP[ [4 0 S0S (0S -MLML%pQ 'OPP50S `:40S P 40S  K P$ 40S !NJNK`@DdK@@DK 0h P 840S (N`$40S 4[S /P `+a+b3 3`V KL3@T 㸪)Kd!K%P0P#:  SK RP PrN`)KD  NX20S 剃K  0$`x ~bP x20Sls`[K(PEPE9K) 4@P `?V00S 10S ,0S '^ n 0S`` K DK0$P Vx10S hV``h0S \1 R D0S0 @,00@ 0$@4 ( V ^x MP V-00S)%V00S D0)KS,0D0 D K d00S<0@K08K0 9K4VS 0`(K[ZL5[,\d [Z[|Z -ML M ǩpI 9 9, 0igS0,0 Y,@ 0P P( 00MP 0L( 0 0uS0nS0 0, 0,@\MP LMP<0L8 09 0@KT8 ` HaP, 2 SP0@K ׽P`@p@Tk PP+ ,01 ´, ,0SU 0 0!0@S0 8CK (8A 0@pK0gD8 A 0\ H( `8 dTL STu 1T9T-LT NTYaT- VT}bT* cTnTI gT4 fT.hTz lTz2rTp oT? qTrHtTY vTm_L lT 8`0@DPH ebF,K /,00SX "00>&G T` P( I 0 0000 >8&P;,007L6\+` P 3H( 5.:<0F,p 00.S.0@0K`8,0 , g b_0,0 0 0 0]000 W%000P P D(x5P噺p@PL8S\5P @e<50SH4}p$T!UP4 4@0H(R 40TS4T 0HST 00 RÜŎ,$0s 400s030 uP CK.KI B BI`X( ,L(00 @0-S 0SH8SCC000S40C S;꠆hhPhPhhІ|30S- 㺼0S.P,  @KHLP @KX<#0Y\ P *XH"PH00: S \ JH00: S S0S2P" 8XH$0S |"0SP |(H8S)0S X+^!0S  +P10SPĹ @pK !0p\ P: ᶹV`<X!0S ڌ0SL10S  H0\010  P81  j}|1h!0P 0?( 0P 0 0G8$1P`P` 00@ 8 ` @P4 G0P0S0Sx@  j60, c0 `X  `00@ (KP@T@ -PPL`p1 ,0S 00wSp rS*ppV 0)0X 0x000p000 0@9`00@ WkIpgIsOH@L@P@T@ -`QL MH p0rSwS ?R@@T WD00RP  0 `01X@0@0@4@8@@@@ @@@ 1嬑0 PwS 0 !@0q`P  OTH0090 ` 0HwS:XW@ W@@0 #020Kt0"̠10K"$}000K- K0 ` )0KX20K/K,K+K*@KD0 . K@  < 8\ 08 0X  DKV\p  0+P  P  0P(Kh@L@P@H@T@ -RHL`p$H X 0P @@ R,B BQRQ0Q@P`Fvd2TLDX@DY00 0 0 0 0 0 0 0  0  0  0  0  0 0 0 @^PlYd@YV}VmFP0p0`F@@ VV1E0\\0\ 0 \ 0 \ 0 \ 0 \ 0 \ 0\ 0\ 0\ 0\ 0\ 0\ 0\ 0\ 0 @`FPV 0 0R@P`Fv  RY@NYP[ -PpL 0B눀H`$H6Y%XL\8@#8P@'XPfTPLD@DTLD@D(0U[E>^E0PEU\EPE@- 0S  00 0 0cRÌ`@0  0"0Q1 P0 0S::"V -0L0S :V -`QpL@10S P(0^ ^0 01^ 4# # !^#$""1^"4##!^#$""1^"4##^#! ! !@D!$""1"#T T $0@T0 01 #:V 0 "Q/ p-L`P@@Tp -pLAM0`, . 0J/K(1 |00R0@KJ_K   Pf@0    pd`0,1((K 0@-@P $^ 0 SΎ809P  L0  ( , 0 8 < lPP0P@-@ $P Q < ^ 018 0C0,0<8 0 Rp-PL@2 0@Q1S``,Pp(0 `S00`(0,00S0,0 (PpUE20Pe$00E`S0,0$0p040$Pphp 0%0  -@PL $Q ,0S 4Q 03/0$,0$0P $P 00  00 /0@-@P \00^ ^l\P:0 -LMpPJ $`VG 0S<0S𫝙0S < 80 0(K08< 80080< #4 B80< <0 S0 h0 hh0  `h0S@ 0 0P 0@P0P $P 0 S/<0s3// -P00@Q0SLS$PUP (\M ,0SJ 0$!0Wl0 $0 #4dT4p$`0% -$@L40pS` $P0 (P47 (Q$ 02,(000( PcU4:b 7T (0,00 0e0`U`1`!  (TPU 4e !T(0,00P00( 0S00, (00PR:0,0 -pPL`P2 $@T/ 0S 0 S)0 S  C @0PP00( 4UbS(0,0e S,P0 0 -L0MPP  $PU 0S 0S0S0 S00D < , 0H0 8p<`@ 0S񟗗D0dȥ(DܪجD@خ8< y< !  ;< 0S  0  Z  0RJv`V0'UP0S'r0$ 0SH͟`F 30 `  0 0p8Z  0RJv`V'4<'<,4<0`80 00p 0S < H  D00<`8p r 080P\ 0S  07s`0Z  0RJv`V 0 S@Ht| 0 0T0 0+X0 00LP 0; 000!q`F<07s` Z } 0RJv`V@˟("('8,Rc`0@ 0p@0Sg DQ01 S@1 @!T`  HR@0D H0d d dD H @0Z M 0RJv` V"'5t  0 0Q\0`d 'w`FR0 0h Z + 0RJv`Vʟ00 0'hq`Fh\0Q* h00h0S S.0L T0l T/p l0PZP< 00<0h0T03L@ C 01QZ  0RJv`P Z  0RJv`V:7q 0`ah UP  Z  0RJv`V:^`a7q< 6 0n00'q`F(P   Z  0RJv`V:71a q`AZ  0RJv`V:71a  s`AL 0S \7 000 h0 0h P*d `0h ^L x:0S! S>/΅T 0 l@L0T l0p` 0P< Kl0`P00X0X 0  p0d P0< 0 h6 05T030CL01 P0 Z . 0QJv`S4  03 @C403<1 R0 Z  0RJv`7|`lS``@ 7p0  0@ L% 0H000HQ Z 0RJv`V:1H0C07q@ `a @ 00X030CP01 P0 Z 0QJv`8 03 @C803<1 R0 Z 0RJv`7|`l@``7p'0H00D 0HQ Z 0RJv`V: 1H0C07qD `a D @,0DD 00`R00< jD Rr @D0 bSH @c 0 bR a(00b@40bRD@0 Q10l@0D0H0lD0 0 R0@0HS 0L H DQC @0H AD 0H 010S4  Z 3 0RJv`V@0Dl00@0@0Q00 H0 a8'4<,'<4 <S D@  00D`@ p0 0< H00D(08pS<`0S 0@P @P0< 09,0@ pc`b0 00@ 0@0 0RV0 f x8 QS@00<`P  \ 00R40 <P<  < <(KV0G-|M⠀P00\ 0 S |@0 2R02BQ0`\ @00S@T@ \0@ @@@'@\ 00S@T 0 sJ QR0Q0P0S< # 000 Q | 0S4Q 0$A\0P P 3ß(0,  (,0 3ß(0,00S0!Tp!p1' PP#0 \00LS`$P08 8  8 800@0i^040@(,Ŏ0@`@0ià0%3l l 041 R @0@# R@0B00|0 02S0C8#(@  P P@@a800@|0T"C$ \ YPi0 \00cSPR :  0<Q00SA 0P0 0pa 0bC1 0wY $ 0S0`4 @8914 @00Q  0A0000S@010p|ЍT// 0`/ERQ /MЍo -0L x0Rp0 l00Sd0`0` \0Q0 PP 800S 04 0_$[ a <[< [^H -L M0@S = P K0S R 0~K`Pp.b>@P <  p0@ <0  `< @ < @   3`P  p d ov40C S+XԿԿԿԿԿԿP0S 㐮0SO Ťp 0S  弤@HQd R;Z <0S00D0 0S X0PSTH0\7j D0c 0S D0c0@ <0P LQ X RH00 X0c0,  D0HQP xrpᎱ@PY0S PHS  a [([$[[\\|NL5MЍ -0L 6 a^ -0|bLDMPp@,0 gP uP@00,0 0S ("Vp20iST`P,K" `P  +P i0S UQ|P J| (K1D P l嬵@PU0 l呭PD/lKP0('X  op AYrPPlP  'V Ir@@MT lp 吵P P  pP@P 0SX@X 0㴥 Dlg<\\DX|;\^(L5MЍ p@-`0@S8 ;0S8\5 00S0C;ౣ;0*@:*005*0S /*)*000000x00\%p0Rtpp@p@D00\%<0R00p@@0\% 0Rtpp;8gT: M-LDM`pKP`@D 0>N0 0K<080 0$0 0@ HP D` @0 <@  K -gMLMQpP`P7RQV0U00RQ D lKN7D0 0LP H` <0 ,KTp P 0 yX7P0\L7P87@0@0  Q 7P0 0@4;D$+4 0 0 0@4;D$+4 00lK fK@ 0@d)3@6pP86\eVP Q|pyYw Xt5V1(0S  0j1t p00 0c  a 8-  & Z x50\%p5R1( 01( 01!ppt ,50\%$5RF1(@1VfpPt`40\%04R00O0 @00O0@40\%04Rh04h0 4Po@00@\4X4\eVf 01(0/ & 01p@0F V PP` `VxV tf  U3fVP`P`0@P uQP0 3Q  85@0L 0 0S_KD,H00 0`Sp,H0 @\H00 0U \:0 0\%2|& RxF1(0PoV f xf1p & t&Rx6 ST2|FTP`P`0@P QP0 2|V@U  850L 0 iK0PS HfKAA 10S e{)P 0 0lKC OH10\%@1Rxf1( 1( x!1p0p0t@00\%0Rx6!0(0xF0!@p0t@00\%00R00SO0 @00SO0@p00\%0d0Rh04Ch0 4PQo0@0@$008 ((K0g8gT:Hf\h -L,P`0iL0pS00000 a0R𨝸8#80 @0c 0 '0p00 G 0-,P0 L@ P0 00 '0 00 p-8LPChN0@S  0O Ppph  0S0 R0 0 : S0QP fjd0S00S V ㉐l0S \dD00SH(Pp00f0phpg:x|feȸ -EMLMx$ t4 lKD aK  0p: S00p4 p$X5R@LX w<5P050S $50\%5R00  00S1P d2(P( T  WȄ0`<0 0,0K4plKD0 T` Pp L0K<XDx0Sh(P2 \40 0' 0P 0S _d0TU o00C0W 3#0@S0 ҏ|3 @@ d3U0: SP> `\'P <3 ß0#@P0"0 PZ@0,0K2D0 T` Pp H&lKA?&0TŸ0D27&0S \{F~KpGL2pG0vp@P 0FKH`GH @ PG m0 0f]@PV 0Q# 0%@Pac %p$0R0C0= `A   x4st| @00000%0 00 #x$rt4s xt$bxt%000400S (Kxиfe8gTܸg:\:$Pp|`90g̹PSx  -ML Mp`@P ͎AK @@ 0%WV 0S:0S:A@K&P 0A.K: SD0P B< B4AK AA Kp.0gx,  -LM0 -424 0`40L  8 ;;S0 0S,0S) R'PP!<0Si ' @c80 TPp<00PPPlA 080P<  80K 0SF0SC8 Z@0@0p0 8;;@TPS@ P1 \.U+T) P$80 < R B+ౢ+ \b 00SOQ8 0 @ H& @ 0Tp0000 0p8g4 -LM@pQ v 0 t0 @0 P `0O?  4D;$+4 0A40 4P 00SO0 @/8.늟KP D,(  80@ e DX0   P 0S0S(KH8g 0 0 0/g 0-h0L0S0XX 0 0CAP; T@D*@;~;0000eeg -@Lq;008[ M0-LM0@0P0c G#00CS4H`xx#0#00# K0 0-X0L @?P'@000S0S0P ge -LR,M00Q P 02ZY 0L Q OTS2p8\0@/  0@ /0@D @ /TS P20S 0@@ _ 0 , `0 Po 0 $ ?< 80 <0,  ,@8< 1! 5 @0O TL H 40 0@ 9 S70DPK` P `LKpÏV@NUL@10SF 0@40  (@S`1K `vp0CXh Tx 0Cp`0( P8 yB0\œ\00 S 0 0 R \00O008(LRLH1/L8 0C 0PLH@0S00ZY 03 LP@0, 00yPx P#L00\%0R0 0S @0 @0 0S @0@\00 0  XT(0(p 0( `08DHS000(KD8g,TfL5fԼgg -LM<0@S0<000@50\%5R000 @|5`0\: S SU SX5^00(Ŗ /RHQE\ 5^h0S< 0 74^ JK>K,JK>FK0 J?K45 0B?FoKRNK@DX T K< 8 4@D`E D @e 0 X%0H@RP5 (@ \5DS8% L0/T 408040#0\P0(00s03t0p  0S. @0TS>@0` 0T0L`DP/0\%00RP%O0 @PEO0@[Ÿ0 P0%(0/p@0S ( T050 X05 HH08040 \5SU\0?0 0 A1 0<  0j0C V 0 V  V00000002@ @2P0\%2RT (P pt20\%2R(00s03t0p  0S p00<00820\%@2Rpꁫ 20\%2Rvts10K0\%1R00d0X010\%1R00000K 0$@10\%1R000D0d10\%l1R00000K(0,@810\%@1R000@010\%1R00 000K004@00\%0R00$0H000\%40R0O0 @0O0@00\%40R4h04O0@tt0 0@0 0OF60p(Kf0g8gfU (T$gg -L M0W @RS =~ 70S 0S yp P60S zFp d,00Fp ],000 Sx6@t6 l6lXP TXPX;H60S 60S,60S GXTE0SX0SXj 0SX3 0SX딕  O080B R OT d"R b b"FxPK@P0X0"d0B!0} 0?S"b&0O?0@@@c0 0 06B K2@WL40S 0;0 @t4 Q P XW30SU 3(0,OPso/1"p@0@_004@=p8/3`"<KP@   pJW,C0S \DWAW@HT e8C0S ,5W2W@T V2@@2@2@20S tR@`004 020S- D" 0S&P`PY`/1"@ 0Od A 0ZPap ,0 X1刁0qSt1  h1@011@0 ,0TQ@ 1@ 10@L11x11X10S- 00SPRW810S00S,HW2P KP " (0K h`P (00S-WjW(Kfqf̽ؽefL;e8g  feDdȾf$gDh0ggPeggegfge@ p-L@M P`K0S 0Sp   -0L r a^ -L`pW("(((R(0@0XdS3 YSM NSODbS cSJnS= fS& mSB&pS yS=7!0 0 00" 0x l1P%\X!00000< >0S(1 U 00000000 Ap00@0dS }{P {`00S {S0 P`0Pg g,glgffh e f <:@\\qg -L M`4 pP,  0l"`Rd"0@0@Q P 0,20SM V0 }4 0 u,0S  zP0 a!0 0S1 0 @010M0x!`p1l0 @R Q @c 10S U 0 : 2P aMP000 .`0 R0000  0S0S R0S0S p 00 @0@P `JZ0(K<[f4gfD[Ph@L5 gf -LMp-0 O !S0`¯  ï^ 0Po xΟ1>0 20 P`ZY 0p>,0W4HTLd@>:͟p 1>0 2 P0 `XWD lK;,>- 0,0Kp=D0 h=h͟d=  0x@mɯ P0pO`xp.0 0 ` /l} 0Y0̟\% R`` p 0x0OWV0 @ / l,0S< `L0S8 DlP| K0@S\0/ 00@1>  0S P` p0@00K0@ aP0 @ `K`p` p  Bp p 0@`  @0p0  0AP @  ˟0 t p 0 e:ZY P ,K0\%0:0 pWFʟ R(0 P!Xl P0S 0 $ R(p4` P   P0S 00   P   0,)0\5S ,6 L009I000PO@? O/ i0y\Ő@ \00T"S\45S:05S:  R8\ 0S 0 0S0s H0S Hh\\x0S \@AP  h0\%40RO0 @O0@70,hǟ`|` \u W|00 0B?QpP tG0SO S C| Bt0R 1!(0p P`@ W00S0  0SP %0S 5W1(0/1pdR ^ @@|`@t8P1!X0 PW00S0  0S $0S 4W1X0/1@TP Pd 0@ 000S00S /P XT T@PDD <$00  RDDc0\5S 00   0S 0 00  a 00  pß'603@P00lKT P \Kl404Oa#p\` Xp \%Rh0O0STG 2Rh0@_@00lB  P 0S =RP. Nb(r0\5S\0h0\0K0@ `  e00P@  [ @ - Ÿ0\5S ,40@t`K`pt` pp tp WpPX10 @P!00`0/Rr Q pnYZj x ?SR@P@TP0` @0 0l+0MT UJ  `P1 ] Mgh",fL[$gfTfeU lT@epeHff|eegf@@L5 eD[<[0f8gH;0U pT唠! i  8L00`0K@  |0@ x@ ,0Ta0 (K p-D0 ML08, `L0$ 0`w5PKp8gL[  -LDMl@KD 70 0 0 p 0,0K0D0 $ U0T@`P T@ PP c0lKS  0@P0 g0Rp0,0Z@P0 (Kf8gT[H;$h$X[ p-D0 ML08, `L0$ 0`5PKp8gX[< -LM4 萟, . U,0PP0,0 0S \  p@0U PUT0 R 0S  0`pHX0,0 ,(KT[g@-0 ,,0PQQ0P0 -UML M00CS@&d& ''8&d&X TP% D @P 4P/$ P ş 0PQ b PoY0:0090>xI rxU tE p5l`K↚D 6 0K1bt5 V>K0C0Cx5 (5A| %5 0,0K 5 D0 [oK000p00 0S S$< 0.;;S= @00 x0y0S <0xxx% 0 <0`Xx% 0o PD0S DO 0?0?0 00SYP0 \5 S0@0 @0@0@,@60\5 S33( K)ɠ(K 0 \5 S 0@d1 `A P0@\1 XA 0\5 S,0(0,0p0t@P( R01 0#\: R 0\5 S0X000@|5 R0T0 P@ lK0L0 H@ tD" XS: 200\\"2 P0p00P`G 0SD 0ST> st: 0  P$`lP,  e00C0P U000O0@!0C0@0 @$P0PDtX:0 P00a0 @ 0S0S M0@0PU:E(Kp@L5  eg|%`[ -H;d[-8gT@eXdfȸT-x -,0LM 0 02P`[d[ -<0LM000 0@2Ph5`[d[ -MLM 0 ,|@T( "P#0@ST (j00P 8)  089 0S_ (Y00lP88 RP(L0JK01 0*1K$0,)1KE50)Q[S @ O"P 8 400P`U)UK7(K P07(K` 000 @0@PfX00C0 4P$P089  8) 0S0Sb0,01 0pJK)1K*K4)1[` 00`"0 00 0RV0`(K00 0@0@00C0(0K Z4(KPP@T) P!P0@ 0$@0SW %BP8) 8) J!P ş J@ 0 S \ş p0S:  0S 0S @00%T RX  0:0D 0@, 0@P`HX,fgf -LHMl@KD 11! 0,0K1pD0 j0!Pop [VSUQTP P` s 00CS?\<T;;T;;(<e Q  A 40S 0S00$ R# @ 0\5S00  00S   +  0|0@P`d@p 00Xp40 ,0W 0 (KH;<e`9p8gT|f 0-80 ML, (000.PK0l[ g -ML__M>Kp0(HCHHK \1-1`>0S`XKPa{X0S$5S0N0S $"0SP  K0P! $5 KPXQ[$UṶUUUSʸQQ$PE``0P3  Ba  B00B!11000 0S < $U/M0S P' 0S  $QPEP`0\3  BQ@5 B0  B110L 000< K P!Lq QV0hK  B0 20 P`ZY\: HK ND 0, <:<*d: "XKLaZ`0KO Hat,0 0 Po/0 hK\aɟ0 S 3 S (K L0XKL!O8<HaL&"SKL` KPTQ`P`KLV` U8K=CHK\AhK0 0ta `,00CV.KD!Xa$5S8(.p  $  HK\A(0, S0Q (0Q,`,`0\58S K\x0  R0R0  !HK\A x00Rx x00Qt0Q04hK  m/0S\08Kl!c/L5XKsGCLQ0aXKtO a3 Po 00CSE,E E E E,E000 0ǟ0C R 0\0R\0000 P20 Y  0tfK0 0ZKt^@T6 LVR\0R\0000 20 00CP 0hKnFKP n5 1> 0 S2$ ER`0K@5ARK!! `0 0(K(K1 0K1 ! 1!2(K1 0 0`8 0iS^000$5S*8--l  0@00^$0 d0R$0`0KU0018a^! BB.A.A BS8K!080ïPHK@A ThKDa V `$5S+l0h P0@` Q $%Q  !0000SPp0PQ $%Q  !000$ P0K0OP0 L@ `0K K0O`0 \@ X0K `0OX0 T@ h0K 0Oh0 d@ L3L 2%P MK P0 0KPP K\ *(K\p!P K P HKp!\*2 a0S K\  M0HKS\0\A8K! Q0 SK\hK\010 0 0 S5 1(K-BP`05" HK\A40 SK\K\010 0S58KL/L 1KH!"@(K-B0@ 0P@`UVHKdAZXK\QψoXKagef(D\hd|Tgt[x[O(T|fe(LU fH;8gK\$0,PS(K\!K`0@ 0!S`0hK10 0 0 S1 1(K-BP`05 0@S`0K10 0S5KL/L 1KH!"@(K-B0@ <0P@`UVHK`AZ0\QhKS\0\at0 SK\\0 8Kl!P K P HK\AQ0SK\\00S\08Kl! 2 KL0`@P``K,0LPtL2@@L5?^s h!h`KP% P MKn P 2 @@ (K -,0LM 0 0P*Px[t[h00 0 /D;@;<;0/D;0/8; -LP RQ-L@ P P-L "P 0-/LPn@P000+0,/00$+,+,0|[  p-LlM/`P@P KyP0: S 0PrS@, #Kp p-`PL@P00S 0 R DD>VpX00Sp qD0D R 4D(D$0$D<;@;D;$ a0 --LM0 0  --LM0 0 K --LM0 0 K -L@) h꘨ -41LQM pK  P@`K*E8`P10: S 0R 000*YK@Pd1: Sp lfDVPP S00S *@ֈP U@ K8;\l| --LM0 0 %t^ -LMP@P 0Ta0C0S0T00C SLjY<dT00@ Sa>A R R3#!S "8+ P 00C   )4 Q0 0C#, , ,04p80,00000(P,00C00 ~)T| 0(P@@T00`@?!8<000(0, 40(08 40 ?X)00,T),00 000R0 ʤ |`0B000@L)8@0DG)Pp0@)0 @@0 ?ᶳ0E ?ᰳd,d00d0V`$@QPU `0P3  B  B00B!11000 0S Rڬ0 0 0(K\|d P-L@(00S ?Chf< -5LM Rttp= l5luPoʠ 0 @PE0,\%(5RR1  T04Poğ4ʠ 0 P)4 \5 S S ST  S 3S3S ğ @p?t0X4*` ,PDڴQ4\% 4R  S0@Sh` Vŵ0 0B RR40AQR00QX30S0 @ O0XS¯0   0S3 0R[ 0RW 0RS 0RO 0RK 0RG, ,0RC0 00R?4 40R;8 80R7H H0R3L L0R/P P0R+T T0R'` `0R#d d0Rh h0Rt t0Rx x0R 0R 0R  0R 0R\%\5R# 10S Bd!1@h00p`P   \0P aAB@T4:010\%R& 0O044D $0O84 Pqp lnKP ,@x& TvA0: S 4,,@P=0S , ]A,+%P TA= R0>=P = 0Sd=  =A`=0S amp-0@h~d`=P` ` `  0 S P <M +sP,(0<00` `P eqp娽P @b\0SH<@T(<_.K B B0,P ` P T|(m00P 54 S0 5S6 @Tkp@5O,505 ï @% W}p P5PW5U h˟hd˟d+`˟`;` @:,;P @D;0S ;4 0@;00 T* ;R 0S |*848@00@ S2,@ @P @ P 00S>@ P,0H0PxD@ P o 00O D,D@0p 0 Po/D`0j0!0S 3S 1 0  p?ԛP0 `t!1>,@0 200L1 DR0@`0R1 0 >`0@  0#0p@P`H@ ,\,  H0O0080Q0 0@0$0HP0C0e0$0L\X8K@ K 8 4 40W8@V (Kf8gggU (f -0Lp@P` d h0S0S @ T @ 0 @Tpj 0X L000 0 0000 @  @8g\ggG-P8嬐 稠p`@10CB>A>A0B0W3! Q 000 80\@80PX;p@-8PP` P P 00Sp001 #@e0000 #%1?FA00 0Sp03 0 Rpp@-8PP` P P 00pe@0@0A#O 1p"1?0FAp1>0 !A pp@-8PP` P P 00pe@0@0A#O 1Ìp"1?0FAp1>0 !A pp@-8PP` P P! 00s3p@e00@@00A#O 1# "1?0  0@ #p1>00 S20#ApMЍ' - @L|;P  P  P P  P  P  0 /;$0 000, R/g0 /g 0 /; 0:0/; -@LP  P $~h{ 0-L@?0PP HP{P@@cP{P0 -\0LM@(0K( 0 @ K$ K0 P K$1Kg -0L@WP  hx  --40LM K 0   K -`0LM00 0@0 K P @ Kg -t0LM $0K 0  $  K K0P $0@Ծ Kg -0LM0S P T@0 @W,0Ptg(D -LM  K K0K վp@S eK` 0-LM 0PS    KK0尾p @e/0 ?K0 -L@>4|HI 0S00/; -p-LM@0`P0 R8P0200  0S CKp --LM0 0 =2 K p-PLP` "  0{p}P@ @p0S P@ Pp|P@$0  @ppP  - 0LP`p, 0S) 0S& 0P 00p@xt 0&pd(PP)@ V0,0,0(`@,@(`@輝!T'g -X1L000,Q0p5@p 0`P0 ,@T"0 0R0 0Dp 0 0S 000EP 2000e {f.PP=.@000e,@Tg, 0-0L@0S ,@TH0@]PP0KP@4.P P .0g --LM0 0 )3G K -LM@-p`PK! ,8P0$0Ep$0 X -LM@0pP0K pt P,p`lP Uh ,0!K P 0`\0!0[ 1S000SU% 0@!pP0S 0S 0S ,,2 ,,FX W WQPIF 0S fF0 (K(0 0,0o0 ,ET` K[( p-`L0Sp@Pp B20P00 (0, S , , R(0(0phJp,0 p4 ph/g; -LF0@000,@T bp`Pdp0S P{ [p 0S0 S0 S @ T g gP 0-0L0S 1PM0 @0 PU0sh0   0~ ,@Tp ]@0S 0;g -L@XEp  pw -`2L$M0  L2$ ,0 (@  $K,K0廻pq0-S A1@0000c,@TE!p/ Z+p`+ P#8@K FP 4` 0` 8P "X XT +@4!(18`o0(! 1$ K⌱ 0 @p`P#40S 0:0cp0S P匢 lp 0S0 S0@ S TP0~K;g \^gP -LMCnKԁ+~K:+6.PJ*PP#(K 0@K(P * tt0p ,P 5nX<0 ,P n<(D=u P 00p$`K p@ ?Tꌺ0S \$0[SUb0S p@T$00 SXTBDc@0  K^04X;; -L$MX*pP*0@K GP ,p (p 0P #W W10aS1 @0 8 <` 4p )@Km |w PK h\P! ~P@D2 up@ T0S  0S' wbQ 00S0$0 $@K)\ |p "4 H0ppp 2Q00 SK贇;(\^4Pl;  -0-L$@KM0 0 0P@$0 S000 @ V 00 0SK0 -LDMg`P \ 0PP h`4ㆺX p@ lllTp ㄠ4P;eP 5 fV@ sV@ +qQ@ !rp`10S   Pl 0 Pq0<  Pi$ e(@K `$ `  0 p , $(p`0P 8@K(  4P 0P 8` U U40+i^L(8sD\;;t\\xАPMЍ;8 200 "P:/ -LM@pPg |`P 0S nS0oS` =PP00 @἞P @Q  0U0P P00 00 X 0000X  BU 0 s00 ,Kշ, ?R0S@pc0"S4 0B@P,Hd -LMp`JP@( P(K,K㵫  0mP(0SC $K -000 0LS    ǫ%i a^@ --LM00 @%P 80 # $Zq a p-X0L0`SP@p8 (`Pp8phigdDT 0-t L@h`P\PP P 000@P 4,7$@0hedAii4('' 0-LM D K8 0K0 @ P P K0it -MLM0@<0 8@ h>\ P P> H> D> P, _ >t* P.^ p4`Kh* dz -N0@&S:0<4|<|8= +0 `P40S=0t:   t Lp RQ<@0@0  < 8 `"4 |<Rp 1 `4 D<R 8  1 `4 <R 8 `4 ;R 1 `4 ;R 1 `Џ4 \;RP o1 `4 $;R _c0 `小4 :R Od0S *7F@P 000:P*:1 x R-ɟ00)<Kp 80S<0S, >$ 0s 0d  0SpP 0d h*~op0S9P ( 0e 0bS 80S \@KᔢPT0K\0 X@ /(1 R0`: -W ]pP& P! ^KPEeNKPE@D@D(0(8PpOi(8pFi x]70S- `XPP(OKe/r?K: 48x* (K |J lZ p <42 =C02 =$2 7P00C,0P 0 1K," ("  7 Rp A 00Kk Pp q  p,K0-pP#d  @w,@ P('PPP P,  ^,0?,0   P ``rpWZ50S EP MP| tA|  x l* x  0 Px M  *x KcPA   50S 0: S 0: S  vn`00S`@z P@`Rl `0R00B SHx +T4| Q$3\pvl |*00A Sa>@2 : 0 @@00@0`   0 S`*l:   |(0@S``d <`KP p30 0 0 0@ 0 @@*0 @@0Y@P X 20Sl` 0dPr2`0O?   4D;S##t`3^`V u 2 02 R P 00C   R |*(0 S;30 R 0S1  0#R ʌ101 S90!0Sh1010x10S ʀA0S l10sxm00 !0S00S00#1ѣ10L@Kp:  x*h00S   P |*p000Sp x  axi<ilg<ii<<(iP<<<i<;<<<5D]@\\dp! !|ln<T'\'4(p'$Hti80@SȻ00/0 10B 0# /0 10/l 80@SꐼpXL00/0 10B 0# /0 10/l8 -L80LS$P8xxxx0S01S 00  00 #A10 #1 0S {lP -0LPA@`|  `    0BOpcP VB?㖃! p    i -LMp`Q pD4K i P00SDDT[0 PP  0$Siiiih -LMp|`Q D@X4 i TP8D0 PP  0" (iii -LMxe@D lUd   0 L5QD60S 0@p4 00 k@040 0@ 70PS`08 `?4K~ P04K80Po4P 0` 0P0o ?S4 Rlk 4 0 @4@84 `R`0_P 4KA ß 0S0C0 ?0@3C  00C0 000 ?>0@3C 000t30SvL3 Q`0P0 20D080U00@ d 0 0G4K(KiiU i< - L0R P; -3LM00 S8 4 ʠ 0l 0 P2R@ d  0> 2P )r; 00C 08P4`\\0`"1>\\0?0 80(R0! @ d \2 0; 0@4D1 00C04P ,0OT8`S8 K 0;0O,0 (@ 8K 0ᾗ0 O Pop@P <` @SǏ!. @0@W< !@p`p, K 8Kগx `?ᙗ` d 0 0@P0 0S 08Kx ?጗00 08Kx ?ၗ00,y $000 (00$Kkh<iiU i4i -LMK@P,Y0 K`0@ P A P @ P y y 0!C p  0 K4 0@ 0 @ ^K`pL =0@0O$+41 ! d 004 0 KA<ii -LM@PpGK,` $1@ 0 A SA  9 K00` 0  0K ]y Xy ,K01B00@S  0K42P L=EK0@0O4;0 dH04 0GK DKiA<i><i -:L0MP0OH0 D@ P `HȟL` 8dli<TTiht@ii,iL5l^<ii<HXii ĐY !c800S80|  00 00 ,00t0$QPEP``0^3  Ba00 =B0  B110L 000@x0`S0 0OH4LD ,L=2 000cd1P_ P=LV>00h0 h0 S:h0D2 0<0P2 0\ \2 0 0R0PT0XT0P0P0HU 00 000@0PP40@0, 0a84 0 =(0 H4LD0 ?>0 ?0 ;0 4 D0040S,d@8t<&4P`&~ 4  4d U$0O?`@P$+4 K ФTp q@p4Pw`tQ 5`P`8, 0U@KP58K0U@ P T 56,P P `F8P A0`@ @c0 0@` R pQ 0嬐娠 J)F#Z **0P^aD70S@P'3*0'\%7R7\5*0G*0P70(88Q0\580STE (8PߦP |D8ppP 1 ـP @ KPP[PP80X0 h R01:0P& H *m\`p㤐K:T0K`0S-L 0O ,00 /0Od )P0d PcP@c@t 0 S \J  . @P`pZ4J0P,0V0S EJ\:0S h:PHx:0K0S "P  ?>0 ?0 ;0 4 D0P  1J*0`P TH4LDVPKd r00 f0 R P000`P pV`0 00840  a0` 0/o?o b 0c1 p; 008#80(K -LMԦ40@,0, $0$0nǦ@iiihMЍY -0L Z㸧 a^ -LM@K($P`㐀Kp>pP 0R  0R 0R`V! ! @@P0/S /sP@0.S0S .S0S `V@_p 0S0 PP$Kj -1LMXp tt'l10SR 0: SN ~PJ >0 SF3`K * [1 RA@P< 0PǙ^00S 00CS00@Ӥ0e~/C@`P0S 00CS00Ӥ0Q~C PpYTyT$Ki^i h]^ -LM0@P, U`pT` p~,  P @TPU T -L1M@QPKPpPR@0: SJ0S L^N@ pP< KP8 0S  0S 0S0: S p00$Kdp $3 S`!k3P pD0`P /Pdp p4%Z(0  c K<L5j -LqlM`KP5 P%0: S0S^$0S P 0: St 0S ZeP 0S 0S ,6%P@T(KijiHiL5 -@2L0S 020S$20S GePPv g40C S04|||p||0!IZ( 0S 0SO @ l^A0SDH _P> ` p8 0S0SH MP, $0BS 0S R HP 0S 0S \$pX<`pc@Pu0S ,oc`iiiL5ij -LP`XT0P!Pp@0dP PP RPiP@ rP fP p0@0@x u]p00Q@VKp噗0dSd00S\APe0S P0W  00  iiii\\\dijMЍ/ -000 0LS    A a^-0 CR 0R0 S]00 -@RLP 0S @ 0TU0@S 10S<p `(<i]0C3@ R 0S, ,X]0SxO]@ h R @0 S0S000S$>h>h4]]l^ 0-PL@0S(0h,BQP x%t d\00SP f < ] 0 (0h AD]l^0 -$L LP坖m @jD Lm -2LM`@P2 |R tphd2d"PPPfP tP  6\p2 10bSP PP P 0@SX:EP I10S Ya@a,@ "pQp 4  VPP `Da0@S 00K@P 0S 10S0",0S& 3KP ,K  04 P,00S ,040 8KaPD00S  d 0XAu aA'lgDԚT\\XA@l`AAL5MЍR -0L U a^ -LlM`p@/pE@0 r3X0 @P0W4P&KPEP  P0: S 0 0X  (K -LMp`;KKᔁ0,0 mP pP,  +PP PI,L@,![p 1PIpD1 PR ؀P`p*g- @P0/S ,0S  ` ~P00T00S B4P@!`PPᘢ lgN(\\,L5MЍ -`LV@pPq \V Vfd b[RC[VS  0 ^S0 0]S0 $0[S0.P =P:P 0SE  0]S0\\S0nS  0S ]S00]S*@P" \R0[S  S nSP \SW0R0000P R @Dl -`RLp00@P0@ s0@0S S ;S s0@0S S\  40gPV@  @1] -L`@0rS aS bS7tS {S2.000- XP ' 0R0 S 0A 0Sp P 0  @T0S04 t ` Vu4j p-L`@P @P 0S0 T X0 R (P 4 A0$ 0S5Zptu 0-LM0 9SP0S*$S /S\S @PP0@00 00 K @@0 -LBKCM@M @ 50KP T L$ X4 Lt _P@, LP |Pd?@)`P(Lt ,0S , ,0 r 000,0 R#R ;R Pp0000Pt 00,01PPL ,rP,  , ,0 r 000, 0,S0P0-0S,0  , ,0 r 000,@P, , ,0 rP000,00SXY,0PM00,R @0 S I0U,  P@0 SI<  4  ,  P p  p  ,00S,0  , ,0 r  000000,00S,0  , ,0 r 000L ,0P$ 0S0L0P0L0pL4 ,00S,0  , ,0 r 000,0 ;R R  H,00S,0  , ,0 r 000,00\S  ,00S,0  , ,0 r  000,00S p 0P`0K00 ) 0eS * e 0`S01:`   \S0S S@000S0lQP 4K@P000N,00S,0  , ,0 r 000,00S=, D 0S00?,(\p8,@; 0".,00S,0  , ,0 r 000,T  ,00S,0  , ,0 r d000,0S 0 , K ,00S,0  , ,0 r 000,|, K 0S``  0b0 S&01@0S 0 P <P @T0 @, ?, 0,0 0\SS ,)P, p,0@,0 P< Q<H n 0@0  `84 @4 D4 8$ 0hS * h 0`S8 01:@@ @4 P>D$\SQ$ RD `@T`FD - |P \  0 S0@B 0T@<0S@\T&T\00<Si@S`Hd  S"00`0S`P0iH$0, P4 ` 0p40S 4 40 r d00040 gR 9R1R*Rs R;RhnpR wRcV `]p[V 44K E0@s@x`@0S40 4 40 rTDH000 S XT:40  40 400ST$0T0T外T0STDD"p `(0T$}40Tx40040 nS,0  , ,0 r 000, 0;Sk0,0@,@ 0\SSR` @PDjD PPd0 LP0s 0@T F d000 S 0 0Q-+6t(j$j4j4DAXp<Pt \lt~tt 0j,jL| `] uuttPU,P  , ,0 r h000,0 ;R0,0 R @ `P0 @TP U0 1 11(K p-0`PL崗@P 0S 00CS00 Ӥ0s8 r ÖpPUpdl]d -0L0S002 VqPP 00S00S  00CS0s 00e8p800Sp30ʄ]tt -LxMHE0S 4500S$50S  %5 5X%5 4 td$P! $0S00CS04Nst4 008p PD倄,K⊖l4P0S $44P00 P# 0S LP Л0S P 3P @@L@#00#0S`30 0  H3P 430Sv KpP @坚0S b 00: S ß 2tB00S +  + P,  `屁0" P, :t RpP@]' 0,D4+OP 8!0S0 fO !0S0 [O!1 l1t1X!0L10?1P@T P1 00#30pPP 0@0S  0, R 00S S B0 0,  xP00 00,  x 000(Ktdlt <t^tPt4llllp]@l^pLXJL5tdhl -@L 000@\C 0-PL @ 0P@000XC -LM0S쒟r삟P`00S: :SfP 000S S+噕P 0@xB 0h_0 00P2 0@@"P44 "0 0000,K@P# q000 ,0S:V, w, <,0  RN0#SK0nSp1 F000k@(0S 0#S0nS 1  0,0 ,0S %,0+;, a0@\ \0 0 0^0a h 0000L000 0 00,00CTC\l`lXltdt8lvPlt -"R園圢L0M`p@40 07fP aP eP EP) nP iP#rP uP "@@@4@ 0!S00 1@  0=";a!Qp1a0@@QmP 1 @@q0SP0 KQAP2[S0(!0SP000Q?pW! ?04 0 Q P/0S~PPw0LuP /` T0*tlgttt tl^^,\\tht@$<tHhl --LM@0hh0 嶋T TP0H H0H0埋 ( eQT KT^tt\ -Lz@P L5 -L_@Pҗ L5 -L @P— L5 -P@Lp`8 0#P 0#lt 40 0S0000{S  R/t -LP`p/0wS {S& sS'0 p }P 0@wA 0p^0 pp jP @e/ 0(LpPU -P` PLpKY@W000  0 0 -LM`0Pp00S 0@ 0V d0 d00 L00#0P S 0F$ ithtu -L`zK<<<MP(pG!0 0R R0= @P 04 *0l P ` P0V00S00#3 lPP d0@屖0S v 08 00$ 0(Ktttd]tt -T/L莟PM@K0p 0H00-.00Q0Sc PK 0 R0 0< RN 0SPPE 0 n00 > R0 0 R0~ 0SPP& 0Q͟ 0S%!%*000 R0 0 R  0S0 p3P 0=0C>S񟗲@ @ @ @ @ @ @ 3 @ @ 04 l4 @ @ @ @ @ 6 @ 7 @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ 3 > 3 3 @ @ 4 \4 4 @ @ 4 @ @6 @ 6 7 8 8 > @ @ X? @ |@ @ > [k0S:K 000P 0 +0 00  0@ @ C00000S H0S.PG + 30SC R 墑P0080` c f; K 0(0$ 0  0 j  0PL`p@@ʟ0U0  P@Vt  000 \T <*NP# T :$NJPNɟ\N@V P )0iNP9 \ƈP`0VSI$N N(90S00#3 HikPP 8@0Sk h90S0S x0 S  0S ]NP\ 00x 0P~M0Sz`ȟ00  0SD'o0Sl  АP H`0  @   0S g N@Rw0   0SI  NE70S G0S lW0  0S  M㌕Vf0S:F 000P 0 &0 00  0@ @PP tƟl ^` T60S  0S0X00$ <@` 0P] %@0h@ 0@d0 d0Sehp0 SRh l 0T h0SR0S 0S d@TyP 0s3 \0@0P -XaXQXXLM@pdP ?P aP tPp=` ` ep0pQy #z@Pp 0 00 000P@TY 0@KyP 0 00 <{000y@P(K謬ܬ`, -$L M 08 , 刔判0@P`p@ 4 0 0!0- + pP0  UP dP ?PtP@  xP,p  rP 0<0 @ 4` 8` #ep00  P +\-\0S0 h3@QX Y 0S HD < &c,(Ko60S ,0<0 H @My, Rp`=00S40S mljl0+Q H0S Cnl@0H @0 cpD@T=m`P H2e  qi`Pv3p)x1 ,Q. @8y@P" 0 4 R -l*l00+S H R=.l| B@0H =  @0 cdzDF\vD < @0V0 @D0 lyDY00@0  8 R0 00 kY 0 00P00 =g0 000000+QH ,000D R T0FPUt<(Kܬdl`PS\, -L,M0`0rS tS eSƟp Ɵp< Ɵ0p<0 Ɵ{< & 0 0 P8 4 0CiP/ UP' LP RP ?P#qZPP(( fPrP+" lP( pPuP' xP  tP P)P) '  @,4@  8  0p+p-XE P cpP@U,@  ,KfP( 4 0@ R 0K|fP 0 1S +R-R0S00Z 070S C|400S w y9ST4y0S@4 0Z`.SZ w@ / P ` Y0D000  3# 0; 0,0圆PMCP@T x3l0`s@ wPV 0 -Y0$    C\T@T20 H L hw 0 R pV 0t 0P k H R<\B0  LB0 <B0  ,B0 B0  B0  B0 B0 B0 B0 BB0 * .80S L0!SB06 h B\B-Y0 P8B0< SBa ~BW @T@TyTXr``<0*{'9P0 `@0 D , 00Spg(Kq (\<<HLPTX`hlptxp.L5PS -L M00P#wSppD3 W@@`` P0 pP ?P VP vP0P  bp0W 0 Q?, 040 0Q, 0 '0! 8v Pv@P 0v 4v@P~ 0{ V 0BRSA00CSZ^ D^ <_ ^ ] ] ^ V+RV 01A4QA `@V> |A0 lA0 \A0LAQ <A8A%V# 0 10 V A0S00A V xAsA0*` nA`Y`0*0 PUl,-@~ (K̬L5 $0HPhtPS -L$M0`0eS U,pKd4p0S Px Pps pnS eS ESf 0Sp R\ 0-SY0SV pP eP ?P RP/ nP, sP uP rP%0 i?P,@@P  @P, @ `p@0 PP @P0000C030q2 0 40 0 40P0<0 8 a<0  cR<K^P\V00 S =  fR) aR 0R \R1 R@\ - *bR cR&rRD $ nRtRH  vRL     @@  00C0S! P\00 @ 0@0 0D0 0H0 0L0 0`V0S 00@T 00 @ 00008980<-08@0S Sv``8p@dPP@`p U uV0S9wU u`T  u(K441\ -1aPL@p LP PP ?P-PP _p0aV ?0@0S U e@T paPP  ^@PPD?4?0048x<\ -3L,M0CPp`P0 LP PP ?PP` Pp l#_pT30S L?@A~H 4~D Z~3P  H`V P@D؁2P PL  70S2P0S  @P ` @eh2pk@ŸP o k"0 @d P0L0 PLP 1 ; 80 4 K80 0@0 < ~놁0K0 @K,pK0 pdP `R< ,0@<c<@XP00SV <>* >1^*00S D <0/SP0S d@P<@T eH Xd<@L  p>T0(K4XxC418x t\@H<0fP// p-PLUhd0 0S ف`}@}T S@PT >pGp84 - L0 0S" p`@0P 0@Pڛ00s03T0S 0 00S  㞆@ T0 0 0\4 -LMD@KP^\0D0 ?P pP :P  000<i> ^pD0S pp`@@D0T!0S00S 000P(K @\ -LMQp@ 0V`  0 gl0V< 0 `< 0ma ,  0g(K 'DT -L^MPp@K`BKBOKBPp` #0@@@@ +p0S0LK`` KBcKB@K0- 41`ßOK P`( $ 0@ =9@( $ =C 0 0(!K 0K R4 0 , c0=)B@ -B4 0 , Y0K`Q P( $ 0@ =9( $ = 0 T 0 PŸ (0K R( $ 0@=9B( $ =C 0 0 K c0KPR4 0 , 0@=94 0 =,0 ,0  40K R4 0 , 0@=9B4 0 =C,0 (D 80LK c@0KPRL H D 0@=9L H =D0 L K 00@( K4PK @0@l 0@ dL0P4 0cK,?BlPSt| -LXM@tPK`ሀA  0lp 0A 0 0$K輨hPS -pPL@` fP vP ?Ppp X\p0aW {P0 [ DX<P8z)`@T -LM 0 S@p K_P𨝹 0S  D1 `@ _PUfA0A0 0 0S000S0\,4 0-4ALM,!P[?PB 0AT00  K^P7 Q;00 SQ" 000 R 08SQ 0S p0;P000  a0<r;0bP:UK0xC\ 0-@LM P[?P0 0AT KQ^P000 0F;00rS0  00C8S@  RPP0SY?P0@0@{TT0xC\| p-@L PP[?P. 0A`P@] 0S <; qZ7; @TrP @@`T 0-S 0S ~rP<1;pq0S`pxC`L -`L| @[?P@ dpH01 0D0P0S80 40 T@xC\4 -L e9PP ,:T ` \ @PP   9PP @, :,$Zp01 R 40(P:$Pf?p@@P 00P؂P :\0S 3 0 D0 @ D0H 0L0 t3 0 40 0 40P0TP XP <0 8 8@ PX u Ue 0S C0 P0dPU u 0  $0SoPT 0;0 \ R L0  cR LKiXP<0  cR<K_X@X0S U8$0S PkP G" GuPX `0\U00SX u U 00  80T0SP0`S8  @DT 0T\000S _y0@+ M` 9 T 60S  0%}8 zP5`@T\.`\0S @ 0000H2H@TQuP8T RuPPTP T(K L5\4 0-PLM @Y?P  01 @R PK @KU?P  P? 0S@R R 0xC p-aLM!@WY?P 0QUp 0 0K$P P T Q9p00 R  x0000000S0SPpg1 .9pxCȄ\ -S@?S00 0 @ R0%}0 0 /4x/ -p0L R`0PpX0`T0@TPT *U@(0  000`8T<@ -00 LP`p@?  r 0  ^000@S 0@00 @PU:]$uD2p -p  L2 20R2:1@1P10S 1 1:a威P@U0c00D0c!S000p1HA jE41@0T@1 <10RpW1 1a 1P0S0d@cp@`PU 0 0CR0 00R0 0R>* 0R <CP@?@TX0XP@t*0T0 D<,LPT`8@4 -\0\ X0LP0/0A00808 Q005 FhTH4,L<` - P P0  0L 0@0RY0DS ꄴ d t t t T 00CD 000<00S$0 R000CRhPLD p-40LP@`0@Sp0U pH -L - L 0   8 -LMP@p.0`d K"d@P P0080P 00 T ,804<,00$0 00 c0BAꨩpt P-L@Lhp < 0 00  ^LT?@hE0!] -$0L t -0L 0P@p 00S @DT00S  <`4P0S0T@(0W ,H@ -L@@T* -0L0\ 0 0@ $ $ \ q 0 _Q $Q  \ q 0_Q $Q ^*048]X 0-0L @P:000P:x0@0hh 0PP1: S0T C:0P00:P0T0<T4 -1L1`PQ 1@||qOTQI r 0_R $R  LVr0$r" 0 R00 ӑ UV r 000 R0 r 000 R00Q r 000_R $R @T0%"*0@i48X]NNCLU -0 LP000Mx4 -0@ LR 00R 00S 0aS!R0S0S0S0 SS CCR0|0Sy0S  C,484 -0L, -0L8 -t0Ll00PT 0 SH0a R0^0S 0b 4,X -0L0P 0@ 0 $@%@@P Pq 0 _Q $Q  @P@ Pq 0_Q $Q \*04,]X -L -0L@I4 -LD0 <0@ 40,0(0$0@m,`<84@ -L` -0L0`P:00PhP0@x0 p d@\0@P0 HPH0@@@T0h.ꤩ,p0<`84 -D0L0S8000,0 (00@\X -0L 0pX -0L 0BpX -0L贩 -0L褩8 P00/$ 0S P0/thC܅ -LMpP` ȀȠ04 <0 8 0 00 , g@@@@a4 0 b00M<08 040 00 ,0@ 0<LT T(0@(K<,084  hC 0-0L@0ϠP|0x0 R  BR 00S H02 0S@Q*0f04,8X -|p|0L 0SP`:L@  `z v0 0 0 804 -L@P唀`@P𩝸t0 pp 0 R 3 #P0 0V@ t0T0 4H`@D 0-1L0@Th10SP' 0D@P R R "R 'R @P R R "R 'R R R "R 'R<P0S0  S S "S 'S P0S S S "S 'SP0S S S "S 'S  B0ST0 P@T T T "T 'T00[@0贩\X -d0d 0`S00L0L  B P4sz$0 0 :̅Ѕ|T4x 0-PLM& 4@0PKK0K"00Cs00X -L0L`L L8@8P0p`0q4(̅| -tpPlp@LX`d@D0 <0 40,0p p8,4@`<x -pPLHP <1 P0S0g 0Q  1 `gP@U3@DtP f 0 0 i0 0 0C0bSZ PP@@T *@@T*D0 D0 n P@tq0Tx48DLP` p-0L M @0 K0$KK a(K0a `P 0 P$0 `|0AP6X PU<BP:UKp8,4p h 0-T0L@T% 800TPc@Pd[G0@0x4 p-0L 0R 0R`P0P0 x0 18l0@d2 0R  BP 0 pl Ѕ|̅h4 -L -L8 -t0Ll00ST 0 SH0  P 00S 048X00 ,00R00S V8,\ -l1L M ``10 l0lp ,K0K(K4K `Pz@W(4 50 ,0(PcVP00S@  0,(0 4 X (0000S/S dO 0"W00S (4 R y($K8,4p h -L -L -L -L} -Lu -Lm - 08`upW<  upWJI`[~ [~upW`@@<@TU pWh`bpW?A xpWg4pW z(pW z( s?gAypWީT!ypWީT!ypWf!a6AypWJ'ypWF8zpWzrbƐZiAypW{*pWmpWmcNOAypW֧,ypW֧,ypWoq.dнAzpW% zpW% zpWF e!OpW`7pWwz(pWwz( k7!pW$3 pW$3 pW$3 F!pWd4;pWd4;pWd4;s!pW5lpW5lpW z(A~"!pWpWpWoC*y!pW5pW5pW5\!pWkgpWkgpWkg ;/!pWpWpWcr!pW )1pW )1pW )1[KV!pWL*bpWL*bpWL*b!pW+pW+pWVu+9!pW+pW+pW+apW1pW1pW/6V!pW1pW1pW/6<apW1pW1pW/6nE!pW pW pW/67dMapWY pWY pW/6L!pW pW pW/6l!pW` pW` pW` <u1!pW?pW?pW?=!pWڐpWڐpWڐ"Ϋoh!pW ;pW ;pW ;"/!pWpWpW4ce!pWpWpW/6f<!pWH5pWH5pWH5(BX!pWAgpWAgpWAg()q!pW†pW†pW†(S !pW60pW60pW60(WCHP;NV!? n,Bx(9bW,/UlB 0@80 3 =0@-0 t(0 `#3 K[0D@ 0,@ 0@  h0@ d0@0  B0@ L0@ l0@ >0@0 l0 \0 L 0<@ *0(@0  C0@ f0@ g0@0 0  ?0@ ?0@ 0x@0 d0 P0 @ .00@ _0@{0 v 0@p0 k0 f 0@`0 [0 V A0@P U0t@J u0\@D0 H?0 4:0 $5 y0A@. [0B@& [0hC@ [0h@D [0@ O0l@ O0@ O0@D O0|H`@ [0h`FP@ [0P@ O0,`@ O0H1pP@~ [04Pp@~ [0 @ 00H@0 0@ 20@30 @0 @ 50@ 60@ 70@ 80@ 90pP5`@ [0 p`@z [0 p`@q [0 p`@hD [08p`@_(Kd(t4`C  P ȼ l p p 0 t , \ 0 \ P 0 0 X @ p ̻ | D -0L0@[0 <h!0SP!K h}! -0 S,0@  0L0Ż h|`C( -MLMP`Qpo!StB_  Q 0PJ! @TP82@ @TNK @D@D0"U1`@PP@T!!^0S1`@S@TN ˵PP0V,A ,1`@ @T 巵P0j.K B B"0S @ P0^K PE@PE^ @T 唵P0 0.KH0 B B`9V< Kd8<`CL5  -3ML M3|3|x3@p3pSl3ld3 \3 T3@L3,KA.,04#0hP0(s(3(#P`@@:0c0 B0E0b02 '.0S0 0C02BQ2\"0 2 a00cCR@00>Kl0ChhŸ48 00 4`A-(K4 OpPn0(K s`0xB"C00!00S1 @ PV 4 3PUX@T@Z@X00S 0h\ R P0S   SpP(  0  x0 t [x0`0 @ 0 | 0  cRڀKI40`00S0/S T :S000SS@/|P0S +S0S -S0SgUdX %J  J0@ ᤍP@ D80 00 @\)T@|tT@ 80  cR8K30TS00T@00TSV 0Z00 ` ^ 0 00 00S0   00 0 )  /00 /(K 0-0L M0@P0  0 K 0 0 = 00`0S0@@tK0\xC 0-0L M0@P0  0 K0 0   00`C1@@ S@ @0GK0\xC -L M0@Sp@ Q 0 0 P$ ( :00 $ ( (0  (`K(0 PU @(@ 0T:$l0@`0DA0 sA0@ @ $ (0 (00P$0 `A0 ( b@K\ p-PLM`@}PT@^0 P3Kp -@LMp`b@V`1S0PuP0 S ,$ (0K(p $` P t3K -@ L1 a@L5 -LM@0 O@K p-LlMPK@`P@ 6@P]U  : SI  S @PV 0SKp -SL0M@< /0P < PRۻD1  000 , k00P080 4 ::٨pP4@ûpW `e80  cR8KN2@ V0/  @80  cR8K=2@ E4< |P4 `, K PP PU4,(K\ p-LM @KPp,H`  U 00/S  00 (000H@PKp, p-L@`P0=S\ *SZ +SZ@G H000 `0p -0L0p@`+HPT 0r03X0S  H 0 0 @ PT \ -LpG2/@P@pX   G`P`P 0  P!   @P 0P,RU$2PPP  00  U@!a @T00S@ G@P 0 4P 0 00 p'0000SN0KI TY  G0@0!00@00 00` 0PP 0T P 5U  0000 dXRUU\0P 0 |P @0 @  '14DxC,Ĭ\ -`LpPF  @0`;0 00 VJUFv3\K0 00P;00[ -x0t`00lL p@0PP\>0D00 @80000`p 0-@LPF (F@P "0h0P/R00/0AS xC 0-PLM0( 0 , nAF/$ 0 0 0S  r 0S$0 Pl1RhA@J[0 H 0SG Y=D,100 n+|@P  0  ++1, R ( 0P( 0 02" P 0 0@ Z9* "=p $0@Zȶ 04yK0\wԇ$ -0LM  00  P,0 [ 0P,K  0 00S  0iF*?0S sH00SG? PP?  A44 0  4K&?#0S# 400S $PSO G;o 404 0S008;P400S7400S 400;0 0 0S00S 00S T^ @ 0 0 @ T0 0S 0` K 0 0 0pX` \>$Q `X(#0S\0 

9P2?P eP8nP 2 lP/rP ) sP'PMP - @ D( |   000 `  @*/Z Y'i#p00 VaP 0^S   z0@T 0S =pP 6P2&00c  㰀 ZZPY0SZ   P@s XU &iᷪ 崪 0 00 , E004 080 pP8  bR4!P@ ; 7 0 PpᯗP`g 0  )8K ^00SY*v80@  cR8K!P  4`, Q 0 hZZPYYP0S 0Z^  8P p @Q@Y %P Y   R Pp X0~3p Q5 D#D3^4Q``$#$0 0 fB!C S,@P,@ PP0 d B,0S00`V@3@#V@T(H2F/PU@sK= L:z^@@ ,Q00@T`3`#T`Vr-pSK.A B ARPPPL 0w.PPx@K NmP`0,10 0(08`K,0 00@080 4 8 @0dS 400c0bS  @8d ,P $@Φ - -004`W 4(K4\41%4\p8X?<< 0     /$P/Q00/0  -0L`0V`Pp @@⠸P,@ p0PP %-Pw P -$00000Ȭ@  -@@L p-0 l- h-0 輨@ P-L h 0S0S L@Pc00P]00@PV00 -$@L0SPH00 -4@ LP0SR600 -,@L0SP&00 -@Lh p-L`0L Q@$0S!PIPTP0$%0&P00S 0P0&10P0` T \ \0PP0 p\0SphT 0P0PpP d |   -LlMxKkPx0: S K --80LM0S 0 0 _( & K@ -@PL 0P P 0P l0l0h -R  H*T<@Q R0$S0 9* 00訩d  --LM8@0 0 ( '&K --LM@HH*0 40 (( '&T K  --<0LM0S$0 0 ' Kp  --LM 0@00T 0S p0 R )0 h0 ' Xn'P=&P0  D00S   0  OKp`4 --LM` 0@0T0T 0S 40 (0 ' 9'&'p P-L@  GPH0 S G  -LM@KPH0P ᪓0P ᢓK ! 0-LP@PH0 S U0  P0-L@P0%UT0 0hx0  RRR00Q Q/D 00/00  R 0S /H -LM@K 800 R000 0 PT -LM K400@  @RK H -QL\M`p  R<P  (0@003 Q3# V+x p  0V 0-0p0 l 8@hK0Sj j k j  0"#402 @ F P'X PhK; 0#40 H@ 8 @4"T* 3P00X00S 0 SShK 02 @ X 80T p0_(x Z(X T( X h0[S tUp1p0 F(L!UPD1@\04 0P5(l  t PX\ 0x P( X 0S0 (@T 0t S0S T]l0S `' P(KmH,!8!@!H!P!\!L5h!p! !!h!!PS-0  0\0\^S  0008 0 Rp00  ` 0 ST 00C0H0H P4 000P00H!tXpLP 0-LM Kⱶ0P@0S 0@  00CS0<0@TL0@0P  8@T # Kㇶ0 H4! -1@LP 0= St0m: Ԡ@<0̀ p0`P#@ Q 0  T  0R@QT 0  P L00@4>0PPH !X\HT!" -L Mp00L S($K@1 l$0S WX2 <0S 0 S R0S S PW| w%\ Q0rs0`9S 0S*+S S %SE-SB?S?!1x1PR PVN$K1 $0 S(1 >0SB P70P`8@ lP V` W,@TPUV"20@P 8hPU W 0 P@T UW 00 KH -LM`Pp8$ KsV`U (K:@P  $Kd( 0!`30@Wp Wpp,40#00 V  @ X 00CS0<0U@TT0@0P  <1@T$K ) K  H" 0-0 0P0 @L R 0S^ UPR 0SQ\ 0@@<00\, (_0H40 $"4","<" -LM`00002p0尢SpP0S @ 0020@00U 1P0@`00 <Q X Q  00\ 0010S+ 10S' 0S$ Q1P0p;0QPP P@D加 0: 0S0D 002L1P 0S0S0  $#!% 0S0;0 <0 R 0S PP 020 r2,0 0P@ d00S 0S l Ld! 0S $00S U ,4hhDlT"T, -LM0@K 4 pD4,KPP   , 34! R@W `8@В S2 `R 0 @T?!V @W P? 0S3T20S 0  <2D $20S# 0 2pwP0  1!k0K 㩳0 1p@`@C塟0 0!0000U00 0S7㜺P2CW`# 00$10S  1!500S @P.P @PCh 00K ]\4 YZW@ h00S0p >0d@0K D(K  |""" !PShDT"Pl""# -LM$PK@p  #`T`00 0S 0S$ P $K  KP 0 S    R X0!P@ @ $K@ T0d0K H # -LM KӲx0P 00 XLK }@, K@ 㶲 L #8#P# p-8@L`P P WPP@Tp -LM$pK` P呲 K^@P  ∲ 0!@  R 0SUUスP@Bi (f@$K _K  -08 00\ $< 0S0` -LM@K 8:40 R 000 - L -LMp0  h@:, K$`V00@:`0 0000 D0S4 $P0``:$PU00tPP\4 R 0S A0@ 0$@,00@ 34 (  0000003@ 8`P3`{0#004됣@0@S 눀PA0#ST 4,K 㚱 [23 0S 0S 00 820SX 2:Y0$'33 ᧌TS   ,,K g?T20S  HBHHb -@DT 20S   10S - -O ኌ`P  h01@p!@l1 @@@4. 0jd5+  (K P 'H`4?B$\d!PX$ p-1ALP P֭0Ǡ) V*U 0S00 0 R @`P 0S …0 006*@DT < 0S ph 0Spph1\  4d   -!MLMPd h( l8  `}K!-KpG B B0pG` p( \ X8 0 S ``d \Q d(P P P  0`8 T8  P XQX8T8 `T( 00`8 d(P\80#\8 T  T( \PPU T7@TUdUL (HU} 7U0U/*!U #UG AU DUD @U@WU TU VU8]UX PDK7 [U+ \U-$aU*pUk jUU eUE hUDlUQ nUVtUl rU_ sU`vU 1,5^:wU 0P4K0K80Ksw&0Z`}㈈@{@T@P@T+pvp}zP@0K0KVw0p(}l0d.b]]0IP P ` 0P4KODKODK0S#0$0 0`H 4+30K0Kw$0ᣇ0K0K wx$00K0KwX$00K0Kv8$0( P   P + P@v25@25PP/25P~0P4KOKX h25 P0/S4254#00B25P25·P~0r 8~"0002 0 00b"00A0S @00B0S3>C1\"彗 PTK0O4K0X8 P4K0"0㮗vX@` X(@hlQ !\(X0"R TQ`( `( L!P)0!S&  0!0PK0yPKLX@PK Xd5PK@hl(R 0!\X0 & T(R`80`8  XH`X00SHlQ 0x R  Bp0x p0\(0" T8S`` PlQ `h(R`(K4@%dL%X% X\%į` 0 0 0-0LMPP P/)@14!0 0 ⶪPPp@ x0 t0 @߆P0<0( ,140K0\d%h%l% p-@L@`40DSl0P $<(` <408`B400,, pxC p- P0@S0C0 p0LPT``p0P0@0 (0@`000<0 00pxxC --TLM<00 00CS,0030 0 먩xC -0@=C0 0 L ┨]\ 0-80P0@L0  @= 00\ -4L@p" Rğ П П ܣ ܣ t Ȣ 4|0P 0S R$00` ` `, ; bR,wP0V0PP 4P 3 !0S0S 0PP05Z000 3됓,, e P   0  $0S0S '0R S 0 ,0 b cR+PLP0S ^V@ 20S 2  !0000c0 U 0S 0Z0wZu \0S  0S 800S 0S  iY 0   0Q 00S!000  D$0 <00$ $ $@G 0 0S 8 Pr T000 <@@$00$02<00$ $ $P@ $0 0$000 0<0  0R e<@@P`0 0$0 ph0Q0 0S 訩xC4|ClPSh]\ 0-0LQ 0 0P0@0. 0SP 0000P0@00h0 0R@0@\T0 0R0 P 0 0|x -0LM p 0(00 , 00̐0ȠP80 4 `8K @T\T 0S00 @80  cR P[T@` ]T`FTV T004, `v3(K\x -LMCK K   ?@ 02 A0 <0 2KH4 00 8 B 徦<00 D0 ?@@ p@ ; 00 |" 2"< 02 \? P\P (ϟ0S00 0 P P #P000. P\P Ο0S00 P P00C0_> $0 0$0h>0S     K D0  cRDKT p" R Դ D $ |  ̻ \ =0S ͟!Z  0$01  CK;  P\P l͟0S0@0 @ TTc Ta !T`PG00D-T S tV ,0 00Nt ,0 00CKR AK`, P\P ̟0S0@0 @T T T T@UYCKC/K0P;0QU 00!S 0(000 0 0< O 1[S CKC/K0@P@@TPEZ[Z92`6 @_+P ,K{P  0 ,@pP D0  cRDK p0P  p0Sʟ,P 0(:,00 000<0@Z*Z ?Z+Z !Zd* P\P 0ʟ0S00 (P@ 00 ;'Z \ZP "Z( 50 Q0S009 00ɟ X 4Kv0p2 00000 X4Kg0\Z `Z $Z>8  P\P ɟ0S0@0 @$T "T  \T `T0  @p   0@0pD0 cRDK pTy  \00p@o<( P\P ȟ0S0P0 gP(U3 P\P ǟ0S00 V(P @00T4K0 @00c0000T4K0 000 00" ){U0  `PPp @T\T Ɵ0S00 @VMH T \ t #T`T X0  `N00D S `J:$00B00D S?[T0,K6P @,@ D0  cRDKF P000S%,5 @T\T ş0S00 @00D SV 00`p P\P D0  cRDK P@ğ0S00 :P@00 P\P ğ0S00 p%P#P 00 X4K, 0 @ PP00T4K 0T4K0 00@1 0  Q  @D0  cRDK @#P P\P xß0S0P0 CP 00000B S0  P p #00B SD0  cRDK p 000XPp@00 0  #  p[00 X4K0000004 0S0 0 BR CC'Z40 HX4Kx  R" x 000p0C00  7"Z40 HX4K\0 0S6꠵  $  H (Z "Z 'Z*)Z \Z%0000C00 0 000000C"Z00 \Z0 'Z0h 000C0@T40 HX4K02 @p\]p%|%%||4x̬ 8\(Z000 )Z00CS0D P\P x0S00 H)P 40 HX4K0 @`P@ d_00%000 0p00 " i}Z740 HX4K  }Z 40 HX4K0 2 }Z40 HX4K 00p|Z (Z 0@00000 X4K 0p`Z0 \Z"$" P\P X0S00 $P "P \P `P0S P 0\ 6)Z0S0C P\P 0S00 )P00 (Z000d\ZD P\P x0S00 P 0  'Z00 X4K  0 00" 00f"Z 0 0p" \00pW"Z0 0" O\Z L$ P\P 0S00 E$Z "Z\Z `Z Z 0  [  p0  p&)Z  0040 HX4Kp |Z 00(Z  0@00000 X4K 00p% P\P 0S00 Z P P0 00 D0  cRDKDp =KX XU"<Z>Z R " @@g Re`W Va0S^000C SZ6"V0P00C >Z0006 P\P 70S00 Z >P00 S>ZP$@7 P\P t70S00 -P0 0 &PY000 |P00X  S @0000 0@8夠7EP^WP008嗠(Z  Z &Z;Z |ZJt\8 P\P 80S00 B P ;ZȠ4 |Zㆠ1 8&ZK,|Z&PF( "p , 0(,0! 000B01 倠1 0 1 P0,` 1cX T 0T 1  cRCKbP@`9 P\P 0S0@0 @T0S TT 0`!]0/ 2&T, I 1  cRCK*P@  P\P 0S0@0 @ T 1  cRCKP@ 00C04+ 0\l:L;0 ,\;0SP; P\P ;0S00 (P㠫y w0@8 `K0ASb  @00P  PU LA  `ΏU000SI " F 2P d  @P  <R }R<<w 3&  @P 0 ,  0S < 0S (K 0 @000 <00 0= L`W0S  (K0/᠆ -`1LlMP` @T<+0(PUAP `9:|pP0T\S  \%|@PPD 0S?|@P x%K@`PKSP0: Sh0K 0@  `00PV(K耆,4 0-LlMP@ўtΞd 0T KSP0: ST0K 0@  0@ 0@K0脆, -LlMxP ` `d PRN0SJ41`PU$'PA 0Q= 唠KpP1 R`P-0: S)P L0 0hKS0S p0St0S& @>(P XA%h0K 0@ pPU(K蘆%%< 0-0PL@ 0R]@T0脪 - 0L@@T\ p-p0L@` 0S P 0P@PI{@U  `@T00@p\ -(@L0 01h\ p-d1L@`0S  0R `+ 0S P 0Q AP U 00S  0S&PU0 0S 0 00@CTT 00P 8bV D00V 0   ph蘝\40 -P`LpG㵝P@pP”0 P000Q0@\ P-@L 00S PP@ P 00S K00S DB@lpl`P0S 03nʞT000K004l\ -LM< @ <0$ 2   0Q, 00   @0 S 204 80 40S2  2┞@P2 T'04J 40S TXt@2 0S <00S,0S< 00<0"< 8 1 S8 1  aQȑȡp!0S <0<0S0S< < $0$000$040S l1<i<@P5 0S4,0S 0S 000C00 00S <0 ,0S 0SP <0p@P <0$0  40S 0S00}0S0S80 0$0(K4|\PSxC%%lp 0-00P0@LL@PP0h\ 0-L M, 0 40  00 ( P$ k 0Q10 0   00 0 0 x1⯝@P) P0 30S < 00 0 0 T4E  1;  40S 00S2 0Q 000, 0 P 0$( @ 0@ 0S 0 0 0 0 K0\% -/L@.P@PuyP @pyP 0kyP  fyp3&& && -LM 8   p(/OK嘛G/ʋ8(K K⎛t8tX@5)7(bXD L4 @$ 0@ PPX@PT g7 0P @ᅛP P# *%T'7@   xxP hxP ΋P0 D@xP$7  ('(7  W7 @6T! P 0Ph'@PۈƟƟ@0 @W'v#`r&0@/SKVOPxKQOP 0R 0R 0R 0V 0S 0S6T  $'U@C#-%?# $bP0S0SYE+#0 0S| !&Уl5PTU XDP5QL% H5H #0@ 0S&#8xP40S%@xP4 `$40P@T0 08Dp  0p`P-0S 3T1PS00@`!RI  2V @Tt3<P  00P  3p @s,= v2` $2 s@@3P 0 F `+P \+P @$@$0 0$00000 0K`NP 1: Sl2 0S dTBppP 0S 1 F@bI 1*P1 00 00Q "@0fA 51!0`p@@P 0S }lA 0S  0f@TO 0\ 1@T 0  0S "%;0S  0EPH"%PV ,'0  W|0  p 0S00 :x@(Kd&, \pܬĬ04\_T&Ca 0  HzxxC`& h&8sh:p&0.d%h%t&&&&&&&  T 000  R0000000S /ᨪ -L4<0<Q808 RT T;0;@80 (@ hꨪd(p(x(|(((P 0-0@pL@`Py00e儇@P( 0 0    / p-0`@R0 000 LP0Pf 00 p p-`PL@l0l@7VPP8` :  ph➘p\ -L@) P )P -LPpZ *0#S*@Pʦ*@ u`P - @L&Pp``V 0S  f&@P@Pf [Up`V:00@j -LM\p8 < @0 @Y,14 8 ֆPPPHІTX` UU0PP``ї `PUp0 ,p W4 80<@<@ Vp@@ P < 0P9@< T 0WP,   P% 8`AP  @ 0DPPT `< V 0W4\ W:8< Q  0,0 < 0nP (KhD -pP00`Q0L@MS@%PT@P0f@@T\PKT0↔P ᱾rp3 05K\ 0-LM@P K%0S  P00 R0Sp000 0-L@PP$0 p-`PPLP @> P᪄p -\L(MT2K R 0S %Q$02K00 K( 4\ p-LMD`@4 P0^0 Kp4O( -PLM`U0p`QR UU UR0000` USQ Rġ@K$   l0 U00R0S80   U0GS𨝉 0 00R0$`40 -LMpT0Sp! X( DDD* P,Jρ0S 00 Q000W| 0-S /w&P 0-S#3|! D@K^뀓t x u00#APP oP ?POLU<00t1 e<@T4U ` PpA AT (K1!DAHQp1`Pp P%Up">K?!R 2Q+-P%Ut- P@Ÿ0U% 10<<}WsP00x   0P0  %Q  DK|!p40D !R 0-S+S00S 0SQ ,!0S#0D0 !R t1S0P0D010S00tQ 0S 0S x!R D  0Sb Zt1S D  !D0 D0!0RD(K҆!)( 4) $$)PS,)<) 0-@QLPs0 00h 0@-0PS/S``V@@ /p/\ \R.00.\!/\\ .\0/SS0&R00S Rp0 R  BR0/SRp0L0 S/S -Q4LM0 /Qp@0`0g.Q0.S0S/S00#0 `V Y ,  0S:S00SQ000 f0, , RY 0/S Z 0S < 0 bRP@  } 00S@/S/00,0YQ 0c0` , 0 bR@, }, 00S@/S/00` P0 bR@ }Y00(KxC -LM00lSp@ ypPUP@/T TQ /nP `eс`V.T@V .T 0.S  0w/S4 W1@/000 0 bRF@ N}  BKA| oP@C#0Spp( K0 $C(4[/S0jB.K BpP PU(K -LM@}0 0 0  0 00 K 0  yP 0Q/0000 `K\ -pPLP|0PPPMl`0V\@T `@0 |U0U 0h蟐xCx,\ 0-0L @ 0  $ 0SW0[ "$0 0 :Q0a/0 .0 0 P  0h 0* -0L Pp 0S'0+ "$00j  d0:00  X = SU ,0塐@0  d0d0 0 8 @0`d!. ~PO"0S0 0;0E" 0T$000  M000``@ V 0 90 0 0 090* -P LpX`  R 0PXX@@ {0 0 d@d0 @T8KpT$Qp >~p`` P!0S0 0;0! 00$ `` V @gT  { 0 0d0 ** 0-@PLP  0h0 p-LM @P-u9 0' 0PKS!0 `K !$0P0&P}!0S0 0P;0r!0$0 嗀P0SpP 0 0C0P p+(+ -QL0MP T H H D P %PP0pL0 k  R 0 B 0HPP H .X *X  X #X7 +X -X2 hX- lX# 0X+pAp?p=p; p8|5T T0  D  T D,DQT D p bT L L "0lSP0@p0 pP0 p00H S  0 0R00C S <SL0  AD L P PPPP  XP tA0H0S 0c0HT|̟S񟗷                     P0 p{@T00T0 `  TiXdX T iXdX T PoT P`oX; dX iXuX xXC pXA (KXV0D0 (KPu`D  0X pX0l 0X ^ P`XuX7 D0S-0 +00l. *(K1>A P0 0` l 0R 0l# (K%2> &B P0` l P Lx0X000LBB( K l YрpL T00\ X T0 o~X T 0 |?KT ?0K?K?K'40#0 P0SL0 S`qL`i l= S`fH-P+P P0S X CX0C0 0 0H  IH 20P00S X -X0C0 0 0H0I0YH0  0xS0S X X0C0 0 0HIH  00V 0pP0S C X X0 0PUH  fH `Y P0S C X X 0 0PU*H0 0H0 VP0S C 0 0PUHH P P0 H00H0 H(K<+(P+ --LM0 0 K 0- L@Pu  50 + 0R 0S$  p  0R00 0  0QS 0*A0 0  : A0 PA 00 0P0\+ -0L @< 0S0   3 $00/  Cp' 0 :0  P 0S0 0S0:0 ;00 00$ 0t+ - L@LA 0Sp 0S 0 0C 0 + -P L@!T0pD ` 0S p' 0S V0`!  P0 00c0S@@ gxpW0 X0 dP0 ``+ -P LpW`  0S;p 0S @V@@ ,x0 `d0 dV0 W0;f++ 0-0L@P  Pf0  00  ,Ƌ0 0- 0LS@P P h 0P 0P 0 0- 0LS@P P hPP0 ,  ,啋0 -L^\Pp`@ PT00\⦋@|0W0,B0BSV@`ᘋ[p0 F 00p $0(`pp ```+\ --L4MD@K0B 0 0 &bK -p-`P00PQ0 L4MS P 0L@K0 0 0 P@Kp+ -l`L@pP [PP@ P P@@U 0S (0Sd0< `0``0$ p    ),4, -l`LPp@ PPP P PPPT V` 0[ފ00\֊00@0h00 0,0$ (` p ` P  T,\ -@`lL0p᧊00 0,0< (`0P g@P T00ӧ2  `gV@,[0 Q00 o.\/ p- @0`SL0@0 Pp 00P@0T:h0@`0DA0 㐊 A000 000 0 00 p \xC -<0@L 3  @     \ p-LP`@@P`p -L"p0LS<2@Q00@A12 P 20 S T1 T1P``BTR5 1qg6T(P``2T)P``,0DSTEPd100LS T1\L1LQ `R`? !唚`P1  R`09g`p`3V) 0 T $ X00( P@0T:t0@`0DA0 Ӊ A000 000 00 8G \D A < (  -1LM0 PPP0@  Q EQ Q P0Po0 0 0 0K 0R S P0AS@KKK0@  0J t,,X ,l,, -0Q0L0 80 00  0 0bC1!0   0-< <@0PS0L0$P0  p- L0@S 0ES00EPPP!`0P@ @T@@T000 0L 0H00S000 00RP4 5: p 8, -L*@P* P㨀p`! P-U0y@0sPP 0`|S00|P00S 0   -LM`ܡp, PP  P1T0?PP1@l1@\1T 0T P<100s$1 P,0S1  $0 < R 0S UU* &P00FP  R S0P;P@ @V` W0 `p 0pT 0    0- LPrP @0S00,t0P 0P[@P a@S0 @@0  0-l l@0LS00 D0P {P}P 7^+ @0  -\0\@00Lp`0 P 0mbꨩ -LPMN0P!0 㺇0t 0 㳇0@0 , 0 4 娇D.D0@S0h P0,P>U0CUAU {U  U. (U=U 0UVEU! ʬ=U 0U=U 0U- `M`= t0  x C]@@=x 0 p0 m0x00 40Q0b0 @S<$0R@! P EP (PpYt  0Y0' 0g0S#400 0b0S,L0S0S UdP PdP KdP FdPx, 400 0b0SK 0S } P h Z :H @g0DA0 A@ph@ H+004@,0T:0@`0DA0 ˆA0@,@ 0 40 J40  40 o:xQ004  c0S 0g0S d: YM0BSJ 0g0SF0:) S00 x t A p () x }  9x 0`0094@`,0T:0|9@`0DA0 oA0@,@ 0 40 DY| 4@ 4@ 4@,0T :00@`DA0 RA0@,@ 0 40 )40 p  40 8@@0P0 40KL0 8x D0 8PK@0 8 p<0 880 ̗HU  @x  \8 P`8U\\Gx 8ȟ7 0@PT@ @0 \@ '@0S00 7P`\w@@P;PD7  6U : @f0DA0 ׅAP`@$'00䆟P P P;PppdU :6@f0DA0 㶅`Qp6p0fA0 㫅x0 px@6T\  06p&0`P0@ 0x x0 p,6x `@ x  15x@0%05|ş0PX0 0S@\0`@ 0 L5P {P}l  p%l 0p0 d0 mD0 0K`0pS0@@0 &(PP U :p$@f0DA0 +AP`@t00P00|P  U :@f0DA0 `Q@#@0f0 A):0S0 0l@P  dQd pp pdp 0S00l@P xp L3 X@` p @/2C0`P0P 0Dx x  pxx0 Bg `P P0@P 2^  0 0+ px  >1 p x Y@Q@PYltx@ t  0t0 bx0 x@0SS84@,0T:00@`0DA0 NA0@,@ 0 40 4``P00 `A 04 @;0\#@$2$0 f#0(p#"@\)|0\#0 #pW#np#0@pP0S,#  04#@T" 0S#0" "0"= R20"""0 "& |"0t"h"\" 0H0R@20 0 $"0" @TM0 S@ P00S0S / !0w @PTR(  $0  ;P   @ @DT T @D W p,0P(K..(.4.<.D.t-p-L.l-T.X.`.l.t.x.|...........P-X-.....////(/0/8/L5 -- LP4MD@KB  0 0 u8K -- LM 0  g K -pL@TTP` T TT  T30# 0R 0 P 0}0DS0U 8V XV U (V hV    !  @     T 0S`  \0D  80  0i@/D/L/P/T/X/\/`/.p. -@LPW00D -L`pP PW@P@@ vh ( PPP P@th  \0P ZhD W ,UhWPd//D/T-0S0 00\00 C00 RQ\0[S 0S0 [S ]SQ䨪 -L@P0s3 -L@P 0S0=S0 [P 0P/]P Ra/ -@PL 0` 00  R0B0 0 PQ [RP@訪 -PL pOj0W:0000`$`V 0S0P@  y@  7j0 A?V0@0 p`P -[L@'WP 0 d h*\Ђ -L@ P 0\ -L@@P=<\ l\ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ @Fy0#hH0 x@PX1y00hPh@X ,PhZ訬,Ĭx(CȬ\ -0LPp  y 0w03&@  0` xx@T@ 0W<0 0h! -@`L oiP li0p0x @e=00 0@@0c 0 d ox -L M`@Ii0P  0SP1x p ? 1 00 @P0Ps 0d^0a@ 000C Sd!`!`0n@9@0s 0@00S  0 @" d7 r 000 R00ӑ R \p r 000 R00ӑ R K\]//xCNN -LM@ p0 4P`, 0[S)P& PP @  @ᠤx g p0 ,K⋹,  R(000 w(K\/ -LM4Q0( K!Kp@` 0 !00 0P02 WP 0T@T  =P\ 0 0 0 0000!0[S (P000"P0<0 K\< -LMTR0!K( Kp]`42 00@\!@[T 00 AR R0 0@ @  @ 0S0T0 2!0p;2100Sp1$Q0 !Q #Q!-Q ?Q 81p P  p=0p?08p100p 000p0 * 0p0%P pP !0[S (JpT0S@ !0[pS (:p000P0<0 K\t<0 p-LpM`k@P񟗯,f \f h |f g g g g ,g Hg lg Xg |g f Ph f ph |B|v7hͫ/@{ <2G0<0x ~RP v000@/Sp?PlK*Pg0: Scq^0<0뉺TUS`0NJK Cp(1 @0! S 0+7*30<0)0<0"0<0@PT/@ 00  0d ?0 0<0sD00c<0@0<0Kp訬,CȬ^Clt -"1L0#0,uP`@  8˾THN 0 @Q :fV 0̾ u V0000   /@`@0  0 00 0EP @00 0 $0u00\ -LP`@-0p HU@P P0S0 -0L@  P0P ?@  g00 0h\< -L@@P>k $l l l l k l l l l l l l l Pl 0<0 00c0<0~ 0<0l00<0X00<00<0,0 (00<0lt -LM0@ `P h   00 R` 0|1U 00S0 S XSxS   00S  p p10 0@  ,0 --R) #R \00S)$\' pP0000A S00B S r ,P0W B 7 BR00?,, R^lxC] 0-LM@ KzpP@ T00S00 t0S0P 00? 0 0 -L(M0P  0I    0D !1 `o oF@T @ T$T @0!0K!pKb00gb`P T #00G b 0G T CpC b00g0 0S-00g0   0 KxCd0<0\ -L MA00@ t0pPB 4 000 84 `V1 0 0 S- E, T@P000T@T , 0  n0<0 U : @g0DA0 VtAPp 0040040 0  R0 ZTX U :P0@g0DA0 ;tpQ$00gA0 (Ko.t\ -LMK @p' -LM`, 00 P@ 0[SP  @000C S R@0=S3h  8PPd30S T)QP D$QP 4QP(  &0e pk 0  , RZ0S ኼZ |2Ds,00v ,P 4@ ,0D0 )< @4 80 < ` ! 0T0Z0S 40S  <\80S    0 0000,8\0 0D 0\  R@ 000 0T0Z0S 000Q  P0\0P0  r0P00Pr@TU Z 0   \  ?S 0S8  p(K\40&@0xC p-LLH @P` }0`0@PTp\,h  p-0L @T0`0PP 0  0 `PUZ 0 40r0phYr\ 0-@LX{r0 0PHr00S0000L00@0 0L@P@m i 00T00P0\ P0 0/ //.P/P // p@-0@`0 0P. R0 q 00000A S  RJ0QA0C00 \ R J^N000A \q 0  RP*ṗ]G-`W\@ B\D ,\ $\ \ \ %\)0\$ ;\$F\ T\ E\h\ e\M ^\ b\f\t\ l\ w\ |\88 0 BR700S GpR700S 770P: 0s 0 PJ0 Bs 0 P@T*R(7 0 0S 7wP7 0N1 P. r 00000B S P0 0C00 QP  000B Qr 0 @P@T*VPwR5 0 0Sr55 0PLP 0s 0  P0 s 0 @P@T*V PF@5 85 ,5 ^A 5a^  ,\ 5 "\P 3R  P-P+J00S@T*F^f^ R@PV00SV`400S L4000dV,4 0 0S40 P 00SR3 0 0S3ăp30 P`= 0000B S0 00C SPr0  000B Qr 0P 0 s 0 PP@T*R2 0 0Sl2h20 P0 s 0P 0 s 0 PP@T8 P00s010 0PP@10 x1 P00[S (S )S {S }SG ]S     P5 pP@bRP(P&J00[S0 (S0 )S {S 0 }S 0 ]S 000S SAQVR ̇]D (0 0S00PP0/4 P 0-L@ p-D`L0@ PR  av, e 00b 0ṗ p-PQ`LpR@ 0 Q" 0Q   0S0 aN, 00 08@ 0 B, 000pṗ p-p`pPL@ R  P pT8@D00 0S0C0 0 p܏ԇ̇ 0000  ,̇ll 0-4@4P0L +0 00 0 0̇ll `$0R /00+̇ 0P000 0nLH -`L PP@ `0S@ 0p00T巈0@S00ꯈ0S0C0 <000c@T塈0@S000P@D -PL3M8 0880 3`@Y|3@0P?0p40 ,@ 0@ T030P4 S,P,p 0p@ W0h0P40j S P2 0b2!p20 @2 PG -< 708P00\0S00 S Q   U MQQ0SS0… Q^@0# 0´08P\<Q 0P0PQ 0 0S0a 0C 4a 0P00 0R 0S ۇ000pP@T*000S00 ,@S<@Z @>@P0S |0d00᷇\ @000H00 S  00c0(KḣP`TD4@d -`0@ X0LP0  ]T ㌇ ㊇$0 0 0 `T\D@d -,@L0Sbm h]4, -Lch؇ 0- P@LKm0hGm, -H0L 0@S  ,/@TT^B@@$h>40 0-@P L[Y 0 00h p-X`@L@mPLP MPD H 喨TΟT>H> @>P 8>8N4>4n0> ,> i$.$>$Ο >HD0 ^#PP@ P PPP,Kf= ,0 LP0b-P]0 a0bM 0R 0LR M0L-0fl-fPMT]  V V= =0  c= B = =夬=圜<̟Q  P 0 S< pP Ro L 0P 0P ܀ Uv0P  Rl ;0 0SP Rw꘨  X d L L L ˟^ P+000^PP``0^XKX; 0Q0AS0C0 0Q0 0 0ӷ0C 00· R 0S0C0 0BL c0  #0PJ0Q `  a"0 ` a :`0P0@0S 0 p a" 0 g0b 00S0b`0pt0 S P00S|9` P7 P/ P6 Pl 7 P1  P2-P P-9R` `P900O d)a0`ɟ000L)0cSsS CS@,9@<|B8=9!0S 5H0 0CR,8` ^` 0  cm" 00 0ȟ0 `0S 0P0 008 P P pu0S7 00C0'P P P@@ 10@'S7@@ǟ00@007`` P7/U0 h ` @@Py0 S8 6@0( @@U '00F  0u0 PT]0000@ S|6xƟ 000C00T&00L6P>10@L&S0000@000B &0 0P0R &00( }$00@ S 0 00C005 5R00ş%000t% 0P0, hş00 W0#P0%005 P P``o5@T0S  @ğ0 ( 0T00x$0PP@T 4 D4 @ 00`0 0A@v0U3 $4 0 UCp@0KS`0$ R0 0 0rE -0LRM~Kp =pX`@P@  0@j KDtd@A33 -PL M},S 0,SS0 afS nS 0@K ~Q  w}0PS K44 -FML MP KHp H@`㔐K20-,Sp+ 0,SS' g RQ 0GpP V p@=0 =x01` Vڀ,}@0TS1!S00Q0S<QP (K(4<4P4d44 p-L M`Ph}0(0PX0,P04@000000=L00$0(00 $Kp`3E4 -0LSd0@``Pp  @>iP U0SR|f aA4 -LMMOKMH@/pKOPP ^KIP EP KAP KP0`0 8b 42 0r P*04  0K0 {0 082 042 80Kl02 ?K00 8 4P ,P @ P KKKT  |(KD(B444 0-LMOKP/OL00 2 RP40 ,͚P XK]K0̲D'B4 -PQLM Hp EP  TP T CT cT00|0UCTUtJKH/OX2CT H2$K@2W`` 0 @V0 ! 1 2 nK G_KpO {O1!01  01 Q q X@PX1S 0! ]O>K1 01 01 1W00 S,  0 FpP  Kbp@@><0 M7<@t0^K 1 +O0 1 0! Q A 1 ! A p0J^KPEd @KKtT B$K4545L5`5D̲4D&B|55<4P45 -VML MPp<p` cOK/N $P ə@P  x0?{]K PE-KU/N`0 KX0T ᳀ r 寙P 4:?; K5|uB°5̲F$B5 -LMM/NKp/`N0 2 剙@PK^^KPEPE2~K`,N0x 5 @C pP `X ;P @00T(K̲D B5"B5 -LM@/KaN 0 d0C" S  8 0 8 8 8 8 8 8 8 8 8  8  ( 0 0 000 hz0 `0`/KP HK0gS ,0R((fK̲5D#B66< 6 -LM MOK f /V N0 3 @P 0S q(Kx띎KHkKHA/I I  ) \kK,@Mpş|e0h6 9(K4 00PKk.K BHPLᾘ@P 8I NQ KC;P3)Rğ4$f09 (K0\PK8C8sp@K \K$CKK0QS pK$;K4S |d xdtdpdldhdddQ\t X$X4QppB?KK <$K3s3Sp< s3Sp4 3OK00 KS @0@#PJC^ c^  K\KKpK0Kf K\K pKTK0K p fp/4M"Ÿ09 06 06 9 $7 POK@7S    Xb Tb PbLbbHbtbpbK `" 7J3CS '7 K@4"42J1 K0GWS ?0@!PtJ!(K1 0!8KgJ6[ SHK4M6[ SK-M&0rp0K\0K 0\Kl!NJ6S pK GJ8K0K HK4KPye(10S K\K pK 0ge3YY) ) 0\(K̲D B5$"B5h6`686P6X6p6|666666666 66Ȳ667,7!B$P7\7d7p7x77777777IJ7 -L\M`pp@KP ppL.9P p.@9PPpT 1 K T 0S U 1 K G 00K 0-LM@/KL1 0gR 3  aR dRmR sR000 0 d 9P00 @]x\0 0aS KP 0  Ox0P0 0L0 0/KɖPP TKY0gS*X0DPKS S S H0L( cDK P0WIT0S@ St@ Sh@ S`@ @@XD KdL|dK0̲8808D*B@8L6\L8l8$"d8t88 p-L\Ml@KP PK:8P) @@.`8P @K< \@K< @\`p0S.S  .SP @0S 00C S000C 㓕)F TP 00C S@0SX0W0Y0 4K4p 0 , tP (Kx \\MЍ 0-,@,PL(  *^ aT;t; 0-L M PK0 @0 @ 0P4 @ 0 ;P 3jHK0;; -L Mr0H S`P T00;>t2P@j@ H5PH4-4pP$j- PD  0D0 jȃHP 1 5@P HiP pi44O4D0S 0  4 ḛ0;010S  ᬛ.aP i00XᒛP 0-SX0S i@K 04K,@P pif4P 4HP Hi(KԲвL5;;;<<$< -rMLMpCKP 2QbP^20S  P %20SL PG K? PB3`K{c* [P2 RDB@P 0Pp20S 00CS00@Ӥ0F@aQ0S 00CS00Ӥ02 PpyTYTN PI 0S  @h1 1: SsNK@D @D P ! KīPK)4PKxP0: S`PP h 1: S C/K f$KL5^ h]^4<D<X<t< -rLGM@`PfP`P iP`P ,!堡p10cQZ]1pI aKn P 0: S Z KMK@D @D+F$!P rFp0W`/S/00p`.P/P@ 0S @P :0/S @P:0/S@dFl 0S\N  IKAPZ\\< p-LM 0PK*"* 0 ,@`Q$K c\0;hPPP @8gPV  卐PP 0S gP0<0VD_c 0PP gP0V0X坙cPX 0lFPP 0-SX0S $gPKpE 4@L -VMLMp@ᩕ9D9AiP+E P: qEP 0. 00 00000Kc pP<0S $ !0: S  X H  &uK1: S  %  mP|  8VK0@p5 |8|0@t5 05  5 |40CS @B 4 .C5SK <0S&P$ % ! @/P 0S @P :0/S @P:0/SdT /2P 0$ ``/Q @ 0T/S/00p0a0 Sp %  00px[Kp4S;~Sl1: SxHPq0Sp H0ykHh1 S d1S `1S  察H00: SS| 70: S l1: S l噟AH@: S'  SL  S S  SV  SY0X%@]EpH# (K 0TD5BvP7)P H$ 0S P$l1: S p$`40SLQP< PxP0S>P D0rP0 -$@0S!:3P 0S9P  0p@ H Tx% ;p5S 5l"Td0S 00CS00@Ӥ0  ὂ@0S 00CS00Ӥ0  ᩂ PpyTYT 0z< x5( ,0p`eSP,l5: S&Z  " /P /0Mpq 1 vDp00T0S L<jep!(0@PpT00 S 0" EPLeW00x-Pp00P |l6eW 05 |7PP0S rtPDu|(KE EL5 a^^|xTx|dXpܲ@ز] -L`Pp)20 @@P0/S /P@0.S0S .S0S pW 0S0 P@T0SN @1 PP? 2$0BS @ | h P% @F@ Ý0 光 0SR R[P `0S `d`@p`ᆣ@PQ0S ,@0L5MЍ! -0L 7 a^<-0 CR 0R0 S00 -@㔢L\P <\00S \ 0   \PPa40[S  5[0S\O| TZ`@P0VU L00S@ G ,9(Klg<<<=x]l^L5MЍ -0L ^ a^,= -LM@Pp`sPp  剜p00`SAT ACP`G_K㚬@P @W ..P@GKZK\\L=X= -@LM `P A A00 Q0),  0,, pW00P0 U 00 @ep 0 KAP02@0P5)0BAP )0@@,0 PdW pI 0-LOM@P' @\@0P00 K/D10@1P0  :3K0xe -LOM@y'D\@0P00 SK.@10<1P0  :n3Kxe -Lp`.P@+@P04`0K0C*K4M8.K BK( KL:K*KQ=K(0C8 LK( (aK0B8 8 C0(I LPpI( 0 SUx           , ` x 40S 0000 0 0E0S'000S00 0; )p 05  (00?0bS fS)0S00 < 4<̠Č8#Č:K"̌,K(l4, .K 0&880Sm0 0000 0 0}*K0P8 Z0`<`K8ßXK )pN0`06PZ@TA0  0K P T X KLP @T`P X p@ X0Kp @T TuA #2`K@Q V@8a0SA o8;-P 080(x0 0S$v $`@PV  XK-*KXK/(bG0(K00C0:K(K0XKS5XK /1 R)0S S S"Z  fZKp0S   p ,<4("4!< 0( K00C0a( K0S1@$1T0 0000*0S<0 00S 0S 0S8A1000 00 000 00S081 0-0 000 000 0(Kd=n p-PPLP@00+`)@P L00040AP0 r)o)@!,p -L@M` P!> >0 \13000 55:W00000 0 S,0 ,, pW0000P U>*0  0 @ep 0 S>P02@0P5 :*0 J>P $*0 @@00 PdW p0@ TP3 : 0S 0 0@ 0@,0qU dP"(KI p-LOMP@`$0 #|P0P00 UK+H10 D1P0 @@ :f@ 0T  00@Kpxe( 0-LOMP@Z$u4 Ps@K+nD10@!\0P PP :1@n0T (0 Y@00SK0xe( -L@#$,00  Ph|eG-M T 0 $0@(@ P,P`0`p 4p@0Tp  <0P<` 0Ԣ($ 0,($0P00P4@ h ! @(`$, <@0g\ P. 0@!g.,P(@T<@`0$ 04@, p$0( 04$(0Dp4pHXLP @ @0 ! 0@!0@ Q18 P!@`!@08P! LPpHI$PDHpf.. 0 p 8D0#Hpj!E$ 0#j 0P%@@X@ 0H @^LP@D PpX  `DHL@PPT@00P0 00 pD0 00H000000000 L@000 PP`000Ѝ4@G-M0@ Q0@0@0@0@0@0@0@0@0@0@0@|0@t0x@<0@@408@,00@aAq@P `(p08! AQaq ,0d481Q   0p^P0Qp nt ^Q nt c9tP@ t ~ Y9tPp t S9t0P0L0#,0 #(8 , 4 #@ H0 < D H #",#,L P H .(#T X H "D0\ #<`0 D d "(h D0l #4p0 @Dp.\..40[8[T@[?  08^P0Q8 n< ?^Q@ n< 8<P@ < o8 8<P8 < 8<0P0D0#<00 , D04 #880 @0D#\#.pT.l0[#4<8[0@0 @P劐pP0(Ko; 0-PL@ 0#<00#800#400 R00hJ4 -pRLPD@A1>08 `cWP0>: E4@1@ T@D SH0 0@H0L@pf@00 @TpG†@0D@ S H00 @H0L@`W WP 4@1 0S@DR𯝘H0 0@H0L@ \00-PLP 7@0@0D@H0L@0? -RL`D@A1>?0 @PcXPp0": 3@0!0@@0D@ex v@00 @@0D@@H@?X XP 3@0!0@@0D@ D00-PLP 7@0@0D@04A -LOM@P`yTp 0L 0+Pj0 S 0e 0p WK%H1 s000ZP10H1 KQ`0 S0$00D/S$0 0!$0D/ -PRpL 0$!`!@P 0W0 )P0 X "P4 U\   7@0`P\0F"C"@$( -L0M`PpP) K.0 P 0S 0"S UD@K 600 KKP(@)u("(04"48#K -鈑LM`, W0RSd0 S SMZK hP0U UP SBU U8p UpK*K0CcMKL8b=KRKp(0C(L8 A((0B88 L,CP 0 S]l) . - . - 2 2 2 2 2 2 \0 X2 x2 0 0R,040S0S000E l0St0S~p0S{x0Sx\0w"0"S000/`0SS S000&d0SS S S000S4 Py\0@3 ,KkP0,@80% R! 0S S0S080S 0S0S0S 0S 00S 080Q,nk`0S S d0S S R  h0S S R  r 000SS\ 4 <h0SS\ 4 88q < r qr h0S r q0000000S2TfTFP\0  0&06 HK$HK 0P0p0SV,0SSP0 p$p HK nP0sHK0S=,0S:\0 000G\p0$0 00?$0` R$01D0s),0S000 0-0( 0?0bSJnK@`F|$@`F(|@0 4 p} P000P 0|00 00(00?0bS fSe'|P0 0  `0S$01D0S0 S0  0 0P 00 S 00P7 `dKX0$ 1DK8`ß K p` @ K0尼P  #p@TT \0"   P 0 S 000 0 0 30"P 00( r0 d@K$#K$%:[0C:K:K:[S4b44@MKdK#%KK :QRA(K 0R<K ?4K^ 4 K  K |0 'K ^(KxK0K0KK\0 :K*K@!Kx4(K0 K(Cz:K(P  | K<P@:[T(0 S 000 0 0$ '0 000 0 R,0000,1,1 0 -0 0 000 00\0(KTAx|AAASAn| 0-0PL0S0@00@0P -0@LD0S 3/H0S3/]L -4@LP APPnA 0-P0LD0@S <3/P00P@0PH0S 3/0]Ld -Ls@o@ -LM8 Y< pP ax4 2n P!X20S002 =PP 20S00#30#@p3Ps 70m,`   P00CS00 Ӥ0w R r ,Kx80SW00S  P<,K٘0,K՘@P 0K N00S p00RQW00S < P,0S  ω R ,0,SP SS SP00P,00,0 0004  0(KP]Hm p-0LMD0@S`P t3/P@ 0  7D0@0S$0H0S 3/TKp]Ld rS-@L`P"@3:pp 0P@y@w 0-h0LLP\X@ TL 0-K4y -L$MP` LK 0 Sh S S A 0R0R0TS@0SQ@0S  4K0C*KM8.K BK( aK(L:K*KQ=K(0C8 LK( (P 0B8 8 4C0( L( 0 ST [ V [ [ [ [ [ [ [ [ xX [ [ 40P0 P 0000 SL0SRL0S 000 00S00S00  0 .V S:V|` 00FV08 K@Pr40p@P  Xp 8K p4A0 00e?p 0r (00?0bS fS0S4 0R  0$ :K(4|5<K 0%880S 0L DD*K0P8n L YK04`<( :KşpK8 pp0`0>PY@p K ̲P@pH K@P T pH Kw@P:KHK (qP`P l p@pKp @T HK 2p`*K@zV@4au0S 8P 080(pw0 0S$p0P04 $`?@P  pKpKHKwnK`F4[0C4K4[pKS:K"*r_KpK *K(2`VR0S SL- S SG6Z:K "<K2P8:K$"{*2Z0*K$P*K Ep#:K ZYK 4*K Z Y :K &K p 4[0C4K4[S@$T0 000090S <L rp`0 0+0S00S 0S4A000 00 0P0S00 00S041 0 -0 000 000 0'`(KAn -L@`p$P 0E@ -`PL@lP00 p.PP d0T04@0 T0L0WP0 P7T   -L@P 0@0B -PLU@p U]-0S )0P.S 0 0 05 00 .S0S00P 00 0  h)P/* mY)`P0U0  U.[P  0!0 000 0m 00 0 0  ;)P* m,) -LPp`@P 400PP<4p8`@x_ -LMBKMJ@PJ `p 0 Sh` $` da da da da da da da da da ` ,a _ ]<00S0D00@RT1 < Gp 06 P0 0 0 48 P@ 0)o0 0l0Sp.0+@P/ @0S) 0S&$g 00D0 0 0S00< S00<000 0D0s00   00(p$-0 0p `(K -L@`pP 0S@T/ -0-LPM@a?KC/_K@0 Q Q (06Kp@ `@ `(,0 pK\ L0 ,P l  K0a -L1M`0pPKA4 8 0 p 1S01 R rP T 00000C00SP0 r [000%R@QgQP'eQG*GQEQC*9Q0Qk*%QA *QP Q7 AQ6 DQd[Qv OQg XQl LQBcQLP aQ!pQ jQ3 hQ4 iQKnQ MlQ1tQ6 qQ1 sQ xQF zQ. uQ?PP0SP 0S0 0C rK@@0hS@@0lS@@L@@ 000C@P  P0# z@KP0pKp"KP0 n0^S  0J_C0 S RJ!- JK0P-S ]S S@Q00]Q0SJ_K0 RLP9"K @P3 0p0p@  0p p @p p 0Oq '000 @P 003 P 0 0SP  00CS0P0 r X000U񟗰h h i j hm X  PT0*0PdP # 0hP P 0ᅞP 4p4 X P0P0CU  SP U/0(K 01SSU$@P0X0C000  0SjP Tj (K001SSPTe 43p043 BX @ 0@ B0T0  RAP 0 r U000 !P@ 0C00X0  0S#P 0 r 000 4 0d p4 hT0HʏKS8SJS0 9R 8R%*0R +R+ -RH(XR+ A0BSAaR>:fRxR:0PI0 J"00003 J000S03 03 S  :J   60K0UI0 0 0CS0000PU  ?K0CUUUXPxPPE;-0 80#<80#Y   0p@  0p 0p @pp4# 4# 8 0`X H?K8RPPJ,0 9R 0RJ#*-R .R +R!ER eR  J  J9S:J0 0CS00006PX   _K@PEt儰T-xePEP zxw;0 8(d0p@ 8Cd0p850p4# 4# 8S 0e4P4 4(K]B -LpL 0`S@P 3/ 0@S 3/] -L M0`ჀpX0S 0@P05%p U{@ d0P0#%p@  N.%@  bc$$K -Lpp p'  @0S1'*p7@ @0S1 8CX0 8CXp@  P 1 A P@70  c`@7 p, 0R@000`@ & 0S0 0dCP`V U00D@ 0DO/K@' D %2 @>&B aP`@ @'O?KPbdUh7L7 vZ 0K⠡K)0KL7 @ P)0[Lp'PS*0[H H SHH  t' ,87H@lT`$H` \0 R0\0 ` xdK PK@DT 0@` \0 0R\0 ` xdKPsK)0[S )0K000`  \0R0\0 ` xdKP]K*0[S 00+0K+0K000` \0 R0\0 ` xdKPEKtP,8H'@bTT`$H` \0 R0\0 ` xdKP*K@DT 0@` \0 0R\0 ` xdKPKL7@eT`$H` \0 R0\0 ` xdKPK@DT 0@` \0 0R\0 ` xdKjPKp @!` \0 0dQ,8d `'R80S\:000`  \0R0\0 ` xdKAPKh7Sp 00d`  \0R0\0 ` xdK(PK80@cTjP$(` \0 R0\0 ` xdKPK@DT0`@` \0 0R\0 ` xdKP{Kh80h a<0@'XG0bT@T` \0 R0\0 ` xdKP^KX? @cTkP$(` \0 R0\0 ` xdKPFK@DT0`@` \0 0R\0 ` xdKP1K@hX'P@ p7 00d`  \0R0\0 ` xdKPK<0@hG0`T@T` \0 R0\0 ` xdK}PKh?@cTlmPʡ(` \0 R0\0 ` xdKePK@DT0`@` \0 0R\0 ` ҂{h'Rp7U @d01K01K>K000` \0 R0\0 ` PxdK6PPK@T'0B0` \0 0R\0 ` PxdK!PPKh7T@iTܮ`2H` \0 R0\0 ` PxdK PPK@DT 0@` \0 0R\0 ` P @00`  \0R0\0 ` PxdKPePKXK\` \0 R0\0 ` xdKPRKp'* 87H@lTaP"(` \0 R0\0 ` xdKP7K@DT0`@` \0 0R\0 ` xdKP#H'8l1R 0aR \0Sl  xdKP0㤐K`0 \0S xdKP0`0  l' xw0@l dW00l PP L@P 0KP Dh Nl(K@I -LpL 0`S@P 3/ ^0@S 3/]Q/R/P000S/0 -Lh1P0S XX18P020SX000S001S q@`@  e\ \0 \ `p@P0VV 0 `00h@0S \\0<0S H0@@ X 0 01%<]]|eea -LM~PPY 00zd10>CNKXa@D @D 0P3KHH  p* T0S \PT4 4`K XpEK0D@K0@3[<3K03K\ T8  (0!"(d80S m00@3[P3<8 q aP@<0X0FP(K\  p-L@ pP  gp` A0$S =@;9P@p p-`PLU@`rP`0h`  h0S0#*P0h``0p -AMLM8pK`d P(K0,0SF"[3RB2[S?2[p< : 8 CNK"[ @D0@DD0H Q ,0S+#[<0R'#[80R#@P2[  ڹW0 02["[[AmK0`F@`FT@D,Pd 00S  00 K -L0MP`XK8 | | p TP 00 `P @@P <8P 0P P /0P 4P |P `P h p-LP@ῳ`P@봳`p -L$ML 媳70 S00p0 2K<KCPP 0K,p$0HKS4PP@4 HPK`<0KPU`PZ k 0P` /2`cpWF$LP j (K@B0 0/0 0/ -QLMD H0  Qz H<̠Č8#Č"̌,,H0 @,̠D!d , 0 @ P ` p @0  < 080  4 000 .2 0$20%20&2 0'2(0(200*280)2@0@0#2H0<0@#2P080P#2X040`#2`000p#2h0"2p0,0 #2x00 , @l  D<,  L8  T4 \0   t DH4 d @P`$p,4S-!@ T @!  8 ;8 d, X100,0 00`VZY`w 0S0%5,0 r<040R(0 0ZY (KCC -LMkP"{`@p{xb"Kq 0Sn"[0hS*1 0Q Q Q QD1Q Q6 Q=  O4!Y;   !O! J&" 00S   0S   [`0 $000 0S 0"[0hS,0 0 0SC C 0-< LP@ P0 -0L.S@P#P*QR00)P00X0`dS F>R`V@1@! >WP P0@0S.pJU000U -h3LM00< 00 0s 00 S P R P u@0+S  -S00  ` Pp8 4 !R ZZZ Z5I$@ `V"0I845A$@  8 4  0L.\  0 S00S@ P 8 0O4S "8S8P 4` ` 4` \<@8 K  V d1d0@0\ 0 R \Ap 0P0 00<11 0@PJ U  0TF9#ZP @P X 04087# <0 @Tq00 (K]NDDC -?@p##pWLMX4 0O?   BE!5;t T@E"0 01`V!U2T1p00   0ጉp  0)T 11 p@Tp0 2H$|p0OT?@ 00@@#U[ UDe VZ00@@P` @ 4R  30 0r03Z cY 0zdyVUZ00@@0h 04X U  D 0 044 ` I  (KC(DLDDDPDXD p-H<`LMP@2Pp0Sp -LMP@ R@00 00 -LM@zpMЍ- 800Ms00Ѝ p-(LM"X`  p@pp -LM   P<@"00S0  @0 $ !K00 @P $K p@K$ -LMP p@ 0^ Ƞ,Ƞ0@P` ("(p V`00 K p-LM ` Ƞ,H@PP  p 00jKp -1LMpPW@: 0`A("S*"0 0+Q(0V  ` P  000 `0 P*@` w$0@0    ? - 2L0PP PP@dP0 `0`p -QLM@39P T@ -L$M`p@0 6 1! /< P + ?@,?P@& +} 0p@ 8PK  00 000 Z00000 ,1080 4@ SpP@Yt20S. a< 0pr P*@ت?00tӪ0S<`l d0pZ P*8@?00@ R00(K dDwd DT'D -LpMd10@W,0   @K@PK {p@K@  __`P060#0P@U@K ^  Z  n A_P0\0#0P@U@KՖ A  = ᣝ0, 0R (KD -L\M` @ V^PP, p t x a 0Cs^0l0 yPX  - hKTpK| :(< 0|0(((  lp t0@hD0@00 hKp t0[X0D0 @0A 0@A0#Q 0@ T:V@1@# x@Kx `d x V@@PKl  hK@K ,0 S (KD -L`R0M0@Kp0 0m P 0S d.XmP 8ymP @ ,KP0 躂, R 0S!V000z3Z 0Sj0KWmPd @ ,KP0 蘂,  R 0S tbSV0000K<9m05m@PB %0PVPS00S000#m@P0 %(,0S00S000mm  mP@$ Z 0S 댢PT{bP0K lP $nb$K8sDDEEE -LLM0 0rp$0 4K m0 0DKs a @ P$`DK 4KP@ P$`@0 @P@(@0@P儜0$ 0R  Ka4y8ED 0-LMP̨ 0@p DQĨ@0\I 0MP ЍЍ/ p-LMHQ`@PJ KPh d0 a>1 18 @0 0<0 0040 V 0K! 0'0`0 K1' 00Bdp PT00S d@K[f K Ξp 0#4 Kp\E`IpEtExE|EE -LM@0pSKP00ハx`-\P@f2L-SP?T00S@ .0S f  -LM/@0 P0 K僀pK`I= -LMP\@pT` U 8&(#(V Aa/ :00 Pb :K\@PV 0RR 0RN3PI 0REKl0 R?( (0R;:Kp0 ,0R5P0 P+$$P&*Khzp$ :Kd EPZ*Khjp 00S0@ z|P᯲P :K`h_ KK`sᥡ ,0 S ,(KBBB BB4PB$B0SK0 F p-LM\`@PzPp D0T  ,PPp @@p`IdI -LM@!L Np 3Y0Y-YTat -0LMM0,0 PPWoKJ%T1[S   O@P UK,MK h0 l囱 .Pp  ,0 S F(KFF -LAM0 , 4$ 84 `ȑ@ Pv?0005ApP 0 8P d0S hh!0ᆌ48$PD U0S@ 80B^KPE@DPE F(0K@tDfP?p%0 b%@P P 0+4J` P#lpp 0G04$84hPe ,0 S 0(K 0 ^`PP8  fP@ S`@P7 00S4 KP 4 R ;;S >`@P!0 Ӌ<P 4h (`Q@  0 8K1@P П$@(KHFdx(T' aFTBRMA Q:0S Ѝ/ -LŸMS 04 < `0 80 @ D Y00K00@PPU 004SQ@04 S  P<0eS\00 @000T:0 R 00S S0B00 08 QR 0E 80R P000C00 0<pqp3\pW  @P<<@ Q 0 00<@  pX00V00S< < R9 ]P4 0<pP@"0B 0S S 0S 4S8  S4 S S 8S S R`00 0S 00<D R<(KF -aMLM20$0 pP" p` ]KPE[NK@D + 0K 0(E 5 U\e kLpTcKPXGl06: S  S [NK@D+ K@@P[NK@Dx1t! 0K@@XH:AUTUaD[NK@D``PA0S  K0UCR`PX& Y#"n/KLPX [KAL#! K2SPX [KlA_\`00S $0 S 4 KDwd T'GGL5edA4GPGFF -LM  K K0K *P K 0-LM@P3PP0.S 0a C00C0  SRQ00 -LM  K K0K P K -0LM0`p  $0 PPKPUOK W SKW,KKWJe.P _K5x $0 S ( K|GtG -,"L$Ÿ M RP`@ 0$ 0 Q 10m Q 0 0P`bN Aʠ^   0b< 0BcA4H6&? `? 0S_ c`\ Q @ p^00P00S P@T00Q n B2`p? W P  |0 ` 0:5 6!ƠP ` -LMP`pDPDPk@kT kP  0PpP` -QLM@< P@0 R0 0P8 < euꕘ$*`@ 2/P@&@03/P  0Q0p <净XJZ p< e║!0 4 4 080 R4  0 R0<`A< ꕗ$*@ 2/Pp@! 0 R0`<0pWV㕖' `ᕖ$8@ 2/P 800 R  0 R04 <00Q 4 8. (Kki*C-@M 804 (, $   [ 0 "6(Ƀ.,40(0P` 0P`000#(p@$p'P(`0 @pP` P`  0  $08@7(ǂ P`@P0 `00#@$ "!0 @ `  0800Cs80@Ѝ -LM `00#@$0@P|0#@$G-|0|@p!"h0h@P'`(`0`@! "X0X@0#@$0@M0P ` (0 0$0Ѝuespemosmodnarodarenegylsetybdet -LM(0P0 @` cT(0'00@0#@$0@/`0#0# @$,@$`&'p' -LM@  -LMPUp (0`0(0 @hU 01:  j`Pd  cPE` @U U  m -L4MlP@K`pP$ X0  w$ 0R KG -LMh0`p@P@T00 0S  Tp @0S ԟ]* --LM0 0 KG-$1M0 ` p00S0 XSxS  R!! \s  D A0a00c0PP@S @0 C .S^ s 0 0m C Q171Q Ѝ] - LM0 K  原p K -L M0 ] K p-L M@P`DP0fC @\000C S 0 1xKp -4L,M TK@KT0 P@ tPXe/P4@D0 D D R*0S0 |S :S00: pP#X0@0X0H KppH0C<HPK (0@pH0 00@pH0 ,0@pH0@D K40qPDh  @LppH0 8#(3 H K,@pp2B, 00H0800H K7@pp8 40H 2;?C0C,  4K2 ^4 0 0#2>;3Sa SC S- Sy'S- St4So S Sj Sj:SL Sb Sa^S\ S\: SW "SVH&S SQ 0 P!P1WWIXF4!W,1W? W< W8>32 0 00 0->400 2&0aPC E 00>  >3 0>3 S0 >01 >3 S00P@ UsЍ -LM` 8 Q0@4  0Q0 pT|0 0Aό  P=0Z W00 W00LR,@P@ X00  X 00"U00P@T  T 0  @Dʰ1U  WD w 00 000s03_W0S  X xd 0  0 _X00R08!SP W" w 0  0 _W00R0S U  X x 00  000s03_X0S PA?E0CS 0  0<04 80 Z\0 04  p\0(K] -L MPp0 0A>#R R R >3>3>3 SR8  R R R R RR RWp0 0@0  000 DPP`I 0`P 0 `pw0 0`0  000 FP@IpP 0P  P00S0@P R@ 0rpE0 00  000 JP0 E0`0>3@ 0` 1>3@1>3"S@D0 @w PP0 @<p 0 >0c"O 0 >0c"O0 @ P U/(KG- M,0@H`pIP>3Sg SD S. S'S. S5S S S} S=SW Su SvqSo Sq@ Sj "SkV&S Sf0X !1XX]YZX!XSXP XL>32 00 C 0 > 0>0 0 `0 S004S0``C/ 0>0 0 0 00$ P >3 0>3 S 000 0>0 0 01>3 S 0     0 0 0` V] Ѝ -LM8  0p 1>#R# R/ RR7 R R R&R; RV ~8WY 0RU8 WQ 8WL >32 0 0C pc0W0] 0W80W5*0W0W0O ,+*0 S(0G$0W!* r 0_R0W05 0W Wr 0 _R*0W0 * R0r 0_R 0W Wr 0 _R  !>3 !>3 S .Z00SZR 8W 0J000 Q>3S9 SF SM SS Sd S0>S4P "0st `@S dR 8 0dW  P040 !0S   8  0P>3 $0 1p 1WA  >3 q 0c 8 P\ @>30 @C1>3@1 >3"S@D0 8 @P<0 1>3 S5 @>3@d_8 0 0 P0 0 @>3@d_8 `@ P 0 |P0 0` p(K] -LM8  0p 1>#R# R/ RR7 R R R&R; RV ~8WY 0RU8 WQ 8WL >32 0 0C pc0W0] 0W80W5*0W0W0O ,+*0 S(0G$0W!* r 0_R0W05 0W Wr 0 _R*0W0 * R0r 0_R 0W Wr 0 _R  !>3 !>3 S .Z00SZR 8W 0J000 Q>3S9 SF SM SS Sd S0>S4P "0st `@S dR 8 0dW  P040 !0S   8  0P>3 $0 1p 1WA  >3 q 0c 8 P\ @>30 @C1>3@1 >3"S@D0 8 @P<0 1>3 S5 @>3@d_8 0 0 P0 0 @>3@d_8 `@ P 0 |P0 0` p(K] -L MP < @0 Q`40(@8 4  0V0 pV|0 @ 000 0Aό@ @0Y W00 W00b,@`@ X00  X 008"88V00`@T @T 0@ @D1V  WD w 00 000s03_W0S  X x 0  0 _X00R0S` W" wP! 0  0 _W00R0S 1V  X x 00 000s03_X0S `A?F0CS 0@ @u0@\00 0 8 00 < YP  40  8@ 40UpO0(K] -L MPp0 0A>#R R R >3>3>3 SR8  R R R R RR RWp0 0@0  000 DPP`I 0`P 0 `pw0 0`0  000 FP@IpP 0P  P00S0@P R@ 0rpE0 00  0|00 JP0 E0`0>3@ 0` 1>3@1>3"S@D0 @` PP0 @<p 0 >0c"O 0 >0c"O0 @ P U/(K -L|Mp 0 \  ?R(00  p S$0 0    0 Y:<`V Ph@ 0R0@ UrP @PE Tʠp0 ` Xp 40 d \0 H0 T P @0 <0 80 X0X T0X`0 `Xl0AϠd  0h t P0tXph|\ Vh d00 V`0d0],@P@ Wd00  W `0<U, d0P00@T d vT 0  @D| U  VD vp 00 000s03_V0S  W w0, 0  0 _W00R0SP V" v  0  0 _V00R0S U  W w+00  000s03_W0S l[A?E0CS 0d   <>  X00S  0td   `ZhRL  x\HPH0S dPKL 0@PL00L0  ^H0Sf \Pd0 D(\ \0S!  \02  d0D0RH0S `0 dKL 0*LQHP H L0SH0S\ dKL 0,P`dPKL D T 0 5/@P 0 - L``PP" XL0`0`O/\ @P` d0D0T\02P`P`@T\)H     0  c  ^*<`V @Pi 0R0@ U᾽P @PE Tp@ d ` Xp \@ H@ T P  ^P@ X d0D0 < 0 0D 80 0 0D 40 0 0D0 0  X04Y80<@x0 |  T0Y`0 pY|d0 00AϠ0 d@"d0 xl P0d`Yx [lP  Wl 0 W`0,@UP@ Z0  Z `0XXşX%U00 P@T d T0 @DU  WD w 00 000s03_W0S  Z z$ 0  0ğ _Z00R0S P W" wp 0  0 _W00R0S 4U  Z z  00 000s03_Z0S SA?E0CS0d  0 Y00R0Sd0 |d0 xd |0m pNlL 0S y\H@Q H0S dKL 0@PL00L0  ^H0Sj \Pd0 D9\ \0S0  \02  d0D0RH0S `0 dKL 0!LQHP H L0SH0S\@ _dKL 0PPL D T0dK F@P0 dK> LPPPP" XL0`0`O/\ @P` d0D0T\02P`P`@T\6H4@2 L0 SL0S(KeE]Z* -LMp`@ a%:/P@D`@T -L M勗 K 0-LM 0KK 凞0PSG G (G  0@-)@d4xB 02d @-M#Ѝ@4=> 0 -LM KK K -L MK  K,P K -L MK  KP K -QLM@ 0K00#0  -0p03T0S00#0K -Q00P00LMS 0S1ó0 KQ K p-LM0PS1ó 0 X0 PK@`@T00 0S T @0S "Kp]oK* p-LM8A0S,1P0S 3/PB PP?@Ԑ:00S 0(0S 3/00@T0`P0S 3/PP  PP @Ა@0S 3/@T@ 0S 3/@T$00S 0,p8_]] MЍNl^ 0-LM 0@PާP \0ЧP0p0 $0vP00C -LM 0P`ᵧPp h0ZP X0$(@= <0 0pC=M&"R!" Q\R0"S0Q0 #Rt0 00 R R R L0 000 S S S  R00LЍ/8 -LM$@P H00< -LM0@P  P<nG -LMC0SP S gP  BP0t00CS00 Ӥ0g R r  r 0R#R S3 l0@S0 e0@S0]@2b P  .P  r 000 00T P  r 000 00 0] P  r 000 00 P  r 000 00 P  r 000 00\ P  r 000 00  P  r 000 0 0 P =Q P@pWyx00#S #W0 S SHP@0 S0lP0  0 <]X 8OGGG7G 0-LMPXP @P0 -LMp `P@P@;P 0S@W .P P @TP @ -LM 0 0P@xh -LDM \p, 0 \0QD0XSxS@ P<r: 000D4 W @`  Q#00ӑ iPhh#h3e/0T02@0 pW: @Q q "000DTpG. v00A Ssآ` P@ j Pv"2$TaQ 00A SpWa:/QQ@ .QQN00A SK/Q!D00A S00V0S< @ jj P$ T9Q *00A SP&Q@"V t0S SS0h1P@@0h!0Q  0T2Č@0(^PK2 #1P@(0/!@P00 ~PT@ dK0 ed0S@ @00ꕌ/00@ ,0 S ,B(K]0HNDHHlH$HHH -L M 0H^ -LM0  ^H -0LMP`0pK00KP i 0 ##SVPU`0.T00S` U @ TU 0K 4(KI -l2L M0P,0 PD  PD<@K 0:S0:Sr ` p@ H >rPP1kP 1@ RY0cr1WT @ %:TXZ I0SF H 0SB'$0 p`p@ .T5`,0KV1 hP,@TX  ,0KR!0'$ p`Z<K 0Vj  0\0 l^A0VD<K ꛋ/00 ,0 S I(K(IIH -LMh0`p@P@T00 0S  TP @0S ]*- 0-Y+ ̌!0M0@  0Ѝ -R00LM?@ D $R DP@<0 < 80 00P2@p0 @t 0-T0@40  +T@4 4  z 3Z00S 0T0XSxS@p R 0T  Po 0q 0r0 < 8 00D S t8 @0002 W070c P,R(8  R<0S <@0T8 \00P00S Ί 0< 80 "0 0 <0<@8<# 0O<0 8@  @40R00S <Kp< 8 DQ RpG@p @0D 0<K(K] -RQ3LM@`P :Q P*W000@@00)@& 0,` ,0K80 R040 (p 0p  2/0 R r 1S018KC~<0`0S 3/V 0`@ K] p-0L$M0PQ`0 AP P<@K̯l 0#20000 Q0 0@0! 0 S KpdI0S 녇 "00hL0U@1:  @PP <0p%=f0 0Qp0gS aSoS uS ~p'}C~pp+Y -Y=Y YI 0D0=Y0D0 H | 0sS gS# XSoS rSuS :wS xSyIW  W 0 |ꒀIX L U:@  @  㑃@P 0f0P@0 D!L `<0  PH +Y00R0D=YSD  L U:@00 @0 h@Pc @0f D0!PL `< H0X PH L0U:@  @ J@PE 0f0P@0 D!L `< 0PKXD =YRLD0=Y0 UD0 :@  @  #@P 0f0P@0 D!L `< 0 PH R$ L0U:@  @ @P [0f0P@0 D!L `<H0X ]PI H !0S ,SpX+-0S2 `0+S -SXS@0-S0  @ +S0  @XS00T@p`Qp`\p` (K -R00LM?`p$RW00`1P0 @t 0-T@ +T@ v 3V00S 0T0XSxS@`P R 0T ``?0 + 00D S t 000 W070 cRQ00\00 R00S,, "  @Q00 SlW QE (K]: SMb0  Sc0  Sd0  S  Sl0  Ss0  S-0p0?0 0r0-00w0-0 00!=@S S-0  S ! Sx0S0s00 r0-00w0-0 00 \ \-0  \ 0\x0S0s00r0-00w0-0 00t \ \-0  \ @0\x0T0t0000 00Ѝ/ 0-LM@P-p! P *p TlU` p@ F8C8@8T000L +*'*#* -LMh0`p@P@T00 0S  Tp @0S ҄]*M3P3tx x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x y y y y y y y y y y y y y y ,y JQ QF& Q*  Q Q>*0\  n00\  r00m0\  b00\  a00\  v00\  t00\  f00\  s0\00 L0 R00000Ε< P   ?Q*Q #Q[Q \0010"#0 000 0@\00M00| `0000  0^  Q?0@00-  00Ѝ] p-LMP`@0 0 S  e0p -LM@pP`T0PEU0 @U 00g0 -LMp@` }PP@  @x` PPo` -LM`8 8!#1 " 0# 0@ @1 K Pp<0 D ]\Q  GQ*Q?Q [Q#Q q 000 <0 Q00S@0 Q00S&20# Q00S   0A QSq !000 "Q  \Q@ Rp#*\00Pp01K XD0pc@ T1K PHXHQ U:8\000 S@1pK08gP0S i(K]'* --LM00  K p-LM@PP0` HH`sT  ,i, cs} phPs a^|<$MЍ/ p-LM`/@PP  00pT* 0-LMP@100 0@ 99U,0,0 00 -LM K R( Kvt*=**pM L0000 P40 P000Ѝ/]NN0 S0M00Ѝ/| -@LM $$ R*00 C R00T0SQ00T0S @-0P`p @M 00000l0P20C^  00C 0Ѝ0S M1>3 01Ѝ/ p-LM0@S`p  e{PP p` Pp p-LM0@S`Pp 0S0?0 Pp  0 1 p -LM` R*P*0S0]SY\pPh/P0Sp@T U @J 0-LM @R:3 R!*0S*0[S.Q00 PR *0S*0.S0]S00 0 0 -LM@ 0SP*( P &  P ^000 `0 00Vp(@@ zP> 0A0 zP00Q0 1#"0"Q00g 0Q P V001"LBA2A` B,0V 000 0@0@00 @o R*0^S00 R*0]S 00 ]00]00]0 -S00 -00-00-00-S [SR: }0:S =Sy 0S0:K00-S]SC R*q Ɵ000vj P0S p@ T !/ 000000Pp @P@ S @  @  g00S R: R*0S*0:S0]S1 ` 0S0:00-S]S=T 0000 R: R *0S*0=S0]S00/e pR*0-SQ*0]S -P00W@ @ 0000000SQ*0]S  R *-S 0]S   -00-00-00 R*0]S  V0Sb 0 0h@Cp0 t 000 !P 000000@DT Y 00C  0N@@000`00^00  00 00 0C0p 0 0P\ 0 0PWo 0@0S00T0S 0 0 00Q\ \ @T:`0  bB"o(w$8J@J](J p-L KM0P0^0 0K 00KS0`0K 0@0KP`Kp -LM0` @8P pw 0000 fP #0KP 0]0@ "0K0#pK!0Kh@P 0S04  4K] -LM`RP@p P 0!000 -LMP\`@ 0 q$0S0$0L0S0L0 Q   fA! BD 0p -LMP`@p0 ST TW0 W000Stt | | |   Ȟ `  f00   fO  f'" F B a  .@0 f|  f2  f " ) B a   HpG`@  f0W  fi 5@DpG/@D`vi -LM0 \@0 :P*0^S00  (00(0 ,00,0\Qp 0P:]0 0|4W$Wk[W! *W .WJW' 4W $W OWxx4W p$WqL00   j"g& b  70D  D 0DP U 1  R *0S*0\S0)S \) w U 1H  k R *0S*0\S0)S00& "<0`CQH0S  N H u E0 H U + R*0*Q 0 0 hj  h    h0^  hPSv*\Qt0{Sq00 `R*0,S0S0 *000C SVP \P 0T R *0S *0\S0}S00  R*Q*0\S0}S T QP R*P*0 S0 SQ 0 0C0 (00(0 0000000 S(Ko)$W (K91)>{} - LM@0 8 V ?U pf +U*Ua*$UN (U.U]^U8 [Ue \Ue{Ux |UIR:0D  D 0DP U 1  Q R*0)S ) U 1H  @ R*0)S V   2 (00(0 ,00,0F $ (00(0 000008 000P )  $ R:0<Q0 >Q&  R*000C S t R*P*0E0?US{U0S*000C S0Q0  V+U *U?U' {UzB 0  g  g   g0  g    g0  gT 0  g  g  gc " B aZ   `R*0,S00000C S\ VP P 0 R*0}S00  R*0}S  Q* *0B0?RS{R 0S*000C S 0S*P|U 8 U0 S R/*0|S,00 0R    j 0O 4 0   i04 aC0" 40 o4  a  i (Ko0 R (K -0LxMS` 倀2  PPa *+P@P ' 00 0 tP   0K0 @ `   P(0 PHPP0|P40 pPP P(P,P0P3S S SS S SP`B B>3!>3S S "S (00(0@0P@P >3S@P P<@@  >3S BR000S   0>3S SPASQ(00(0l0L0D 0 T0 @0(0 K=0S  n(KEe -LM X0R @T @0R000kig<ehbeE -RL MP` ?R0Spg1 0S 3/=00P @0P @0 000 R r0 11@ppp .NZ@ ,K0 KtV@,` XVPp,0Vp `LpX@ 000C 00 0 |00S,0VKZ@0@`0  f00 `00S 3/$K]h -PLM 0@ 0 @ K0,K0 P0@,0 (@ ,K -LMX0`p@P@T00 0ST @0S u][* --LM0 0 -L0LM@`P8 4*iT  3 .v a^ p-LM@0`@PT00Tp@ 0Sp u]_*3* -L,M@P 0S (Ko8R000 $P0-0-S*000 P ` p  0 @ 0t@ P`p P0 0S 0S Y0Y 00(KPO -LM@ T00 -(LM"x H!X` P R hM HU -LM0Kn30S 282 2R ,0 S 00S20X` 27" 8902 / (08`"#Hh208#X@ @2@@8r X`v@ T  Xg!A 0S11 " P ""<K<K00@ @ S900,1<1(Q41 0@ 1.10! @B0 ^ H <P 30A3200 Q#P D80 x0RP $$0<@ K]]M/uyOMM -L8M \$ p`<@ nP @ PU@V@K 02R R @ RV@K 2 >h 2e-WP  0 $0 S z KMM[įOO* -LM@000@00 0 R10K' -LlM Q 0 000?/0 S @?P046S d  X  0㌀ 刐 P0  H \K4 K00KPT R ):**R K46oB`FX 4 000C Q@0a3 A 0a8CnA,`FAX h>µd.d>`.`>ϵ@PL.L> 0õ@Pិl 0oP l 0PlAl l R0h0 l=K1 VPlࠣA h l h 00l0fS0SaBC` U|0 U| E` E^` ` \ x |0l0ll|0 x \  R @R0@0C0 Ő@\ , , P x $  t p d # d 0  `t  p d 0d0 \ ` t p d l 0`V0Ft` p0 `t` 6PH  t\00S2 l^+; NB1`p;K B@@ IP`tT p  0)"l @bT ; 1 K+DbP@p` @PV ph0S :  ㍊tP00\00S@ P p^  P:lp A< 8 t0l80 <  0 :尴8`^ p@ UA 9 ᑴ 0p`WP8 L p 1JPd8Qd)1A 0 d媴 0qHD Z@ 0b0@ 0@`P#DPD  0< l O 0P 8 D8\S p8偵`p0 0y  H@Ⴐ 0$ 0`P%8P 8 80@ Z 7@ 7K 0҈Plʄ K  0ÉP 0x0S <l P8`pꌀK4 l0?Q0Sl t R00Ӭ61 R 6 0FPlpL < @H P 0믵 0 0ᴳ000 0@PP ,6 t Y' 0ᳳ 0@PfP<l  0P HXl 00 l 00x9S 000@Pd0S|PL0  X\00CN@6@cPL  `|` P| `0RS``0|` S 0c` Pc `cxQd R LË0PL0  T.@P TT@ Tx嵋PT  rpP \\ ᩋpP d@^00S X 46S 40 S `P` \ R0 01_ 0`` 00 0cS0C` S`0` P`UTᣊPT _ `QᛊpPX h R TOPT  'PT I T L  PL @ l0p0Cl0 t t^&ʐQQ" pP. t R T%Pl0<0 L pHl P H100<00l0 T VLKPL  ZLLH@ P L L d@P L0  ! .PTPTL`ω@P 0SPTӈP0@ \ U00S Y9T* V1@ V00S YT0S0SUTPT ᧈP @:T @U9T0{900t'GG[?aCoc?`(?yPD?d?$@@@?@ t0@RC T  VPT x PL\  KPL m P P  BPP d L  ;PL ] @@ nHPTa0@T@T0  \0SP ,t UPPT > P TyPT 5 0P  H X100l00l0 0x9S 000x0S ^L\ P^ ^ ULSTQ 0lS00 H H(K -LMRp3 -LM@ 0 S@B !0 0@0  8 SP< @0 4 / pP`0< R0@ 0@s 80Q PP`0 @p ! 00S0  I40 BR0S @ ᜇP5<p4< 0 0P0 ` 0@0s@8 00Q @S0 p ! 00S0  I40 BR0S <(K 02@M Ѝ⣇ - LM@@ 0SṇP@ 0-LM@PP 0  0S0U 0 -R00L MH /@ D H$P D@Q@  2n0<0 8@ 00 3@0 pw 0-W@p4@  +Wp4 4 H q 3Q00S 0W0XSxSp H  R 0W 00H0 4@HTQQ ȟ@@ 0OH0   0P4`P 0QH 0@Pb`0 000c00 < 8 00G S w^ 000X W070cH0PQRM4@T! 8 V<U < 0R8@T00 P00S m! <0<@8<# 0QO%8@T<\ <0Q8 R00@P00S m!< 8 "0 0 <0<@8<# 0O<0 8@  pD@T RJ@ @D<K(K]D**(MЍ/ p-0LDM0PQ`0 P P\@KDl 0#20000@Q0 00 0 S KpHR R -LMX0@K`P$0 p$ ᶒ$ 0R K,R -MLM@pK, l p`P@ VKA p ;$U eXW 0xQ ׷)K tV U PUo0 ONK@D@DV  U pPʴl@ ᲷlW@lKT ,0 S [(K8R 0-@ MPL 00K0j* -0-L MP0U0 @0 0 0Q a00 |P@T( ,K K$0K$ @, @lP 000(   K0 aL5NMЍX -0L@MH0 0 D0 0X 80 ` @ < 4 HK0pK` 0``vlp@z 0Q XPP}  0``elp@l0XP S !XP X00Pp`N0SI0 S SD 00`@ 0` R000 0 Pp0V. @T 0夀' 0 X2 0S000R`  R ` X< R000\RP P \p`0 Q:00S`@@X0 P\ X崼 \0Xp`PPP T 0S0 S3 S 00 PPᶠ0@0 P0P  ` v0S0@@@@P 0 B 0R #P0 b`00T QZP RL 0LG T0 0 0  \0 0S0  P  PP 00S5 0S0@@U U U ` `Q  ``  `P U00L0p00X 0Wk:\0HS:00\ ` `0@@\(K -L MhpPA 0S> ,K FjP6,0 R% 0SMR GR KR R kR mR gR`PA`VK $` @ `[F`Q@Pڌ# Tp#LX`0XX `+P0P00(@$K\RhR PnRRR -L M`Q0 8@ 4P `< @0 p8KApPP  P!0,S@ӵP  00K hC00S<  @0 Ej0 0W>j00 (KRR -0LM0 Q0  0S0S $S02SP  K0j 00 0 S KRp@-PM@0#!P0 "0'0%"*0V#" 0 !0'0%" *0##?0 0 0Q` :ЍpS -BML,M0ğ@,PK,@ TK @<T0$S0@2SaY bY0*K0HPH#K 0$S00@ S 00B S0$S B 0##0J0S0ʠ*K0?S<0KsK@ 'K` @300S  P 0 1"2*K DQ0D* |PUy 0< 2"10DK0#Tp 0h @R`c 030DKT`  @*K T05K@TpKV`KpPK @TB]K(PEPE@p`K@ l@TTKpP `0# #$# 0PUK 0 !:K0<@K K B K(@@h00BMK(@D@D^KPK`p  @P 0 @PH 0 S K@S -0LM0K0  K0K0  c0`x0p 00PS?@0< PS 0 S KTT@B`PS p-0LDMY`K =0P +PY@VT @P g 00= 0 S KpdS:G-0PP%%8%L01%@4a0@,@$ @$$8$Ġ$ 0 q1ß` 00#0 P%P%%8%Ġ% 0 q1ß` 00#0 @$@$$8$Ġ$ 0 q1xß` 00#0 P%P%%8%Ġ% 0 q18ß` 00#0 @$@$$8$Ġ$ 0 q1Ÿ` 00#0 P%P%%8%Ġ% 0 q1Ÿ` 00#0 @$@$$8$Ġ$ 0 q1xŸ` 00#0 P%P%%8%Ġ% 0 q18Ÿ` 00#0 @$@$$8$Ġ$ 0 q1` 00#0 P%P%%8%Ġ% 0 q1` 00#0 @$@$$8$Ġ$ 0 q1x` 00#0 P%P%%8%Ġ% 0 q18` 00#0 @$@$$8$Ġ$ 0 q1` 00#0 P%P%%8%Ġ% 0 q1` 00#0 @$@$$80$l$Ġa0 qA=00. P%P%@$M@PЍ  $(,048<|4G-0PP%%8%L0%1aA=0@,@$ @$$8$Ġ$ 0 q1ß` 00#0 P%P%%8%Ġ% 0 q1ß` 00#0 @$@$$8$Ġ$ 0 q1xß` 00#0 P%P%%8%Ġ% 0 q18ß` 00#0 @$@$$8$Ġ$ 0 q1Ÿ` 00#0 P%P%%8%Ġ% 0 q1Ÿ` 00#0 @$@$$8$Ġ$ 0 q1xŸ` 00#0 P%P%%8%Ġ% 0 q18Ÿ` 00#0 @$@$$8$Ġ$ 0 q1` 00#0 P%P%%8%Ġ% 0 q1` 00#0 @$@$$8$Ġ$ 0 q1x` 00#0 P%P%%8%Ġ% 0 q18` 00#0 @$@$$8$Ġ$ 0 q1` 00#0 P%P%%8%Ġ% 0 q1` 00#0 @$@$$80$l0$Ġa t0 q:0. P%P%@$M@PЍD<840,($   -LM udTH0@-@MP!\#0  0(^D"ȠЍ0 -(LMZ0p"2K@`.K 0 8#h "V 0AM80 2K40 @4`K8K W8 40 0PU   K4 0 8#H80 T0P`V  `U @(K -LM(j<0 0" x2K@P. K<0 8#X "U 0A]80 2K40 .pKP  4@w 0  40 8@p8 K0 4K80 8 40 0`V . K 4@] 0 . K 40 8@V8 K0 4K80 4 0 8#h80 V0PpW pU`(K -(LMp"h@P08#XU @ -(LMp"h@P08#XU @ -L Mp#0@P`8 Ƞ<̌@04Č00 4 004 ###Ġ""H"T0@P p0h S 0K4 K:(K -L Mp#0@P`8 Ƞ<̌@04Č00 4 004 ###Ġ""H"T0@P p0h S 0K4 K:(K -L Mp`4K/0 0#0P0 8 Ƞ<̌ 04Č 0K 00 4 4 0P-[B["%4""Ġ@0P `0gS:(K - LM@BPC0K4K8 -8<0 400 0 8< 04 40 -0[02[ 000#4 000 010[ 03[ 040#404000 0#0Q@DPEUp  `<8 400 0 8< 04  40 -0[02[ 000#4 000 010[ 03[ 040#4040080 0#0Q(K p-LM`H  Pa$H phdTHW*@-@M0 0#@\LTЍ 0-LMP@ $K6 E0R$@ 0 0 1c004003200 $K0 KP0K0Tg - PLMc0 0Q 0S0K010  -  K8L*9H*H0M0S 00CS0Ѝ;;Ѝ00Ѝ/] 0-d0LM 0@S 3/00CS00PӤ0;P00S 3/0]0M0CS 0Ѝ ;00Ѝ/MЍ -LM@>T`p@P  @00#:k0cS:UV@ 0c`p -LpMoP0p U<0  yP¶P@  P>0@H0 D@ 8p 8 0 S S*S? +S -S S x 0x0 080 0S,080 @x@ 8 00S| 00XS xS!x@<0K8K@ K@=v0S@ Ss SV x < R =PKKx<W{0HKPK@ QC8 080 00S S; | 8 T  t Qt@Ւ4$t@ 00@Q:*080 8/P00@9P0P M0SI RQ 080   @@ 68 @080 0P 10@S 28 T @0P@ 0 PPt0t R  \BSt  0ӓ"t R 0ӓ*@8 080 00@ S00 ᄐ @EPeP:|0 y 8p 8 0+S -S```080 00@ S8 080 0P 10@S8P0@ <,808 /P00@9Pڨ*0e\S 00V0c08p 0XC| R9NP IP4iP nP/8@K$_wP( 800C 80 WwP80080 H:D0 08@KKwP 800(S P KxPL046D0 P0H0 L0H0 D0 H0x0 8p DX``Q0it X0 VH D 891H C Ԥ@ P 0ᗣH D X,Z|P)X@T T8HK؄1 PhX0\ʤHHK1 认X 0eA 詤H D X0s`(X@0##HK 芣X0f @TW  8HK1 荤H D 0 MSl p h d (8D0 0H0 lQ <ypyhylydy꘧CbpH@K0p` d@PV!H@ DP D056CD0 87HK1 RH D D\'7 R6CR7 D0 560@ H0 @ D0 RO@d  6HK1 "H D DbB V60␦j0p0 H@K0` @PV pʈH@ DP \ Dh60#:kcQQ04QH0 A0276D0 H0 1H0 HK 0P l p h d 0@H0 D@ m `5T t0vPl Y d h l0hyPp S l@  ! HK0 K40KyP< D zPh ? X00\X `4 ࠣSc00CD0aS6b ` $ cRb0 B"00`0 ` @0` @T00 S 0S p pc@c`c^ hzPh  <#zPP <xS\ < 00pXs80W:\ <0000D b(KM. ".Q  .RA Aa0A \.\A Aa0ARS 00A S  RS 00A-Q S _Q  QЍ/0M*S0.S S ЍЍ/-0MS]S.R00 S Q\R !R!0B.RЍЍM]R0S! CЍ/0MЍ/0 <8MЍ/ <M 0Ѝ/ <0 Ġ 8M0Ѝ/ -- LM 0  -PLM\ p` PP@wNU  0借0$zNᔶ  hN[ a^|< M0ЍQG-HM@pP0 #2b P"3 UpG1?7 (1 L0LLLWW& 0 00000 R0 S` h.22 1 W00&#!0=00=00P U03107:Ѝd -`LM@pPUq ("000L=QN 崥P| UCD!p!!"T P< Vp*1 P0c104T Vf*!0 bB2 Q05:PX` PT VQ*P!0 bB1 Q05:PC`P T V<*0 0c  `PQ/ U-##"x"0000r 0  PR=R  r 0  PRTV*0SU `]d p-LM`YPPp@Y0S@ ?PT  0Rppd*0-#$##Ƞ0 "4 00M#$0 00 0 0 0 0 RЍ0-#,#Ƞ#0 "40 M"40 00 0 0 0 0 RЍ 0< 840- 040 0M4000 0 0 0 R 0Ѝ 0< 840- 040 0M4000 0 0 0 R 0Ѝ 0-LM@P PU0. @ e@P0/S P /U l0@P  Q0r/S0Pa U:X@?00@ 000`,*(MЍ/)#*l*0 M!Ѝ/ -LM@R$  ,  `X0A XK00C 1 儠K─K0 p!0!S @X㿣pP P " X ! 00P P L00L0 60[S0 60KQ Q , rL0 0, L0 kx00x0 00 0 d3 K0 卶 K㉶ Kㅶ,K ぶ K} Ky Ku Kq KmT嚶 fA p ! # T *!R00K [r l000 1S RH00 ӑ KW [R(00 ӑ K0[0K SP  0[ S S00XL0  # , łP  vpW0SX!X0S K  K K K K K K K K 1S Ợ1S C1T4P@!TU!R W10 qQ P@p ,0 S (J(K']NNPS8eM 0Ѝ`zζ* MЍ]t,@ 0-0L0M0P0 @ DK<00<0 D KQ Q QX P8DMW00 0 S K0t,t,t,HeP0M00ӑЍ/NP0M00ӑЍ/Nx* -LM KP Kwt@6g* -Q0LM0P  ځp3Xi -0CLsM@00 `V_ |1R 0R 10CRG@P! T*0S TG  00P@0PS> 0VS+검VX7 0 pSY@0U 0@ S 1Pp0 SU0Sp#@UpPh0U W 0VS ` TPF:0Vs3(K?*!:N-]M0P P0Ѝ/M00P  R*Ѝ/ p-LM @R 0`Qv`FvPp000SPp 0fP0U`00p -LMPq0  |   x00  x#`pHA0S P : 0  0S 0S 0.@V`@'@$ @ RP  pR 0S '0SpZ 0p =  RP  `R 0S &0S`ZZ`0 0 0l 0  R:U0 0F@0l@AP<  0 0l ¯ 001  0 0S00 c0@00`P 0 &P ᵦ0 0a0 @0A 0  01SU @V  (K -MLMğ  ` ,  P8 @T g@ 0  (0 S00:dUp/0@@0BNK@D@D+P 0K@A (P 0* 0U/S' 8: S S!BNK@D@D+P 0K@A ,KwP 8: S0 S/ 000>K(0Cp   R0B0S/S@@Q P PU0E0/S |(U@T@K0@S@H+H+YP  0K@@@ $PP0Sk B^KPEPE+@P`@T04/PX 0UV 0p@ ! ( = 0  d0S00Tp0/ 00 00.S0.S%@ 8T*0 S0 T:p @0zP  D8` pP (2/P 0@  Oppp ,0 S  (KHz?hi -LM:K(M850,0 K0~P04 <$] 0 Z K@@8$BK^L`P L@0A@ Q p 0S /S000SP4P!RBKLK (ALA B;媁 BKLKK @(AL@A B;s0P 0FV 0`SQ*0S0.K B0 B0K8$nK0`FK`FP44@d?WPu [W *W0u@!TP0S  ]0P!TpPEr!T#@ @ P[Z:0:S7`:P1 0]S.0fhs 0RR Q*0S p`V ß0l10 0᳠[Z@P0 0 ]Z 0 00-S 0]S Ÿ 00P@0]S 0l< 0` 0T"< 0 K 0@< V 0 V$2R 20pWp 2p(K0S KBKLNL N KKP(@AK@ A< 0 PTK4 0P < SH*K8<$0B P?K4Ipl - @`P2 AP 000000P  0 00 00@QP K40 d0 ,0 S @僰(KX[!N:-]?**C,Cpi -MLM0@{Sp0}S0Sy {Pq KL0dL0  R @0P`0[S   0]SSSP {S` }SVギKJJB `FP0SK@@>0[S ,S2{S }S-   0]SSS@ `V`FV 0CQ 0:0S0 P  00 @T (K -LPMh0K`p@00< 0ph P@ Q< R9q7 r5 10aR1  K0\`2KS   0R\S0@0Q09 B0LP*0 S L000 KK  KxiMЍ<MЍ7p 0 M00Ѝ/]p 0 M00Ѝ/] P PMЍ/p 0 M00 Ѝ/]p 0 M00Ѝ/]p 0 M00Ѝ/]p 0 M00Ѝ/]p 0 M00Ѝ/]p 0 M00Ѝ/]p 0 M00Ѝ/]p 0 M00Ѝ/]p 0 M00DЍ/]MPЍ/MЍ/M @Ѝ/M Ѝ/$0PM0Ѝ1,Ѝ/\ -LM@QM ЍЍ/ -LM@P  MЍMЍMЍMЍMЍMЍMЍMЍMЍMЍMЍMЍ -T0LM`pNP @-P@> 0P U\PMЍ0Ѝ/ -QLM@ hP00 -l0LMPpT<SbN@`P @>0 2 `V\ 0-00LM@P`<SB0h\ 0-40LM@PT<S10h\-pM p00,,0 ^0 S: R 0n 0\ B 0R2Ѝ\ 0-LM@P4ᙛP(000 咛P000j\j$\QM R P000SЍ/MЍ/ 0-PLMP@   01S S  R 0^0OT0 0 ^  RR11:000-PM Ѝ0S1 P P10:00Ѝ -PLM QOT0 0 M QA 0SbЍ/PM 0s3Ѝ/ -LM0S O 0P ) 6;AS00?QyO T00Q Q@T0Q@@ 0lA?0 B<R<00  -LM@\pJO0+QpT RN \P %WPA0  P 0S 0S0 [ 0S0 X OT00(0 P|3R`1`!0S?0\:\0l) P6;@ S:P0WP0  -LMPP`&RZ 0S00S)0 R  d 0wpD pB P@ @@pT:6SR 0S00Sp@"NT00#  00S d 0Dp00 p00 P @pT X1:00 -LM`P4 80  vNP00LXP=@Pp0K0QQ=  pP6 P@4 T/00SS0&Y p@  0K@t0K 0P0 T 2P804 q ZU1e@:0 10(K0 0h<40B.΀T<(0  MX,\`*:*$MЍ/ --LM0 0  K p-`0LM@`PL HpAT  ,y, sA፩ ph`A a^|< p-1LM0PS 080@0S @T00S 0<Q0 p0 0S ``0<H `K CpP}M0S ᇞu Kp]T\]h -L M@ 0< rSwS 0 S8 eS0S ZM00 㛡, ,P 4KPd20S XX28CpP P E(20S 2<4200,;x1Q@0S0 D @T@ P0rS$0KAP gp Lp    Lp<088!8q0S 1<@ $0K@wT@@aT@@$ K0ٗ,0,0P0S 08|, 000, S  PP0<8 0eS Kp   K $K]T\]h\f^Z* -0LM Ba -BML M20PP ,0 T$ 0S /PP0 L4 04 J`s\2@P@ت00 c]0  tL 0| ժBKJJLT `0SPa P Ὢ0 Sp1KH4 0D4 1A84  0@d 0@S/ L$ P$1!S 0 c@] P40T$fBBNK@D@D`PL$R K 0K0SK00 ,0 S ,天(K0Hzk$k\^j 0M Ѝ@a --0LM00  00  0  0S10 c]K 00 00 0  0S0 0 S ^ Kk --0LM00  00  0  0S10 c]K 0000 0  0S0 00 A 0 S " Kk --0LM00  00  0  0S10 c]KK 0000 0  0S040 A 0 S  Kak! !v - PLM@KP0$KpGpP3 (J`P. R $00R KP00#TPP 8#$0 <0$0 J J40@$0,0P,0$0(0 0 0PK̹p  0-LM4@ 0PS 3/0@S 3/@0] -LMPQ`PPhp 0S 3/0 R r A0t03U0SQ0@S 3/@]e*RM 0S0 0A R RЍ/ة*; -LM`P @0S 3pP PUP EP -LM 0PlXg 0-LMPP E00@[@@W @@0MЍXg -L M0`SPPOFP 0K4KE@P 4 R 0#S S 00S# S0B40 4 (FP0d40 4⨞PPk 4 40_IP@@0 S SPP hPIpPP  ZI00S ?R0Sp 0S㼝P PW@Pp)+ S S@" 0@1U SFPI@hI @00000c0P@L IP p@T 0S0 0 (K8kn\ -LMV0PXgx 0-LM0@SP$$E#F 00 008knMЍXg -LaM ``0 pƥP@¥P@T iԥA \00 c 1   ^@P(K -L MPCPß`8 < 4 =@ D0 圔Ppfᅧp0@P0H0 0 * ᶔP"tP " 0Q0W0Sz  H R @0 0R 0R 0S 0 P@T00P00S 20Sp <0:Sl  ,gzQ @ X B R00S 10S <0:S  0!S 00<00.0BS QX1 R408!41 10S610S200S <0:S 0 S 0000  B < 0:S:? 0S 4t0 L h00S <0:S \H0? D R0 S(K\\l\X\kk`\lgkk -LMR0 4 80 o E0S5  0 s 50S 5P -R l50S+RT-R+R0S@5@%004% u0< 0S%00S`04V4$P4u0D @40 0@d0d0@t@0$`0[40tA@-QPU+YP'<<44$Q0 4 `@  Pu` @t  40X0 e0b#0000003pw #0s`U t-U0ST8S@P3 t0  40.0 g0b00`0#8Q# 204 1R -Q 00:Q P48 05p`OdrP@`:V@ -V0SҒP-V0Sy 0S!00010S 0:S 1`?`f8 0R0WV0S" 0;S0Sl!000S4010h1 \1R0248 0`(! 1 <0:S 0S5 0000000S@ 0:S 000S04 100 0S0  0:S @p0`0:S:`?`(D 80  `(K\\p\pg0lgh\d\l\ X\Hk`\`k -L Mk K -L M` K -L M 0U K --LM00  K 0-D0LM@P 00?:T  H  0h a^-p0M0S 0 CR 0R0 SЍUЍ:00Ѝ] 0-LM0@P 0S0;P ]F 0 00 R r 1S010 CR 0R0 S 0  00h0 p-LMD` 0PS@ 3/0PS 3/p] 0-LM0 @RP r 1S010   0S:P FP 000 bPQP0 0CP0P0S  0 U00S QP P0 -LM@P A00 p-LpM`@T lB lKgPP D @0  0: S EO0 0 A P KpPn -AMLMx3B~KpG0dc,0 pGIJT3T N@P @DPPC0 P 0#S    P@ P  @2PŸ P 1 v0DTd P 1 g04S|4 P 0#S    P @ @@P 1 80DT P 1 )04St + o 8 Q@0[P' rP0  jP0  bP0  XPl0 PPP< h ^@T4 ,0 S D}(K\Hmll<lx(tl 0-LM@P  P0PP0 0-LM@P  P0PP0 -40LM0SP P @-PMP 0 S \S@0 0SS0D0@SЍ MЍ**7* 0-@0LMT0S 3/P:PPDD@E0] -RLM$ D0 0 -LM@@T p-LM PR @T@  <0S$0``P vP PC@ގC@p -LM$0`pPPᩗP@ 0(P004$0@L0000H0 L⸝ 0-LM @<Q*幔00C?0 0 5PPP 婔 P0 -LpM$s`Pc`LP0pKHp @  0P }C 0PPtC 0PC  0P gC00l ^ 010  P%L 4,00.R80M0S L040. S  ,0S00S40\0   <0S0 P 0  P000 K -LpM$@pP)R`6`PP!K3ePP4 0R, 0R0 0R CP00PBW@B@K -LM0PR`p ( m?@P@@@0P0 0p 0^10 -L4M\ `5P \ Rs04B00 0w\ R0@0  $ 0S 0@ <0  8 00 c@  < @0\ @S@R  0X H0 L0  0 WP0L H0  X  yB00404sBL [H $000S/S$0L 0/  4 <0sD0 D 0 D ZP 0  pi0 T P 8 $0  0.S0S 040. S  _PP Q%: pxP ,B@80 04$0 :0 $0B@ W $0 04  80 8 0piD0<00000 S$0*0  $$0 :0 $0A?00L0S @ R 04 0L 40 04@ R <0S P P $0 0L00$!$0L  0( 0 4l 0 0&@0Sڰ$0B8RS@  B@ 00  ST00P PP TP  P @PVfQ00c00 RL00  Q00c000S0 <0LS$0 0P RY400C40 4 00H0S# \ P0SR<0S $0P 02PP  $$0 :0 $0P0SX R00 04 0P SR0(KoJ000  %8 R 0(Kx -pQ00 W@@LMTP A0 0;`A@$0 4D T 1 T.P  W$0p:$0<0pS00/S $0` 9 X@P.P   Hz 0-LM@P1UP10@S0 -LM`pV $0*0Q40#Q4 0C8S 0P$0P4֡ 04ơ@0 $04SGQ $@ 4 0R 4 刋P o0004P   :$0b000S  0AP i@4 04  000 R P$0  `00Q0`V] V<0S($0@WP$0`( L$  k/&AP P0S @პP k(P04 00 :4S S 0zP$0 $P4֡ 04ơ@0 $0040$  0R/S@/00(  Lj P<0s?``60$ `<0S$0$4 $0  P ?@ Ŋ?@   L0P $0P:$00`S004P`Hzx -0L M`p ? 4 @T?4@ 00v(hPP4P p 4P 40$`4 0$0 P @PXt PP 0`<0!ĝ @P0L <  < $  P04X``V0 `@0` 0@  ATXY J` ^P `0 $$0dGP$00$0Y  1  ,*(040 4(K Hz p-LM|P0@S $h080` 00S $80<0S $0@ph]]MЍ/ 5**1* -LpMKp``P'0: S >P00(P P>80@100P ʏP 0@p$`0 @``0@PK 0-LM@=pP  00R00S >P 00PP 0J  =0 0-LM㖉p@P PPr0-SM " 0\0  0\0 Ѝ -LM`Pp@3/P 6/P6/P@@ 6/P6/P@@ -L` M <0 0f8 D H0 D R0V000  0 80S'# f f40 @ 00S 00   00@ @p@0TP< 2/P40Z* @ p8 0R㖃' (R0B▃*8 1P <0 <0d d p<0 ez <0tp00S 00   00P8 @0B▃*p P 00S 00   00<p@T.< 2/Pf 00S 00    00# fH  0TP<03/P6 00  00 Pf0hpgS08S㖉)  c00 0j PefQ!Q  00 aWę <0!U ẙ e8 %0 R (K -0LM`P0p R p  AP   @!R  000lR"=0 0  0  00@ 0-LMPP0@S $<08K0S $0<K0]]cC*??* 0-LMP$K4CPU$0K$KK0 -@RL0(M0Q 0\ 0  h        $0T0p0S00Kl(l -Q0L M4 0R004 000 040`0S+ Pp @P 㕒"0S P pt0 2"0S Z0 00 X0 00PU0K3`P(K\lm -LMP 4@P` |` ᨀ,pP 0Rp„S0C \0 ^00`l@-@MP 0SS 00B SЍ7i*e* -LMP0A Q@!` p0 0 B0&&sP00R00S 0/S9SV00 V0S` 0-LMPPRdEAN`00 -LM`Ap  !PPP0U`VP -SLM`8  -= = = Kq 0000 00 r ̟00088 8 %Q 8 P  ]P8080 %0AUS Н؞|(4L|ĢآD؞|``|Ԡ,hdT0 00 Q00 > UPU 0ʟ (U00#U00U0|0U0h0U0T0 0, 0~ 0 -P0 Us4P )1@+0p P A  P0 40 4PUUR P 00 0'UJ4P <ɟ0h@0p P 8@ P0 40 4P U U) P 00 000  0K4Kc0kP 4 d0d8 0K  0\P  00U 0K0U0K 0U0K 7?P 00C0000r 0K;00K 0)P 00C000UXp@ኘ0 U P0 SP@z F P0 S S 0000 0 0K=0E 0K4K' 0K0P 0K4K 0P 4M000K4K "0 000 000C S0K4K 50 s0K4K5Pm 40%v>C 0C000z a0Kc0PZ#tU0@ QP0$(P00 h EPT0$00 (C 0C0!000x1@S 0v~ p dP p3 0S\10 2) 00C0040 0!4 004 0R0 0% PG@{G@ݔ@@eؔP0000 c 0 S 1X0 00(Kl]|\4n@nLnTn`nn't\x\\_d_mmmM0Ѝ --LM0 0  K -WMLMp0@P  C/$0 KN?K`5 8 4 $0  PKⳀ0YnKⳀSKp0NFK|E E t d5 1t@PIDP@$ 0R 廕 KHTpMЍ%P 0MЍ/\MЍ/ -LM$0! 0-LM$@PP $P 0h݈ p-LM$`4PK@.0<<P <P 00000S 4K3/Kp -L@M$@ 0PR0 0`00dpKH` 8` 0LK< P 4K=40L0 d` `0 P d@K0LKd0 `00S 3/$K -LwM 2 0(, 2 夋P`J 㟋PP`b`A,1,! 0$P@ 0@rK=~K 0 oK . ء ԑ 4<KP 100@lP oK L 10S ~K3/!` ,0 S 忔(K\h`p -0LbM0K 0 cp" @!@KWpR^K`SP00 PNK0 0 ^0 K@f 0 S 傔K\pp -LM`Z$P@K 0;P 00 @y;pP@ r;p$K+O* -LM   K 0K 6p K 0-L MP@=P  ?P j=P  e=P , 0PK08 -LMp`@P:/P U@P -LMP`@R=P6 pW啒W0S+T0S S %W# P`P@  P`03/`0VU @#3P:0S `` M Ѝ/MЍ/M ЍM5MPph`XPH@80( |xtplhd`\ X TPLHD@Ѝ/pppppq,qXqxqqqqqxr0r -LpMK@hbP`  : SH  l0S4   Krr s$s -LMP : P -LM@P trphm -L$M@ Q< D0 R 嫓 娓0 @奓0 @0pB@@0iPI40 L >0\S+ $S7 ^S! ~S2Z0 D @0RT 0T:S(0`/SSP"  ṀP 0/SSL @ PZP0SPE0S  E@P@ 0/S7SP@4 T:@PH 8 @@pP\U8 $U%^U, ~UZ D0@S T 0T:Sy0`/SS  nPn 0/SSj @  /0 bpcZ_  %i pZ0 SPRR0 SN RSG CS( 0SD:7SP#BS=-FS4 NS/ ES6eS bS! cS TSnS! fS' rS! tS"@P @:P0QQ00C Q 0/S7S@P @ P @ P@ P@ PP@PH@40Tj:HP00@P8 8 <@^(K -L,MD @0 D0`@@  0000PpDp @ PV DX@YDP @`  0"0S@00T TpN ~'0 @Tp  pG DKP o'0 @Pp T0I0 S3 D @ @e0DK as#. 0| t0p h0d @P00p40 40S`@P(K@s`sssQ: 3 -LMpQ@ |1PpC T  0`P 0 80`P,Q. ,T@0TPP 6  0S,S00SQ000S0S 1`Wp@TP _|P*P0 sss\Hdst -QL M1`(0 $@ #P (P PPpp![0pR0Vp00 0S 0p0 P= hp KP8PPLp: R \R R 0 S S S0 S S  00 R  0T@pt95tP ,0 S `O(Khrtu(u0uTupu4uuuuuuv vc0@vPr 0-LM@PP@ <0 @00M Ѝ/\@-@M0S :S 0^S^@S :RS:SS0@S0Ѝ0MS  0\ :S|S S S 0R:SS  |SЍ/ 0-LMP# P0 00S 0XSxS@a A00A  RA0A\ W0AR70AS4$@0 -LM= `P d)P% @d p P0 PddhP  @0:SS`PPd TP@~E@ -LMp= IPP dP `d@ k^S0S:Sh 00PU\S0P R:R\ 00B0S 0R00CP  0/S7S7TRP# ER( BR CR)$NR RR FR"fR cR eR bRrR tR nR 00 0 00:000UP@T@fd΁P `d@0:SS00T@f ὁP`2~D` -LM4@P X(00000 p-LM@PdPd` ~@@pT00;Pp 0@ @p -ML M4ǟpd8  0 ^, \ ` h( l8 põ\VP hPF 0P  `Ṇ0 0Tx X P(  P >KKN0CBK 0CL|8 LN B;` Tx ( X8 d\  *P U%PD%0S@ d  0![P7 h< Њ8 ( 0 p P D8 R@ <8 @80C88 Rppd}ᯊPᖀ`P1  JP/`(\8`%TW(Pd p P |xHx PPH(W:|+d8APpğ0Sd02@ d @P(R dZ'T*"}|8H p0 SU 0U@E\S 0X@ U:;PfᏀP}P^ d4'0fP@`XX d @T0#SS hPl(R PP0:S@lDwP@T80T8 T0S*.K B0 B0CL p( t8 x = KpPo @0S :S@DxptT(d8PPP uP(R d&|puU u0:DL8 DLX 4 0S :S08 i b0( 4 00SPG:S:08008 0(0ecX(0hZX;0f pPk|P^ d& (f0f fpPXx `0H a@%V40(!V P| DP(R d|&X8f`S0A0 P`:|*+p 00 L\(p^p`-|Ypp ,0 S ,ʈ(Kv\n]vv -MLM4300ß,0 ,3,C0 <8 3R048 0@ S0'P 2X "0S00f  "P BnK`F`F┢{8h PP8Q(: +0P`8 X"0S00#3@ @P@Te%2 @00P@Z &PS8(0 S8( U0U E\S 0U:;@h$P= 0hpP000S#S 8(@1f/0H'$1 h 1(e$NK@D@D Pk蠟(K0pxC0`KA PA@0ps@T 0'@M*t 40PS P0<( P{T=*$ P,0 S ,(Kn]vv 0-LM@P0h -LM 0  K, K 0-LM4@ 0PS 3/0@S 3/0] 0-LM4@ 0PS 3/0@S 3/$0] -RQ3LMP@ :Q AP*)W000@00V S P1 0S 3/0 R r 1S010pS000 P&PU  $Pp00S 3/ eꟃ000'Pp`e |00S 3/ f  `(V  ႃ 0f0 0 0S 3/] p-LM(0`Sk)@0P0.0 0S 3/c50 P@0  0(p@Pq 0 00 0@T_S <0@T_ R 00c@_00S 3/p] -LMQp")W0 0  -LHMX@K 0K Y PK -LMP0P :4 80 @jtP> `P0K0  00pZS00@ % *,QtPP 000S8   41S  RRR4080@T 0S(K -MLM8 0( t8 t3\0(P,0 x | 0X 4X @P|8@0H S낎KH H/48S  4 (|(`V 0X  1 S0q03R0SQ p@ xsP@t(U@࣢0a08 PyTP4\X00 S KB.KA BxA B;8 V`PLB0SPxK@@0 h(po h<M$PPA @nK`FH`Fp* sP p s0PZ00CS00Ӥ0d PN pL p @sPDt (0@P P8#t T@<$PPKt0C(0C8hp@ @<x8x@ R08(0@ ,0 S $o(Kvwwn(wv -LM0 @R r 1S01%P0 0C0 !* -p- 1L]M0PC/0 `>KJK\1 0Q ,Q @z 0K 0 K{P |  0 cKx1 1 4 cp@ 1P|{P|hx00|1 U' 00@ 0 S KpB8w -LM@QP;'00L41 0S 3/0 R r 1S01D p00SU%P W)00S, 3/(0`X@1@!  #0P d  @f 0d  00 0 d0pX0000S 3/ ] M-L(M\PK0p@&0L0 &0 X0 WP`'0K <00PT` 0SPQ&0"S XWuv&0"S V U@@@@ R( K1(0 0&( K1T$0P`0(KDw -R00L MH /@ D H$P D@Q@  s&0<0 8@ 00$3@0 pw 0-W@p4@  +Wp4 4 H q 3Q00S 0W0XSxSp H  R 0W 00H0 4@HTQQ ȟ@@ 00   0.aP4`P 0QH 0@Pb`0 000c00 < 8 00G S w_ 000Y W070cH0PRRN4@T" 8 V<U < 0R8@T00 P00S %A 0!<08@<4# 0QO%8@T<\ <0Q8 R00@P00S %A 0<0 8@ "@@ <08@<4# 0O<0 8@  pD@T RJ@ @D<K(K] p-QLM@P`p`S@rP$K 0`V $0K0s@$0 @ $KKp p-`LM@@`0PS P@0Sp pxg -LM   K0K %p K -LTMP`h  0S 0v03@P0S0S ᗃ0x03@P0Sy Xw P0 d0 0K B0C$ $ 4 BN8 B4t x |$ $0CNA B4  $ h@T8pp#3p~ P:X t np@" NpP"0#S 0`4 t4 l4 ht d y`4h$0P mhPmYmgh00S|P<@K рŸp x4K\@0C\\4H i$P`|h@\ I!pX` 00`Z `  ,0 S P(Kv\tgwww(j\wwwMЍoP0MЍ/wXx -0L M @ R R R0ᓗ0 P}xh h0j} R@0@0@ 4_}( 0000K(jtxwXxxxA -LMhf^ 0-LM0@$K$ R10t!3}p PLH1$ PL`R500L M} 0 }p P# @`R01S 0 | |  0|pP,T,PD@ |K0wXxxx8xL5yx$yPS8y -LMh^P0 !MЍwXx<^0(0MЍ/ -LM0P003/MЍ/0@-QM@ Q QP0P0P0PЍ0 0-LM@P0S p kT00S P3/q0hq -LLM` l puPDB 00 00h uPPB 00 00x0S l 0!@Pqqk04,"400S0 n'&P P0 PA 00 00pD "00@0@@8K&yP`` lh 04 X \ d@ m%hK$P0S! ckT0T0L0S 3/ld0 T0(2$P 0@ 00D 00OqMq (K(j X \ -LXMP` t  x0 Q40d pP`l0 p   R0d R0h0 4 P0K| 0 P ( l 00C,̠Čl 0("Č#K0C< >K,BK0C0CI B< I0F, < /bP PP"@iT  [q( K0Z (Cpd   .B,0 /S `2Xm/00  ,8[Sr ,bPm  b@P Xf<@/$0f@]+au!PIKAC@P 0STZR<0U<: SA, R >01P!-vPP>( K0LC,<[/S@ X<@/0@fZ ( K?1 0 @?Rp0@`P@Pl@  g@@P?0S@@:  eof -0L M0P@ 0 (`K  !?@T| ~opd 0 P Qn/B(K 0 S rjK}|} 0-LMP@!1 1 !320QH0hf0@-RM@P \4, 0L 0l51@PЍ0 --LM0 0 -LM@Ppw T0` LLT  0Q0$2h  d a^|< --LM0 0 Q K 0-LM @j0 0K,0 R0(0 $  2/0 R r 1S01,K 0P0S 3/K0] -L M0S@ 0 0SP  0 0 0p Wp  W 1+#,Pp`00`S0 040 00 dWp 0B<B S0S*0P`` 0PU:j`P 0 0b00P0P  UP! e0 0e P0 #0PW  e000P o W:,PP e e0 0g 0 P00eS0[ pe0p40 W 40S   P00h000 040  0`0V`!PP00V0S  ee000dP $V ,PP  Pe0 0f 0 P000S00 GP4 00eS0 pe0 @00 (K 0-0LM0@S0P-  00P @0P %\00P0 $000 0000S0B< S  0  0 0c0 000000h0MS  0S0 0S Ѝ/ PM Q 10C0 Ѝ/ -LMQp' %R`@@PU@ UP@  P 0Pg0 B T:00 -LMQPp R`@@ P 0S0B e0@T:00 0-LMP @id0 0-PLM @]d0 -LR0L0M@@P T@ lR0  0 R B0 0 ;h -0LMS00 P@0Y.0D0TST' T%0 `~fPpp``UVZ W@@ W G00 h@0 0  00`(KHi* p-01L8MPPKA 7 K$ KH 0 hBp@ P $K h- $Kh0 PK)g4 Kg@ Kg(`K #pP 0S $K g4K g@K gu(Kp }a^;h* Bh*M0Ѝ -LMl0`p@P@T00 0S  0 TP @0S ] h* -LM@0Sp 5P-0Q 0 *P!_Z000]P0 0P 4`4P4协 R @00>yh*{uh*P4M<P81#8181:P02410!0 < 8#" Ѝ/0@-RM@P \4, 0L 0lRQ@PЍ0RDh* -L M@P4K0`p| $@ PPpdP00P0#S 00 4g $0 S }f K|} -L`M\,  0  \ |K f! BB/A?/A0(K B 0bT 1#QT ` |K1Sr @@r v T` Qr v T`v Z`ZK p. ;v W 0WW10SG*:*W @T>*: W VZ Zh0P S   dMP@ f@|KPd!1cPPpW00P0#Sv 0S ,0KR*:00ZK .0R:0a @S@ 00 hf/00 ,0 S e(K(} -hp(㗘#MLMh7 L1`0Pd ,0 .2$0SKNuK NAAP  Br>`73PQ0  Sc00 !f0Sd7S 0SPUtP0"$#PUhG ,0 S Je(K4yt4} -hp(㗘#MLMh4 L1`0Pd ,0 .2$0SBKNEK NAA0  B;` 50Q0  b00 e0Sd4S 0SPUtP0"$#PUhD ,0 S d(K4yt D} -H0LM@T-X0@S@&X0  -L MXAPXLLPpPJ   4P P/ ` 0P 4@0/S4@PP U hP ` 0K4K@px@4W 01`4WDPA0`FW@DV0W`(KT}n`}] -LM0 -LM(@0S0P000M Ѝ -L M \4 P  000SL`K0`PK`T0KXL PU`QZ0=@P`  P2K P0= @@ @Q R@P00Y0X00Sz0<K@ K@  d 0P0SPPf 08 40J`0h 0RYx@K h0`K-P* 440S@0 @ 0P0400800S 0@0 1\ 0 0 P  B xP@x@ xP 4@4I0#S  ,0 S Y(Kh?B~ -40LMQ < 0( $MЍ/MЍ/MЍ/MЍ/ p-LM@PU@OP" P<\04`Kx0 @ 0 0(00<000S 3/Kp$h]0MS S. R > R, $0 0 0 0 00 000 R0 R000000 00000S00 S S000 00 00Ѝ/ 0-0LM0000PS@P P P  P 0h0 0-LMP@P 0S S P 0h0h0 0-LMP@P P 0S 0K0]M Ѝ 0-LMP@P0  >0h 0-LMP@P  P 0S S00P 0h0-$$ M @ Ѝ]]MЍ/-0MSࠓ 0C0,<4("4!<0 00 0Ѝ0SM0C0 ,<4("4!<0 00 0Ѝ/0 McЍ/0 Q0aM0 Ѝ/ MR %3 a 0 0% % Ѝ/MЍ/ 0-LM0@SP3090b0 T 00 00 0-LM0@SP3090b0 vT 00 00 -LM0@S0C0 ,<4("4!< K0 ZT 00 0K 0-LM0@SP0C0  KDT,<4("4!<0 00 0K0 -1LFM0PQ,0 p@ K_K<N/K81 hpR 8!+A[XT081 4A `T041 081 `) .005@81V0OK@  >KP%  M?K@:P8!(VY@   >K&K?KU N/KP@ ,0 S W(K~MЍhY* Y*vY*iY*CX* -LMh0`p@P@T00 0S  Tp @0S ]X* -L M0`p@P@T00 0S 0 Tp @0S $K]X* -L M0`p@P@T00 0S 0 TP @0S U$K]X*a{X* 0-LM@PtP oP jP  0hd0 -0LM (0 (K2/ KMЍ/ 0-LM@PT :T 0 K0  0KP00K0 0-LM@PT :T 0 K0  0KP00K0 -LM R :R00 -LM R :R00 0-LM@PT :T 0 K0  0KP00K0 0-LM@PT :T 0 K0  0KP00K0 0-LM@PT :T 0 K0  0KP1[0K0 0-LM@PT :T 0 K0  0KP1[0K0 0-LM@PT :T 0 K0  0KP1[0K0 0-LM@PT :T 0 K0  0KP1[0K0 -LM0@K0 P00K -LM0@K0 P00K 0-LM@PT :T 0 0S00 K 0KP 00S00K0MЍ 0-0RLM@& P0PeS 0P U  0h0S 0 P U  0, 0S000(^ -LMP@p`P 0@S2/ RV 6/ -L MP@U` :U) '0(PK( $0 0P 0(pK0P 0P (0$ @@00K -L MP@U` :U) '0(PK( $0 0P 0(pK0P 0P (0$ @@00K -LM0PS`p@ ST( U$ $KP" $0S R :R TJP@ $0  $ G00KM Ѝ -LMPp`@P# PU0S0S :SU TJP@  iT nG00 M;Ѝ -0LM0S 080Q|@|P|p`0@XPC/``2TUEOL40 00S 0<]8]hlḻMЍxP -1LM0S10S 18q0S: X@ RZpWP10S DD1<@7JPPE   0@7n0p O(`(C/SX @ TXDU) 00S 08 0PP@ x0 0S hh0<00 D00HC/S@h],]_G<(_ -LMP`>00S 0 p@T 0S @ 0@P0'Tp 0@0  FQ00@ tTP 000 jT80 00S 0$ K]]h0 -LMt(B0S 2 "000"2@ 5` P0E%- 0S) Y 0Y$ E 8K%O  48p*TP   #Th!0S \1$7/D!0S 81 8!0S PE`VZ@T!Y00C0 S0@ @ST 0@P0S 0$Y# @0S 0S x0(P0T00 00EP 0@ S00S 0,(K]]0h08_ -LMpP`@QL10S @1 81@T 0 0S SP3P 0@06SpP% 0@Q0 zR00 F P 00P0 B  pqSPH0 @  @ 00S 0$$K]]h0M ЍMЍH? -LM@7pq0:0 0PT:0 p-LM0@ `P  00: 0phHS 0-LMP]?PP00OP0T@00:00 -LM0 0!S K p-LM0@ `V  00Pf`0 ,Pʼ0@00p`P` Up p-LM8` 0PS 3/0@S 3/p] 0-LM@Pd0h\0 0S 3/0P 00P00S 3/0] -LMH`p@P0X@S8/pPUZ`V_0 10M0S0C0R:Ѝ/ 0-LM0 RR@  P  100P:R0 b320 0 0-LM0@10 0s00R: 0R PP@  ! .Mc @0 1 0 -LM8 <0 P4 K00K@ `P? 00 i40R040 0  R5Y0S @aTT T  BR \ 0210 32@@0Q&# 0Ppp T( `P 0@0y0@1 @d P p X0{ 40 p040 a `P 0@0[ p40Q8a Z40 0S 00 pP008PJU00X0S XQ4 21@0PC ? 0T0 ,`P`p 0@0XPp  Q 00040 j "00p <K 0  @000@ (K -LMoPpU 0 K PPFP@ P PPPF@d  6TK1 2T P 09 FCb46 56,ʠP0 LLTK 3T P `FVLƟPp4656P0 T@K0` 3@PV 5T@ PP 0#:?C0C PPTK@ K<0Kb PH  <0@a@0T0@0 t@0 0< @0 @<0 Pn0Uh U0 dP `0 4@lT H P<0H 0<0  R< r H0  H0 P080 SH 0<0 00dH5 Q@  0S0d0 ` (4X 0P| \ h`  | P M |0 ! NIH0P @ H  ! AI"00SC S40X b040 8 <0R<0F0ZCP0f0CI X 0 S S R0S yPP000'S S SQ  R0pbPP@@ZD0P 0P @T0U 0g R#1 0@00S=PP  0 0CP00@  q0Rh ^000Q@ @dDA@`Q@hP D21 03pQPppW40040 @aPP 4 d4 0 p04Q룠/4 RE40`cV) 0S S SVX HPQ  R 0000D bP0@0XTP"00`W@FpTp0 20 2p0f40 W? 0S S S70 2 000, 0bS( `PP* Z 00CX21 030S@ 1 0dP40Q4 p D P4@0 (K0h0M 0@RZR R\00Ѝ/0A10M 00 R0: S:Ѝ/0 \M 1 21R  10 02SRЍ/ -L M@,KP0K0p0 c,0`0b2SzG  0=,$K -LMp` @E 00RP! 0 V0 0@ P @@ P 0 B %PP@ U @ @0 BP U P p@-0"RM"1@ 0`  00 3$ Pd05003$Q:R 00Q :0 0cC1S00Ѝp -LM0 10@ @R*0 S K0 @KM0S. 10          $  (  )  *  + , ! - " . # / $ 0 % 1 & 2 ' 3 ( 4 ) 005 L0S @04 0000 00 Ѝ/@_H_0D_L_0@-@PM 0Ѝ0@k-@- bM@ l 3. P:Ѝ -2LM00< S@0 2140 040 8 4 00<0BP0 S SP00S p @ 0p X0 XSxS0 SP"`V= S%00S T0#03P0S T7`$0p P0 S0S+0 XSxS&0 SP")S00W0S< 00 )Q<0C 0 S> PpT  $ 0200SW+ T0#03P0S ]T  0 T000 R 80S 8 0 b 21040ASQ00(Kh- M 0SЍ -8@LM,    hh|JL\ -LM,` -LMt,` -LM0 PR0P``@PH 00010p 8!#800"( (!( 0( \"x:0 0b 0("( #8!80#x \:W  0RPP@  ! [A@0 1  M 0"108#8S"("$"""!   Ѝ/ 88S00000PM 00Ѝ/-0 MS10 0LRA 3#\Ѝ -LM0p100`@PC 0` P0 `6>03U<U@@5 P 256 b42Uࠓ>  0-LM@P0 0 S0h7LP0S @@088 100AS0 0<0]P_]L0 p-0LM0PS 08 Uʰ AT010e10 U ʀ0 0c1S1@0:P@ @`,00S 0<0 00p]P_]L0X_t0 -L M@Pp`P5 46 J,0 6,0 Q(  (KP, ( 0`32 0, ,0S  0 ,K,0 0 T C>D0C05 `0 C>@0C01B@`@ K -LM@P`PpP00`?0P@``dP6 p0!1  0 ``0 @P0Q Q @ ^ P@:0t @  P@0  0V: pG02S p(K -LM0@0 P` VpP 0!R 0010P n0>00R3:Q`0R0:0F0 -LM0 @R0@PP` pWP9 10080 0 8S:1 ! 00 `P00 4 Z 0 @:4 0@^0:@P`00U:8 pGW02S p(K -LM@ P00@ -LMpPoȟ0@)"0@ \0P`0 0Zo@Pp  ! ?@p 1P  -LM@` L1 1`PK DqI ,APU 0S 18PUPP3 000S 0<帠开 8@P `p @T0S h8@T"P@ 0S $<P`lt9]T_]q -LM0x 0MЍ/x_ -LM@ ,0( P00 -LM(0 :1PX(0  XaA8pP+  D d_Bo5q`A78P 1!0 1!(R 0  P1D 1D , Z00  ,0o -PLM@ 0At/00 -L~M41Sm 5 000  @0 P P `Q `Kla `pH 0@L1 T 0X1  0\! Pd h 4 p P0aK/qK.K-KLQH+QK,KPaTqX\Q*aK)qK(KP`a `dqh$qKl10QpaDQ `p4|q ⌑  ! 001 P4qtQ 4x `a pq 刑  !  0p1 @0A PR `8 a a$`p8q(@taxq aKp|,P1a1K`qp向!K 10a堑8qaK!( 11K`a pq Б  ! 嬁 01 `a ,` $pq 0pȁ @崁A ( P4Q , 8@" 0$ 1 P 0P 4@ 1D 0$0D @ 04 P4P0t&2#5 0C@,0< 0(4 =e 40 Q4 P4@; T@( qY 0S5 1 A/4 ,4, 000 -0[ 0.0[0/0[ 000[ 0000 -0[@0.0[P0/0[ `000[$p00(00 -0[, 0.0[081 401 810/0[81 801 81000[81 <0 1 810 0 00 -0[@ 0.0[ 0/0[81 0$1 81000[0000 -0[0.0[0/0[000[0000 -0[0.0[0/0[000[0000 -0[0.0[0/0[000[0000 -0[0.0[0/0[000[0 000 -0[ 0.0[0/0[000[0$000 -0[$0.0[0/0[000[0(000 -0[(0.0[0/0[000[0,000 -0[,0.0[0/0[000[00000 -0[00.0[0/0[000[04000 -0[40.0[!0/0[000[08000 -0[80.0[0/0[000[0<000 -0[<0.0[ 0/0[000[0@000 -0[@0.0[0/0[000[0 $D 10 - [D0 . [0 /[ 0[  $ K/0[ ^000[ 0 !  ! ,1s4 L4@h,A^d 1R`00CS\4   4@0PS(0<4 @P4P 0 1D 0!0 BR#N!!4 >4Y Q  4 g?04P10A00#00#04$1$4 F4PP44@ h 0 0000 0|0 0x00t00p0000 O@*(0 @ (Ka\PL  -pS00LMW00S@ W 00,1$!W00/L 0(1 !$! aV$Q L?`Pp a0S 0P(1( U 0(0$QU0$1ZW(10(1 S$10$10 (1 ?P` B 0(1(1 00Q R$1 !0$1^ 0S (1 8#0PS  0"P  1S 000P Q 00c0 1 0000 0b0 (K -L$MD  D8 @ 4 H0 0 >`P 0 00P@< 7pW 8 0b\4 P: P$W 0  8 40 P'xS 0K0@ [P0@ 0 0 >@PE 0 < P< X@0LSH0 D 0P0<:@Q3x0/ 0S  H0H00 00b0 P D H0P 0  P 8000(K -LMR@p01j00,1 0h: 0-LS00M\00SP@ O01I00,10\ 00h -LMS0@ h -00,1QM@  0R:(" 2 02 02 02 02 02 02 02 0Q Ѝ/5.=*&*=* -LM` 2pP @H1B@A01 ; P d; 0200 0 0崜8q -AMLMŸP, p p8$ /<Pd<PXBnK`F`F0@"9 P:?0yBNK@DBK @DA0A 04 ;& p   ;1sa 1 <4 1R& Y 0CA 004 -4[.$[/[0[0L LLL^0L 0Q( K0/4[0$[0A A PZ<` W ; @00%BT  - @ F : : 8$P0@<P' p 8$P O00 ,0 S :(Kؠ -LM`pyQ 0P40 00 0 ? Q< R @00%BT @ H : : .4 P0@ P p G P 40P O0 0<Z 0S 0 0C0pp/ 0R* Z 0CA 000 -0[. [/[0[0L LLL^03K/0[0 [0 003K/0[0 [0  P (K p-L M1@QP 0aP8 0,0ZP8 8]-Kp p-LM 0P8-`#1@::0C0$ 0\\1 8!$ BP@ T00~AB2AA 0B 1 0ph~; -L M404  SP0 00S400404 000 `0$0!QD AQ! 1 BN?p @%PP T 01C T 0 ! 0$ 10C0S  "0|X 0S@p T!D0V$0@00@c TD `Vu F!D1DD0 `0CD0@ 010CX$0Sc pPi!D0@0 TD0"`V1 :R F!D1DD0@0CD0 ` 0 B Q~AB"AA 0B 1 05:    RQ00~LB2A0AB <0 0$ 10Q0A $0PD0 QP1@0c0Q51 m:@008#8#H! 04 :40P 00P00 00000P0C0@P0 40(K谀 -LMP0@0P@cH$HX`p %X0@@bH$HPX%X0 0C@0P0@ -L M`PD OXX 0S0?pQH NR7 0< 00Q8 -:@0@0F@bH$H0 @0H @cH$H4 @000<0H0@ 00 0c80b0C 0< 00@ 0@G0 SD0>:PU `尀X 0R@0 00S0S 00 0S `4 DPP1 0S 0 0 0S H 4  0D P040 0400D Q808(6D40P4D(Ko(K -LtM@ 0  P9P` ? 09Ph 7 `(0P 00h"0  0@ `p| 00S`@d 0h 0C 8xp hp#X`p 00C8Sl   0\KPXX \p0W T`V @p d` )^$x0`0C8#8 I 00l0ἐ 0g9`P dPP @ _8 @#d` x  0P8#8t0 Ut0D  b@ 00L0 00 0lH t P0S H @00 0S DKYP; 0DKL K[000p 0S @0H 0 0SpDK;pP 0DKp0 L K=00008#X0S0S UG:dP dDB4 00c 00  0f P4K< K8|#8  08# l  0 0b00屐 00<0 00l80 08#x`0X0g8#8 I! 000ഐ`000h 000(K -LM@0pP\oER 0080S#80l G8U#h 0  b000 R C CCC0^(1U0E(10 00G000 000B800C800000@-RM@P \, 0L 0l4 @PЍ0 -LMPp Q0`@\ Q QV8PP P0Sށ𩝉 -L M@pQ 4  P n0 $ `R),P> X) 0(10S$1 0 ! 0S 07P * 0P$1 0$10 0S07P 0 `P0 8#R `00 4 0 `(K -LMP@`Q7PPq  Q0 Q000a07P^ 0 8ᲀ#xP`=0 R  0S0 ` pp7P(E000Y0n0@ 0S$10 (!$1 50S 0T7P ) 0(10P%$10$1  0h8(#h"x 0 0p 0S 00  X10 -LM@pAQ 4  n`0 Ph(+P- 0 QP #0 0S06P  0PP0 8#R 3P00 4 0 P(K 0-LMP @p10K0 -L M@0 D <0K4 K `@P^40 j@KPwP 0@ 6PJ 0D pUpW 000ᴠ08#8 P(@"(0ᱠ00 @0@0@ D0@00Q@0A 8#8 P0 00@PP W000(K -L M`H0 00C< H8 H 8 4 D g< S0@8@#8@cH$H 00 T   8#8 @@0 0@ 0@00 DEP <0P< 0+p@4T # TH0X @ T@PH$HPdX%X 0PC4 4 0d0d00@ 0P00B0`008008 000C8< @ P#88 00;R008R#XH 0X0E8#X0 0@@eH$HX 8#8 B @0 00@ 00 DP `04 0 4 00000C8X#(p4(K -LMP `  a("Hpd0P pP\5`PP  0 0b8#H0T ʲ0S T0 bP P -LMpP`@LQ\QQ5W@p T0X  Q00SP ô 0@00!0 0 0C2#00 0 0T00 WW 800C80R B 0\R! B@-Q:@- R (2 R R -PPPP RrPP B PP R  R00 B R000Ѥ000l\000Ѥ000 R \6 R B0-.40P<$DL%T \,Ġ̌8 R0 .Ġ̌ RA R B0-.80P8$HH%X X,ȠȌ8 R0 .ȠȌ RA R B0-.<0P4$LD%\ T,̠Č8 R0 .̠Č RA R'0 R@- RP1P P1P RrP1P  B P1P B@  R010 1  B R0q0`0q0`0q0`\0q0`0q0`0q0` R 0\6 R B0@-81, Ġ%̌T$\D#L0P  R0@ Ġ01#̌  R R B0@-81, Ƞ%ȌX$XH#H0P  R0@ Ƞ01#Ȍ  R R B0@-81, ̠%Č\$TL#D0P  R0@ ̠01#Č  R M00S:Ѝ/ -LM @! ? kKP, -;2?P0S0@T0d p pGW0WXS 0gS80S @00P ! `K f-P@ 00C> 0( K 8C0SP0@ U T00SR`1S S S KeP 0S@@ -p@0S RP@ {0S  R s00@ ,0 S  1(KHJ -LM 0@iPM 0Ѝ`0M ЍZM 0ЍT0M ЍO -LM 0@FpMЍ(~2*z2* M-LM0|0`@p@T00 0S 0  ` Tp @0S $(K] M0-LM0 0 0@ P2K0 M-LM0|0`@p@T00 0S 0  ` TP @0S (K] M0-LM0 0 0@ P1K0 2*0 SM0 RЍ/p@-0MSP`P` D4%LP`\ЍpM0S0 C ,S R-S+SЍ/M0S SЍ/0@-PPM  00L S @#0C^00L S^Ѝ0 0-LMPK@ 0P  >00:S 0P 0<##00:S  0 P0 00K0 0-LM0P-S@ +S@P0 T00c00 -LM0@JS000 #MS00  0P 0.S! 0P 0.S 000C S00 [?mP 0/S 00h}m  -L MPp@0  d.P000 .p30 0S# S Sf 100 2" `0F40  1:C=C00SO ;RMX1@H0@!B0ß40 QV@@Gd-dP- @ -0 @-T  U0B0C@-0P S04 0 \@ B1Q \000 O0O(KQ 0-LMPP-dEA-`00 MR10bQ1bQP00Ѝ/ -L(MRP0 L PP 09H0D LR L=Q:S0T.U50S8 ( 0 5  00S9P0 8 80080 U0L SPE 0S 0<0R 8 0"4 < PUZ8 < DğP 00 D @ !H` @ 9$0  Po0@0S@T SUQPRZ 004K40 \P04pß0Os/,P ,<@6,P0<,8P 0@  d ,P,p3 00 P00bP 0P0!0X0 00 0L$P P(KP@D@Qnm?Q MR10bQ1bQP00Ѝ/ -LMP`Up@++0c0h% 0RM 0R  0R  0R 0R 0cЍ/ -LM0 00  lK0S lK< PlPK`< P  P\PXpU |+ x+ 00`K0c\0 0p wPprP jnPde\ 00``RPP=+P7+p3 10`0 LEp`0 S\ 00RPP+P+p3 10c`0 3P,D帔p0K``dV ʜp` @0K0Pd0*P0*0p03\ `##1 Qc R` \ \` P 0KPl00;Q X0 v># 0Sl lK:>Pl ;0 l0 0 0 ?S p 0O /?0@ @  `cP@a0P`Z@P <` Y@ < VU@p < @K K03/P <0S@0SKlKP- @ K R  S ZʎY@ < R S ppS~R|@p < ZxYuP@ K pїL RJx0SG 1\11pW_  =0A☐K3 L0R- 0=0P`BL0\ @0K 0O0SO80 4@ 03/PlK hPx L0R80K@0 <@  PEV 8K`FJHZ@ K PoSR ?!0 @K8P 4` @P <` 3/P00@K(Klnk99 -LMp@P`40S 0*K@-p0M@ 09H00 NS N0S: 0C"0\ZЍ9P@ -MLM`P8 <( 30 0 0S0 000K 0Pz 0S 18P11Zm B.K0 B B0S =0 B@4 P(0K 4@SD4xp4x 4(KR B.K B BD( ?Dx 1員! 0S@ , 2DP圥% p\! @ H @H L w3Lx dP00 S@x 0 0` cq3 4xX8<(00K4 Y (Kk99L*H*P 0M 0ЍYi P0 0M ЍPi -P?0LMS+? Q0S% R#0.,0 0St0 0Sd0 0ST0 0S D =0p3H*L*T*X*P* -FMLMx90P,0 9Kp`& PI 0U00 >+P 0:S /P  P/S .P X0:SP0/S v* P*BNK@D@D+v*+F*+B*P p@ L(FPPUIK966,`fV @FFH`fg0`j6f(K$! $(@ 2TQ Q\K\P2P)K6SSYY 0##iKf0 2"0#"KF0aS)KV`@v KPK`P@0V0 SL&00@P9KV`0S0o 0PRi@`0V 0e 0 0`R K&F)K0%P09K6S K` @P0X9K' IKFT@ 0S0(` 0QK' Y 0S0` 0Q @0 UT00CP0S )K&0j@c)KF 0 0 9K6RIKFTiKf PiK&9KF6TS0 SIKFD0 S}00 SyFLK(@D @D Po0Sl 002Sg0#qK0(A00000 0  0  0 P ``V FP*Y` -RLLM`@ 3(,6p@ P01h0 @000 0<S @>L0>Sv dp@ h 4p@ @d h@ 0Si 0K@Pd  \pP00PU& <U @>'0 >SP dl@ d  l@ @dd@ 0S,S ;S 4KdP;00>C40 0 s 3W4 R0;S,SHK dP& 0,S#\K[P PU|ğ @M00@H04 ` h0004 b 0a 0004}0Pp0(PPG0` H0K c4P@ ` \0KZU T  G0  G0@ P 0G G0`00 `dk%P`e%p3"1p QʍP`  ` 00KSځSB0`"0Sh20c Q0TBD  0c#0S ,rR( R0 0h!00 0S0 0 n0O0@0 Sb0 \| @M00@00 4h081 b 0a 0 0 00C00͆@00 00 blP  000P0PlPd h0d R d00 0 0 S p&dQ h d0 l &(Kx9H*L*Q%X* -LM@ P  hNd p-0LMD0@S`P 3/ 0S 000P \0H0S P3/T0@0 V80T,0(0p=0(0p]::B9l_d MЍ: -LM@  -@0LML@\, $$, 0 -lLM0SX@0 0R@GP (@ P hz:9B -LM,@D0S 3/H0S 3/]: p-LM,2%@PphQ0S Pp $PP ,$P0SP% PQ0  B B,lp$ P` 0:S  P ph|:99BP*d p-LMP`D0@S @3/4 H0@SP 3/p]:k P0M 0Ѝ p-LML`D0PS@ 83/w H0@S 3/p]: -@0LML@\, $$, 0<A0 Q@l0#[[[2[x h[$[[4[xh(Kp_ -QLM`p`pp^$ <0?@PW$0 X0AAQM Q0!0a0PЍ/-RM \1,0l00 ?\0 00Ѝ-RM 0bR12<0 RQ ?R0̑030Ѝ@-SM@ 0l\4<0̠ \ ?\ 0 0@\ P R  0 0 0Ѝ-MR ,0l0>ЍàS-0c02Ì.1M0 00Ѝ0M S 200 Ѝ/M0 3# R02 R02 0Ѝ/M bQ B2c00 Ѝ/@-M @0cR#3n P0C2Q0C2 d  l 0Ѝ0@- H. !Q, H@ ,P2\Ƞ3# MЍ0 -LM@,pK` 00K(PK 40K(4 ,000 ,( 0 K -L(M8pK4`K@H0  <0KDK 00PK@@K4D 80e  00@ 40`Z H 0@D 80O04 @0`I0< 840 000(K -RLM@`P'"xZᔀX4 K80Kf,@K0PK4 800<h0H0, Q02[Z8$KP1#3P1 <2MЍ/$PQMЍ/PM3:00QЍ/PM3:00Q#2Ѝ/QPMЍ/ ;; ;SMЍ/p@-9`\@T0 QMP R ,@00@0000#Ѝp p-LM`P@@@`@p -LMPP`p P0`B53A0Q B"A0E0U00` EU0 u @@ 0@dpP@$K0@-@_Z@@P  @PMЍ0 p-PLM 0 o@a@I PP5Q 0 U0S$0 UZ$K e 0KAe $0Kp0 000M ЍkЍ/|_t_ -LM, X"`@pt3Z00 P T  W TTV1("SV*0U,!00QsLPJ T 0W0T0SWT  !0Wx0SU0u P ,0 :@KDK T0Z@ D0 H)@0 6 `H @0 0@K<0DK48 0 @0`DS :`@KDK@HKDH 0FH@ D0c (K -LM@p`U =0S0S00SU -;LPp45gc M3^@(` ,0 0U0/@@UPpS3:V:00S00O2WS0"?DE)U1(0 n(( K,01,0 , (0( cUV W1,0 N,, Kz(01(0 ( ,0 cA@ Kx_ -;LP`45f M3 à^@p$0 ( US8 V2N(0 (( KI!V\?DE% U2$0 n$$ K6U FU 1?"C   $0( 2 N$0 A A2@K -顏OLMX`p P$K -顏OLMX`p Po$K/RMЍЍ|/RMЍvЍ -LpM| x x 0 ,JPJt@ %Jt優Cʠt \oOp&tP|@㪪<@ 8 0P D @ 4  @ tPZ t   lCZ    0$Z @tP0P 0DK4 K@0K00S 8<0 MbЍ/ -LM@  P900H9 -LMH9@SH9 P 0H9<@M<P񟗈 000D0<00Xt0000D0ػ00000 00000000D0400Ll0000D0л00000D!(00 S(0<H$!(00(0C  1 = 0 0005 *0$ /  0 ) 0S0C# 0S00  h0   P0   80  0 1 ЍЍ/P - 1LdM0pP$0 `o08@K |@ 0 Vx  L t p 0t0 0p0 0dp l0 0h0 L@KU` \@ XP  0P X <0K T0 0P0 5  a,\ \nPS -LMT @R0@000C0,00S 0 00@8]] -LM`0 pQP  뼀 R 1S @@b00  R | p000C  Tf:#:3 201 32  VHP`x -LM 0PC@  B0 0 b00刡 0@ 0 `0D @1p0W00  o P # 3TX0#0300 0 p (K計 p-LM0, 0 RP@`Lt90^ l N@<1A.S R00SRPpP -LM 0`^0 4 9~NP ,1@0鎐pPIp= 1@T  0A !0S0@0p W:P  0 P00 00@C0  BP0!004  00C0(K؈ -2LPM"@0`, 00(lpKV V V P,? P+( K0PD`C!P#hP\2PSP sPHB @BT@P(T@P(PU P`VA# P, Q pP` 1p`GP@@    h:B[<0 0 @1p`-P  0 0 0 0RD\,0Z0$%Z Ut)0@ c00S 0P00S h F 00 ,0 S <(KPi 0P ]]x -LM|ŸP, ^`@p00 t90U H >0>0W $ iT'1Zl1(L'QU$ T U  1B S 1A0j10S   0S  0 R 1' 0 ^ X( P A 600S   0S  00 0j01R0j1 0S!0S  T P1 SX >P 40@0:PB(KP$0 ->0>0LMR8 Pv1"( Y 8-Pp 8 i10cY c>p`0 1S P l! 01Xa140a1!0 10`0 X 10( 0B0P40 A: 0( BaVp 0S 8  &0S  8#80 11 010XApL@(0XD ( 1S, (Ko~(K@P؈Ph -LMPp^P *"*R@ R B0B@ T㈣@$ 0b S:Xp R T*P N<3`V$a P  ; R 0S R>0>$ 0+ b . .  o0 `ST  b `V=  zp b1IW( 7 0S' T% P 0*"*R R B00@ S15 05c0 P #0S  Q1ypW `PP o @/p !0 1!08#(R!  1 S1D1!1S R00 1Sp00S *<1S1100S00@@Pȉԉ  -LM`Vp P0S 00@T 0S 0| hV0h 0SL)0 h00C00S 0庮p]]P< - QL M8 < `ᰦ^$8 0:CR*80p>0^P <0kp@@ 000 /P  넮@$Q a P  e0S $ 0b S*0S bc $0< c:b0P@^ 0SX Xh%0ST<Q$0$ c g bH, 0 Rt90Q  8 0BS080S 800C10 D0P0U40 *0p Y:3), 1 ""p  0 W0 44 @P0 p0#  0@` 00S0@@0@P 1P R0000  0U 0 *P]Y 0 0 1R1J438#811  P  20S00PP`8:39 )8#8!1Ბ1 !2R0 B101!2 Q 4@0S00P4 P     0@d 0R  1S>@A@T0@@p$20!0R@ >8#Ƞ@T@.00001!0C8#8 ,S!1 R00 00p00c 0!2Qb 1S @@@@a00 x 0S1S  b 0@<0ST 8P 0 80 b (KPԉDH -LMp8 @0GW Z4 P20S 2R`VP`0"0SL)0 0D S 05@0 WT!1  0@e$0:CT: @5@>0 W0@ :Y )s0Wp  0npPh 0G0 g@T `Q P  ePaF P  hT| 00$0 0PP  m@1$Q a n P   0S$  bQ 00C000S 0T x00S  t? 00;4 P 80@4P24  @(K]]PPd؈ԉx -LMP`p10S `1Xq@TPPK@81VU3L9:U iP*00S 000S  tP'0 R  P#0A S05 0500&0P0C0\00S P0U @00S 4 Jī 00]]Px -LMPᲫ1p0S 0`@TPP0@0 0SL)0 kP$0E S05 05P000P0C0\00S P0U @00S 4 v 00rp]]Px -L$Mpc50< S p5hEXZP@N0@@5TL9@ @B0G S55 05p0Y  0@ P8  8@4$ 0:CW:%@ 0080:#:S@ S@ 0CC TT*D ,4$0c W40p $0000  W Z8 0Y3PU>0@0. Nn@`Vaß$PU`d4` `4 0P@: 4@@ P:@ P  P !<N01 !10b1 @(0UP:@@@4 2P0 P@ PP@4 2P0R @T 20S4 8P @pxt> 4R P9  D4"*$Ÿ$Q a P  !$ a P   f0P80 @PH W 0S$  b gW0 8 @ 7 WWD!0S0S00W0S&  Z 0 c W!* g9 W00S 0|@P WZ Z 1 ! R0  0 c" - @00C0`00S T0T D00S P  0<00(K]]Pȉ؈ԉx 0-PLM@0dCPaP:=0 -'QLM`$rP@ 2P0|p@  rp1 @0 84 0<00 84 0<0 0 84 0<00 84 0<0 0840< 00840<$0 0 84 0<(00  8 40<,00 00 00 0040000 840<8008 40<<0K`H`expate knd 32-by -9LrM 9, 0 @,! 0x0 @@ PP `` pp Ā    $00 (@A ,P Q 4`a 8pq <,$ P T H 0 L L?P  HA00 LQlKRH 1`pD1 $14a 8q < @ xP `p0A1 04100 81 (00 <1 00 0,@#1n, 1lȠp `p D@qc8` dH`1 p0P# ,&0b*a0 0 'eZ0` 0 (0 0#@,0n 0#1 1dLc̠1`c<1 0&00 000 1p0'P#0  #0\00 0,00 000 10(1 0 #0lȠ#0n@#1dHc8`1 0p00 0'00 0a#0` P#0eZ041 0 &081 0b*0<1 10(1 41 #81l̠#<1p@#1Dq c<`p1 0@a ndL`p@1& #D1P'#p0, \0Cp0 p0SF01( x0 01 t 41匀80|0 0< 0 ऀ ̀P P  P  `p1 ` p aq@!DQ P! Q  $t| @p !",q A X \ `! 0@P`p؀(!#<$L%\&l'|(,̠. !",d1 hA pQ |a q 唁   ! 1 A#p?$(,(0!4 180 A<@,QPaq0V4p00L@@HL Tp(\(#0P!0@  "@ PX@(@( @40 ?00, 0R (K`` p-L,M`0 0R0 P 0S D@K(p ,0S((`t@DK(0`0+@ L0080 0S00e0 0 S EKp``j p-LM`0S 00P00S'p0 @0M@c Kg ` 00C00S 04 Kp]]`` -0LM0@S` 00w밀尠p00S @VP1P!M@c 1 * p0`e0e00PV00S 04]]``MЍ/ 0-@LM P0hQ* p-R00P0LMS P?P*0SR *0S0,K  `00 0!00^0S0c 00 R L0Pl .a @0Q010C  P 0Q0KpЊ -LM`K 0 0 @ PK   @  PRM  Ѝ/0M0Ѝ/ -- LM 0  K - ML0MßP0P K, P$T4 jKPdT#VP3#0H#P[%[ 0 S2 NKL 0 KK(@DP@D0"0 P   0pPPR2K0HT0Z`\P "0PEP`p0 0d"PEP`p0S UPEU:00 00PEBKHHk1%T+0KmSD PQ!L4KL!0}P*KFD``%S00V0S 0@@:KD`FV@`F@TB.K@ BjK BT4BP KE(A0A @ab@DT0R S 0  KHZK 0aTHdc0 K(PK`(L0L00   0 K(@@  ,0 S <B(K  , aD4<L5PS -LM00 K --0 L^M0`QP 0 paM_KPE`@M?KC/KKd1 4A 0A Qp0F`Kpp\0 peKQ Q < c1@0 0R KH -@LM c` -LM @T#PPp` 0 zP390 rP)*?UQPdP0@ d0P@ZP*0`@@ F0f QPP@DZ-00" -LM0@!  0 K訕T -LM`p@ΰP0PP@0  p@ᯣTPPKxh@-M Ѝ@-MЍ! !P: ZŒŒ#! !P: `B!,aB 0>ZJJJJJJJJJJJJJJJJJJ }J xJ sJ nJ iJ dJ _J ZJ UJ PJKJFJAJ=Q:Q:Q:Q:Q:Q:Q}:Qx:Qs:Qn:Qi:Qd:Q_:QZ:QU:QP:QK:QF: QA: Q<: Q7: Q2: Q-: Q(: Q#: Q: Q: Q:Q:Q :Q:QA ? QA ? QA > QA > QA = QA = QA < QA < QA ; QA ; QA : QA : QA 9 QA 9 QA 8 QA 8 QA 7 QA 7 QA 6 QA 6 QA 5 QA 5 QA 4 QA 4 QA 3 QA 3 QA 2 QA 2 QA 1 QA 1 QA 0 QA 0 \aBC`B0QA 0 M Ѝ -L]M@ PMKpKKC/` `4 0 jTAM_KPE@l0D@K\0 KQ | Q x1 0 0R KD 0-AMLM00AKA@APA 0  04 d+0,f+b+^~B^KPEPE @A  $D D (D : h ap-R0 0c BSR48 R p-@P`x BRpR0 BRRRp&*."*10*2 -@LM\:0S@d0d S0!* R0 B\0`M 0SbЍ/RM0S0  R0S 00a@Ѝ/w* -LMh0`p@P@T00 0S  TP @0S |]y** 0-LM 0@0 @PdK0I*@-pPM`P 0@T00 S R B \0dC10 P  =\Ѝa -0LM0 0S=S` K KKF*JB* 0-LM 0@0 @PK0)*:%* -LMh0`p@P@T00 0S  TP @0S Ԡ]*@-@᫠@ 0 0C0S2M-S0!1!Ѝ/0 00M100 00 Ѝ/ -LMAPTpm%& R0 W 0 0PX@ P  Yi 00 cAT$K -L$MR` X 0SR D @ 0 13 B1 80 0D0 @ 010s03@0 < XQ 1U   01 0Q0PQ!0Z000 R00S 0S S0101S 1U=0P  P 5P 1S0C1\0   P0R 0S00S40 0 0Ps 00<3 Q B  1 001% p # 40S0S00S40  0pPC p00 p 10!00@0@@T00Q00001P0Q =U0 P @ 0 Z00 nPZD< 081  01 0ā0P(K -L@P/ 0`p( 0A 0P-L  0- L@0@P!P $000A -@LT 0A -OL@ PO -0LM2@ -L Usage: %s ..., where is one of: instbin%s: %s not compiled in mount_cd9660md5sha256sha512dfmountmount_ext2fsarchsyncnewfs_msdossttylnpaxtarfsck_ext2fscatifconfigsysctlping6dateztsscalemount_nfsfdiskgrepegrepfgrepumountmount_msdosfsckmorelesssignifymknodpwd_mkdbreboothaltmount_ffsdhclientcpgzipgunzipgzcatchmodchgrpchownchrootfsck_ffsnewfsrmmtejectmkdirksh-shencryptbioctlsleepmvdmesghostname:|\0v@@܍ `ԋ@@ unknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs cannot be zerocbs meaningless if not doing record operationsbuffer sizes cannot be zerobuffer sizes cannot be greater than %zdseek offsets cannot be larger than %qdnonenoxferunknown status %s%s: illegal numeric valueunknown conversion %s%s: illegal conversion combinationcbsconvibsifobsofskipstatusnoerrornotrunc%s: end of device%s: short write on character device%s: short write on tape devicefiles is not supported for non-tape devicesstdoutinput bufferoutput bufferstdiopledgecase conv and -DNO_CONV%zu+%zu records in %zu+%zu records out blockblocks%zu odd length swab %s %zu truncated %s %qd bytes transferred in %lld.%03ld secs (%0.0f bytes/sec) skip reached end of inputtt usage: mount_cd9660 [-egjR] [-o options] [-s offset] special node session number is %s: %segjo:Rs:realpath %scd9660%s: Filesystem not supported by kernel%s on %suserquotagroupquotarwnetautoaccesstimeatimeexecsuidrdonlyupdateneedsdoes not need-o %s: option %s a value-o %s: option not supported%s: illegal value '%s'%s (%s) = %s usage: %s [-bcpqrtx] [-C checklist] [-h hashfile] [-s string] [file ...] error encoding base64cannot open %sstdout: write error%s: read errorstdio rpath wpath cpathbC:ch:pqrs:txbase64hex%s doesn't support %s ,stdio rpathunknown algorithm "%s"SHA256SHA512 df: %qd: %s usage: %s [-hiklnP] [-t type] [[file | file_system] ...] %7sonly one -t option may be specified.empty type listhiklnPt:-h and -i are incompatible with -Pretrieving information on mounted file systems%s is not a local file system%s mounted as a %s file system1024-blocks 512-blocks%-*.*s %s Used Available Capacity Mounted on Filesystem%-*.*s %*lld %10lld %11lld %5.0f%% %s %-*.*s %s Used Avail Capacity Size1K-blocks%-*.*s %s Used Avail Capacity iused ifree %%iused Mounted on%-*.*s %*llu %9llu %9lld %5.0f%% %7llu %7llu %5.0f%% %s ext2fsnfs:@ufsffs%s: fstab uses outdated type 'ufs' -- fix pleasemfs%s: fstab type %s != disklabel type %susage: mount [-AadfNruvw] [-t type] mount [-dfrsuvw] special | node mount [-dfruvw] [-o options] [-t type] special node -o%s,%s on %s type %.*s%sunknown flag%s %#x, ctime=%sv3v2udptcpsofthardintrnoconnrdirplus%s%s=%dwsizersizerdirsizetimeoretransmaxgrouplistreadaheadacregmin, %s=%dacregmaxacdirminacdirmax%s%s=%lu %smsdos%s%s=%u, %s=%uuidgid%s%s=0%onowin95norripgensextatttmpfs%s%s=%04o%s%s=%luinodesstatfs %s on %s type %.*s: %s already mountedexec: mount_%sfork%s/mount_%sexec %s for %sno mount helper program found for %swaitpidstdio rpath disklabel proc execforceAadfNo:rswt:uvrqnoautogetmntinfounknown special file or file system %s.root_devicecan't find fstab entry for %s.%s has unknown file system type./var/run/mountd.pidsignal mountdasynchronousasyncexported to the worldNFS exportedanon uid mappingexported read-onlynoatimenodevnoexecnosuidwxallowedwith quotasread-onlyroot file systemsynchronoussoftdep/usr/sbintt usage: mount_ext2fs [-o options] special node o:specified device does not match mounted devicefilesystem not supported by kernelmount table full%s on %s: %susage: machine [-a] usage: arch [-ks] machinezaurusarmOpenBSD.%s%s ,@@,@h ,p,p ,p ,` ,@ , $%s: no default %s%s: illegal %s%s: bad %susage: %s [-N] [-a FAT-size] [-B boot] [-b block-size] [-c cluster-size] [-e dirents] [-F FAT-type] [-f format] [-h heads] [-I volid] [-i info] [-k backup] [-L label] [-m media] [-n FATs] [-O OEM] [-o hidden] [-r reserved] [-S sector-size] [-s total] [-u track-size] special [disktype] stdio rpath wpath disklabel%s: bad FAT typevolume ID"*+,./:;<=>?[\]|%s: bad volume label%s: bad OEM stringbytes/sectorsectors/FATsectors/clusterdirectory entriesdrive headsmedia descriptornumber of FATshidden sectorsfile system sizesectors/track/dev/%s is mounted on %s%s: block devicewarning: %s is not a character device%s: unknown standard format%s: can't figure out partition infoioctl (GDINFO)%s: can't read disk label; disk type must be specified%s: unknown disk type%s: partition is unavailablebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %u-%c is not a legal FAT%s optionblock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)/boot/%s%s: inappropriate file type or formatno room for info sectorno room for backup sectorbackup sector would overwrite info sectortoo few reserved sectorstoo many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: sectors/FAT limits file system to %u clusters%u clusters too few clusters for FAT%u, need %uwarning: FAT type limits file system to %u sectors%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) bps=%u spc=%u res=%u nft=%u rde=%u sec=%u mid=%#x spf=%u spt=%u hds=%u hid=%u bsec=%u bspf=%u rdcl=%u infs=%#x bkbs=%s: can't read sector %uNO NAMEFAT%uBSD 4.4%s: can't write sector %u16018032036072012001440288044 448$9444 45  5 5 5<97$5,5:6666666667 7 7 7#$73,7#473<72D73L73T7#\7@d7@@l7@t7|7777777777777777 8 8@8@8 8(80888@8H8P8X8`8h8p8x888888 8 9888888889999 9,989D9L9T9\9d9@l9@x9@9@9 9 9 9 9999999@9@9:: : ,:C$:C :C$(:C0:<:H:T:`:h:p:x:::::: : :::::@:@::::;;option requires an argument -- %sundefmaximum option value is %d -- %soption requires a numeric argument -- %sdiscarddsuspeofeol2lnextminquitreprintstartstopsusptimeflushrprntillegal gfmt1 option -- %sillegal gfmt1 option%lxcflagiflagispeedlflagoflagospeedgfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d TIOCSTOPTIOCSTARTTIOCSETD%d %d rows %scols %sospeed %sispeed %sillegal option -- -%scbreakcolscolumnscookeddecekeverythingextproclcasenewoldostartostoprawrowssanespeedcs5cs6cs7cs8cstopb-cstopbcread-creadparenb-parenbparodd-paroddparity-parityevenp-evenpoddp-oddppass8-pass8hupcl-hupcl-hupclocal-clocalcrtscts-crtsctsmdmbuf-mdmbufignbrk-ignbrkbrkint-brkintignpar-ignparparmrk-parmrkinpck-inpckistrip-istripinlcr-inlcrigncr-igncricrnl-icrnliuclc-iuclcixon-ixon-flowixoff-ixofftandem-tandemixany-ixanydecctlq-decctlqimaxbel-imaxbel-echoechoe-echoecrterase-crterasecrtbs-crtbsechok-echokechoke-echokecrtkill-crtkillaltwerase-altweraseiexten-iextenechonl-echonlechoctl-echoctlctlecho-ctlechoechoprt-echoprtprterase-prteraseisig-isigicanon-icanonnoflsh-noflshtostop-tostopflusho-flushopendin-pendin-crtnewcrt-newcrtnokerninfo-nokerninfokerninfo-kerninfoxcase-xcaseopost-opostlitout-litoutocrnl-ocrnlolcuc-olcuconlcr-onlcronlret-onlretonocr-onocrtabs-tabsoxtabs-oxtabsonoeot-onoeot tablet disc; slip disc; ppp disc; strip disc; nmea disc; #%d disc; ispeed %d baud; ospeed %d baud;speed %d baud; %d rows; %d columns;lflags-extprociflagsoflagscflagscchars%s = %s;%-8susage: %s [-a | -e | -g] [-f file] [operands] -aefgaef:gTIOCGETDnot a terminalTIOCGWINSZeither display or modifygfmt1illegal option -- %stcsetattrTIOCSWINSZusage: %s [-fhLnPs] source [target] %s [-fLPs] source ... [directory] %s/%s%s: disappeared%s and %s are identical (nothing done).stdio rpath cpathfhLnPs\f4fl"!5E)[o8o8 ,ޅ/x{ыs5^ŗP ] ը3܃0ޝFՀާQEmtG,H$JcU]:N3sUrj:woz]Nj~&PIFQ6euQ3iM_>9=ʧ>LG)EwET>Nh;0,QBo`Hˣ8ͣI? uo;I>G!4F%QG9l ,:%]ؑ{l,m"1:2 S<^B㲊Weͷq  .XTU8㉬/x`R|^V+Ug8uV6&KUUf,1dv u<9 Y`Hetqmj9`tQǙMh#q`R,bú6_ldvD,<ǀ0Y_aj y٢,fЪlf=3I&yd(Ć<$U6ӆP /&K@E"cPM]t^VW^@eBܐ(8T'|vπ-nvŘ=sz8+a%>@Cx7vfN m1l<.aDVL pj0?)N-|$>!32;`48 ,96 a'Wk]>`A`L_\t¾Vp344>NitIitiC {K`֙7 > aOڍgV 5$Xo-^}EɪX:ۨ*C}DleQ81lI \(\e`("53l!BBw,Y:juoEyWke OzpL8$Źy,@F7*=\YצH^ґSG@E Aqm×FW<.FwdԊT ^׀"PC z^*p@w~Wx:FێB/ywb1Xm, C`frLJ6ϛX(ճfpj]m.w8S{¨4 H%MHMlqy,/gf5 e?,Fp> u_Aa[ :Yaɲ~5G!!r !a7WZw0M+AgI>G;Xx]epa6rǧgyvp& SYYl-3.=UWYrK~ⲭIYQ'}3FA2ꂭ7b_$TÀgkߴp)@K@}ԾaD<Ҏ]jQwJB' mڶ޾#A_CqZ~/,h+(^f iVQ\2Kd_ƻ$rkǴ[%&cjCցJGqSs鐮, Q?Xqs5^iѢ { $wH;VIlNk[D@de2 J܄bUC,) -j3]Ck ECQf*I/4k\6e,_ǫPb左$'g$I3IT䪸 x;X%)l xO Qwn #| fzU0#`73{4!#peyCZZQϜVrDJb#&'\ @󛐪\a@AUŰ+{\#&o0 A˦K\n Me@lt4˕;6CZ85SocraFe9Rn16'OȄG:*[~tkx4|C{DE͏kX <\r(jrL"8a}([O:V$WQNS`dǡ6 e7HMl%z@R+'|Lw& eGhWt{2m:{u}56R͘0&٘Kbz=hv4VrLq|K`Fv5|*-UjW,]k:o%e7QIIE\F:Q=HR[B5kFKrمۑ+nw.wǘ$WnTXxɦ]h( )qfXZc@x&YVEӹȘ[2T BIO~Q` /]Aj'l< !v rA(W\ө5EJIOūٽzo{dt(&z>$EuK

w!&%x)oV}u-C^f+X/XeƙLh[Q5փa`x7TY Uiv[xXO3-=5UJpI9s̀oyt?lsj xh#{<(z~룠 iQńVu+L"妇i1f^/ɾ/ffŦ\\-,]6G$MfQ”P &}K~d.uת]0Iِ"TSiVE3`rL_G.T-&L01Zsݎ}D- *r3Cؑ I=PGM] |"&[1%rqb;ܸ|KbfC,6!sOeu+wG*U}j) \pKSU6-m\>!ď&-Vv(+Iڠ=z--߸Dwk[/;홗*el_*X=n?O?E"efٟCnS~NRQӁ!M9OPdE"Rbv&Mi-rksmOBpH6 "?QKS1}|Uzk`"t A+!*%Dmya1(-;A ?^C_ 1 {/ $eS#O=}?asg{m8ƀ:V<uT]j,t:EPYIgs[ޑN݂S |E(H6c믢@$b$oYZmr3b[7@08iW.[HZ}tfI!F; R DA1?=ӥP]O)hij|@ټVRAc &E3Zj:=@HsNJR/pa[6bU8JKˠkxF9bGx-=9h_]͊7qNot5vL۵k*j%vc.bj W Ùژ]ϙc)nC2t5]F1 Nf޽0?w^lm@Z !UڄM˘gi%pg{kUS{k Xq&٩8N}.K΢36z ` tZ-mV'C#1f@Ox8fXLR 5AV?}bA*A#ޝr>&%%3Iڹ%O}%i䤌~ }|^(ݜTz$ .#G =m<- 'ހJݧ?_ ԣef:}ZTH L@=;#%O㡒ÁϾ'Go&_ ^Gwoڻ'dPS* 긷UqLЭ*+{e/`"L~W`چ̏8 |!_S{hs3Q}:mo x5=atBﺋbu_;QAמ͍ICɳGqY$/g3]5o`r?Mi&1`oHq8 qoTx~̾ 瑉BATi'qsP&kmmЎ!6fu%c^+Vte(3Cl'#@ˮ2_#|"_{Ґt! sx0FC`2 ;<-h8 4ArWYQuJB .msU-t/sU ^ԩKmFR f.lvd+m9:8|uwB(*3k1+cSˡA$dje~* a⮽'w~$߻\ljNs[f*\ra=dyVKc'䰰5pH_ɰeע3ԜgR,pZd] UlxQƄ Vnioqxk[cPM{rF? $bJ؆Oa8Lۿ~zy]Ycz=Ov˫m`j~;5\E+HJ/$ Ӫg+јB _R&]oqgrzx{'l3_{4a'95:9{5DZz:'b  1pN0P6+Aذg_>$+ˮabBo%'czl&0T n{LJjott| K=TCMdusage: disklabel [-Acdtv] [-h | -p unit] [-T file] disk (read) disklabel -w [-Acdnv] [-T file] disk disktype [packid] (write) disklabel -e [-Acdnv] [-T file] disk (edit) disklabel -E [-Acdnv] [-F|-f file] [-T file] disk (simple editor) disklabel -R [-nv] [-F|-f file] disk protofile (restore) `disk' may be of the form: sd0 or /dev/rsd0%c. `disktype' is an entry from %s, see disktab(5) for more info. /etc/disktab`packid' is an identification string for the device. `protofile' is the output from the read cmd form; -R is powerful. For procedures specific to this architecture see: %s fdisk(8)sector size %dsectors/track %dtracks/cylinder %dcylinders/unit %dboot block size %dwarning, boot block size %% sector-size != 0super block size %dwarning, super block size %% sector-size != 0warning, number of partitions (%d) > MAXPARTITIONS (%d)warning, partition %c: size 0, but offset %llupartition %c: offset past end of unitpartition %c: partition extends past end of unitwarning, unused partition %c: size %llu offset %llu line %d: syntax errorunknownIDEESDIline %d: warning, unknown disk type: %sbadsectvendorline %d: bad flag: %sdrivedataline %d: bad drivedata %s%d partitionsline %d: bad # of partitionsduidline %d: bad %s: %ssectors/cylindertracks/cylindercylindersrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seektotal sectorsboundstartboundendline %d: bad partition name: %sline %d: too few fieldsline %d: bad partition size: %sline %d: bad partition offset: %sline %d: warning, unknown filesystem type: %sline %d: unknown field: %sVISUALEDITOR/usr/bin/vi/bin/sh%s: No disk label on disk%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of diskioctl DIOCRLDINFOioctl DIOCGPDINFOioctl DIOCGDINFO %c: %16llu %16llu %c: %15.*f%c %16llu %7.7s%7d %5u %5u %4hu %19.19s# %s# %s: type: %s type: %d disk: %.*s label: %.*s duid: %02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx flags: badsect vendorbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %llu # total bytes: %.*f%cboundstart: %llu boundend: %llu drivedata: %d %hu partitions: # %16.16s %16.16s fstype [fsize bsize cpg] offset%.*s|Automatically generated label:\ :dt=se#%u:ns#%u:nt#%u:nc#%u:sc#%u:su#%llu:d%d#%u\ :p%c#%llu:o%c#%llu:t%c=%s:t%c=unknown%d:b%c#%u:f%c#%u:/dev/%s%c%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx.aioctl DIOCWDINFO # Notes: # Up to 16 partitions are valid, named from 'a' to 'p'. Partition 'a' is # your root filesystem, 'b' is your swap, and 'c' should cover your whole # disk. Any other partition is free for any use. 'size' and 'offset' are # in 512-byte blocks. fstype should be '4.2BSD', 'swap', or 'none' or some # other values. fsize/bsize/cpg should typically be '2048 16384 16' for a # 4.2BSD filesystem (or '512 4096 16' except on alpha, sun4, ...) No changes.re-edit the label? [y]: unknown disk type: %scan't get mem sizebckmgtBCKMGTValid units are bckmgt AEf:F:hRcdenp:tT:vwstdio rpath wpath cpath disklabel proc execstdio rpath wpath cpath disklabelSMDMSCPold DECSCSIST506HP-IBHP-FLtype 9floppyccdvndATAPIRAIDrdrootunusedVersion6Version7SystemV4.1BSDEighth-Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSHFSADFSNTFSUDF-cparse percent %s: %s%s: parse error on line %u%s: min size > max size on line %u%s: sum of extra space allocation > 100%%Treating sectors %llu-%llu as the OpenBSD portion of the disk. You can use the 'b' command to change this. OpenBSD area: ; size: ; free: # %16.16s %16.16s fstype [fsize bsize cpg] Can't stat deviceAvailable commands: ? | h - show help n [part] - set mount point A - auto partition all space p [unit] - print partitions a [part] - add partition q - quit & save changes b - set OpenBSD boundaries R [part] - resize auto allocated partition c [part] - change partition size r - display free space D - reset label to default s [path] - save label to file d [part] - delete partition U - undo all changes e - edit drive parameters u - undo last change g [d|u] - [d]isk or [u]ser geometry w - write label to disk i - modify disklabel UID X - toggle expert mode l [unit] - print disk label header x - exit & lose changes M - disklabel(8) man page z - delete all partitions m [part] - modify partition Suffixes can be used to indicate units other than sectors: 'b' (bytes), 'k' (kilobytes), 'm' (megabytes), 'g' (gigabytes) 't' (terabytes) 'c' (cylinders), '%' (% of total disk), '&' (% of free space). Values in non-sector units are truncated to the nearest cylinder boundary.%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx.%c%s%c none swap sw %s%c %s %s rw 1 %d failed to sort partition table Error, partitions %c and %c overlap: Disable which one? (^D to abort) [%c %c] %s: [%llu] %lldRounding size to cylinder (%d sectors): %llu fragment sizeSize of ffs block fragments. A multiple of the disk sector-size.Command aborted Invalid entry Error: fragment size must be a multiple of the disk sector size (%d) Zero fragment size implies zero block sizeSize of the partition. You may also say +/- amount for a relative change.The size must be > 0 sectors The size can't be more than %llu sectors, or the partition would extend beyond the last sector (%llu) of the OpenBSD portion of the disk. The 'b' command can change this limit. Sorry, there are only %llu sectors left Starting sector for this partition.The offset must be >= %llu and < %llu, the limits of the OpenBSD portion of the disk. The 'b' command can change these limits. The offset must be in a free area. Starting sectorThe start of the OpenBSD portion of the disk.Size ('*' for entire disk)The size of the OpenBSD portion of the disk ('*' for the entire disk).%s: [%s] [d]isk or [u]ser geometryEnter 'd' to use the geometry based on what the disk itself thinks it is, or 'u' to use the geometry that was found in the label.BIOS geometry not defined. Note: user geometry is the same as disk geometry. You must enter either 'd' or 'u'. Where to mount this filesystem (ie: / /var /usr)'%c' already being mounted at '%s' Mount points must start with '/' FS typeFilesystem type (usually 4.2BSD or swap)FS type (decimal)Filesystem type as a decimal number; usually 7 (4.2BSD) or 1 (swap).Unrecognized filesystem type '%s', treating as 'unknown' Size of ffs blocks. 1, 2, 4 or 8 times ffs fragment size.Error: block size must be at least as big as page size (%d). Error: block size must be 1, 2, 4 or 8 times fragment size (%llu). Align partition to block sizeRound the partition offset and size to multiples of bsize?Rounding offset to bsize (%llu sectors): %llu Rounding size to bsize (%llu sectors): %llu The disklabel UID is currently: %02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx The disklabel UID, given as a 16 character hexadecimal string.Invalid UID entered. Possible values are:"IDE", "%s"Disk typeWhat kind of disk is this? Usually SCSI, IDE, ESDI, ST506, or floppy."%s" is not a valid disk type. Valid types are: Changing device parameters for %s: What kind of disk is this? Usually SCSI, ESDI, ST506, or floppy (use ESDI for IDE).label name15 char string that describes this label, usually the disk name.The Number of sectors per track.The number of tracks per cylinder.The number of sectors per cylinder (Usually sectors/track * tracks/cylinder).number of cylindersThe total number of cylinders on the disk.The total number of sectors on the disk.You may want to increase the size of the 'c' partition.Not enough free space to shrink by %llu sectors (only %llu sectors left) partition to change sizeThe letter of the partition to change size, a - p.Partition must be between 'a' and '%c' (excluding 'c'). Partition '%c' is not in use. Partition %c is currently %llu sectors in size, and can have a maximum size of %llu sectors. partition to deleteThe letter of the partition to delete, a - p, or '*'.partition to modifyThe letter of the partition to modify, a - p.partition to nameThe letter of the partition to name, a - p.You cannot name a filesystem of type %s. No space left, you need to shrink a partition The letter of the new partition, a - p.Partition '%c' exists. Delete it first. partition to resizeNo such partition Cannot resize spoofed partition [+|-]new size (with unit)new size or amount to grow (+) or shrink (-) partition including unitAmount too big Partition %c shrunk to make room No room left for all partitions You need to specify a type for this disk.can't run when there is partition overlap.No 'c' partition found, adding one that spans the disk.Label editor (enter '?' for help at any prompt) unable to get default partition tableThis option is not valid when run without the -f flag. PAGER/usr/bin/lessgunzip -qc|%sunable to execute %sIn no change mode, not writing label.No label changes.Write new label?Write the modified label to disk?unable to write labelResize only implemented for auto allocated labels Free sectors: %16llu - %16llu (%16llu) Total free sectors: %llu. FilenameName of the file to save label into.Original label and mount points restored.Last change undone.EnteringExiting%s expert mode Unknown option: %c ('?' for help) /tmp/var/usr/usr/X11R6/usr/local/usr/src/usr/obj/homelfsadosntfsudfsdFLOPPYxdhdVNDsvndabcdfiklnoprstuvwxBDEGHLPTUXYZ0Cannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specForward positioning operation on archive failedCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Reverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsUnable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Tape drive unable to backspace requested amountUnable to backspace tape over %d pad blocksUnable to backspace tape %d blocks.Failed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDUnable to truncate archive file%s%s: Waiting for tape drive close to complete...done. %s: unknown format, %llu bytes skipped. %s: %s vol %d, %lu files, %llu bytes read, %llu bytes written. could not pipecould not forkstdio rpath wpath cpath fattr dpath getpw ioctl proc-dcPATH=/usr/bin:/usr/local/bincould not exec %sFailed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed chdir to %sFailed stat on %sCannot write an archive on top of a directory %sUnable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Ready for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again ..Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sUnable to open %s to readCannot identify format. Searching...Sorry, unable to determine archive format.Premature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot mix current archive format %s with %s%s: Reading archive to position at the end...Cannot chdir to %sCan't fchdir to starting directoryUser specified archive volume byte limit reached.Read fault on %sFile changed size during read %sFile %s was modified during copy to archiveUnable to obtain block size for file %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sActual crc does not match expected crc %sUnable to append when there are archive read errors.Archive read error limit (%d) reachedCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Write block size %d too large, maximium is: %dWrite block size %d is not a %d byte multipleWrite block size of %d too large, maximium is: %dWrite block size of %d is not a %d byte multipleWrite block size of %d larger than POSIX max %d, archive may not be portableUnable to allocate memory for group name cache tableUnable to allocate memory for user name cache tableUnable to allocate memory for group id cache tableUnable to allocate memory for user id cache tableFile changed size %sFile %s was modified during readFile rewind failed on: %sFailed seek on file %sFailed write to file %sFile seek on %sWARNING! Major Internal Error! GNU hack Failing!Out of memoryCould not set permissions on %sUnable to set file uid/gid of %sAccess/modification time set failed on: %sUnable to restore mode and times for directory: %sUnable to stat directory: %sDirectory vanished before restoring mode and times: %sUnable to close file descriptor on %sUnable to copy %s, file would overwrite itselfUnable to remove directory %sCould not unlink %sUnable to create %scannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCould not create: %scpioCould not access %s (stat)Unable to link file %s to itselfUnable to remove %sCould not link to %s from %sUnable to link to %s from %sA hard link to the directory %s is not allowedIgnoring unterminated pathname at EOFIgnoring too-long pathname: %sCan't chdir to %snext_fileFile system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %sWARNING! These file names were not selected:Invalid file name argumentUnable to allocate memory for filenameUnable to allocate memory for file name buffer%b %e %H:%M%b %e %Y%s%s %s %s%2u %-*.*s %-*.*s %4lu, %4lu %9llu == -> %s: unknown option %c %s: %c argument missing input compressed with %s; use the -%c option to decompress itbzip2compress7zXZinput compressed with xzInvalid option nameUnable to allocate space for option listInvalid options formatusage: tar {crtux}[014578befHhjLmNOoPpqsvwXZz] [blocking-factor | archive | replstr] [-C directory] [-I file] [file ...] tar {-crtux} [-014578eHhjLmNOoPpqvwXZz] [-b blocking-factor] [-C directory] [-f archive] [-I file] [-s replstr] [file ...] usage: pax [-0cdjnOvz] [-E limit] [-f archive] [-G group] [-s replstr] [-T range] [-U user] [pattern ...] pax -r [-0cDdijknOuvYZz] [-E limit] [-f archive] [-G group] [-o options] [-p string] [-s replstr] [-T range] [-U user] [pattern ...] pax -w [-0adHijLOPtuvXz] [-B bytes] [-b blocksize] [-f archive] [-G group] [-o options] [-s replstr] [-T range] [-U user] [-x format] [file ...] pax -rw [-0DdHikLlnOPtuvXYZ] [-G group] [-p string] [-s replstr] [-T range] [-U user] [file ...] directory Invalid block size %s/dev/rst0/dev/rst1/dev/rst4/dev/rst5/dev/rst7/dev/rst8b:cef:hjmopqruts:vwxzBC:HI:LNOPXZ014578TAPE-IUnable to open %sUnable to read from %s-CInvalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multipleError count value: %sab:cdf:ijklno:p:rs:tuvwx:zB:DE:G:HLOPT:U:XYZ0%s: Invalid combination of options: -%cDestination directory was not suppliedThese format options are not supported %s = %s ustarFile name %s/%s, too longWARNING! These patterns were not matched:Replacement name error %sReplacement name too long %s >> %s%s >> %s >> %s Removing leading / from absolute path names in the archiveRemoving leading "%.*s" ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s Pattern select out of memoryPattern list inconsistentEmpty pattern stringUnable to allocate memory for pattern stringEmpty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %s CPU time limit reached, cleaning up. Signal caught, cleaning up. Can't open current working directory.TMPDIR/tmp/Cannot allocate memory for temp file name.Unable to set up signal handlerstdio rpath wpath cpath fattr dpath getpw ioctl proc execstdio rpath wpath cpath fattr dpath getpw ioctlcan not gzip while appendingEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [[[[[cc]yy]mm]dd]HH]MM[.SS][/[c][m]]Unable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryUnable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory for directory timesCannot canonicalize %sUnable to store mode and times for created directory: %sNo interactive rename table, links may failCannot update rename tableInteractive rename table out of memoryCannot allocate space for directory access time tableCannot allocate memory for interactive rename tableCannot allocate memory for hard link tableHard link table out of memorydeferred symlink hardlinkdefered symlink hardlink pathsymlink tabledeferred symlink removaldeferred symlink%s: %sdefered symlink pathdefered symlink valuedefered symlinkFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sDirectory access time reset table ran out of memoryUstar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sFile is too long for ustar %snobodyUstar header field is too small for uid %lu, using nobodyUstar header field is too small for gid %lu, using nobodyUstar header field is too small for %sTar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sInvalid extended header recordInvalid extended header record lengthExtended header record length %lu is out of rangeMalformed extended header recordlinkpathwrite_optnodirUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.%s: /dev/ttyFatal error, cannot open %susage: ping [-DdEefLnqRv] [-c count] [-I ifaddr] [-i wait] [-l preload] [-p pattern] [-s packetsize] [-t ttl] [-V rtable] [-w maxwait] host patterns must be specified as hex digits%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xVr HL TOS Len ID Flg off TTL Pro cks Src Dst Data %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %s TCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Echo ReplyDestination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set (MTU %d) frag needed and DF setSource Route FailedNetwork UnknownHost UnknownSource IsolatedDest. Net Administratively ProhibitedDest. Host Administratively ProhibitedDestination Net Unreachable for TOSDestination Host Unreachable for TOSRoute administratively prohibitedHost Precedence ViolationPrecedence CutoffDest Unreachable, Unknown Code: %d Source QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect, Unknown Code: %d(New addr: %s) Echo RequestRouter Discovery Advertisement(%d entries, lifetime %d seconds) Router Discovery SolicitationTime to live exceededFrag reassembly time exceededTime exceeded, Unknown Code: %d Parameter problem, required option absent: pointer = 0x%02x Parameter problem: pointer = 0x%02x TimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask Reply (Mask 0x%08x) Unknown ICMP type: %d --- %s ping statistics --- %lld packets transmitted, %lld packets received, %lld duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms clock_gettime(CLOCK_MONOTONIC)invalid peernamepacket too short (%d bytes) from %ssignature mismatch!%d bytes from %s: icmp_seq=%u ttl=%d time=%.3f ms (DUP!) (TRUNC!) wrong data byte #%d should be 0x%x but was 0x%x%x %d bytes from %s: LSRR: 0.0.0.0 %s (truncated route) (same route) RR: NOP unknown option %xping: sendtoping: wrote %s %d chars, ret=%d setresuidnumber of packets to transmit is %s: %sillegal timing interval %s%s: only root may use interval < 1stoo small interval, raised to 0.01preload value is %s: %spacket size is %s: %sttl value is %s: %srtable value is %s: %ssetsockopt SO_RTABLEmaxwait value is %s: %sDEI:LRS:c:defi:l:np:qs:T:t:V:vw:unknown host: %ssize of sockaddr mismatchbind-f and -i options are incompatibleNo audible output for flood pings-R option and -D or -T, or -t to unicast destinations are incompatiblerecord route not valid to multicast destinationsping: record routesetsockopt IP_MULTICAST_LOOPsetsockopt IP_MULTICAST_TTLsetsockopt IP_MULTICAST_IFgetsockoptsetsockoptCannot set the receive buffer sizeCould only allocate a receive buffer of %d bytes (default %d)PING %s (%s): %d data bytes PING %s: %d data bytes stdio inetstdio inet dnsrecvmsg4fl cgsbase %d blk %d >= cgdmin %d; blk + cnt %d > cgdmax %d LARGE FILES UNSUPPORTED ON REVISION 0 FILESYSTEMSSETTING LARGE FILE INDICATOR SET LARGE FILE INDICATORTRYING TO SET FILESIZE TO %llu ON MODE %x FILE I=%llu OWNER=%u MODE=%o SIZE=%llu MTIME=%12.12s %4.4s cannot increase directory list PARTIALLY TRUNCATED INODE I=%lluDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDSCLEAR (CLEARED)-%c flag requires a %s usage: %s [-dfnpy] [-b block#] [-m mode] filesystem Alternate super block location: %d bad mode to -m: %o ** lost+found creation mode %o b:dfm:npystarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system** Phase 1 - Check Blocks and SizesINTERNAL ERROR: dups with -p** Phase 1b - Rescan For More DUPS** Phase 2 - Check Pathnames** Phase 3 - Check Connectivity** Phase 4 - Check Reference Counts** Phase 5 - Check Cyl groups%d files, %d used, %d free %d files missing %d blocks missing The following duplicate blocks remain: %d,The following zero link count inodes remain: %llu, ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW *****EXCESSIVE BAD BLKS I=%llu (SKIPPING)CONTINUEEXCESSIVE DUP BLKS I=%lluuDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%lluINODE I=%llu HAS DTIME=%12.12s %4.4s (CORRECTED)bad size %llu:HOLD BAD BLOCKbad size %llu ndb %d:bad direct addr: %d bad indirect addr: %d LINK COUNT TABLE OVERFLOWINCORRECT BLOCK COUNT I=%llu (%d should be %d)UNKNOWN FILE TYPE I=%lluROOT INODE UNALLOCATEDALLOCATECANNOT ALLOCATE ROOT INODE DUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYFIXBAD STATE %d FOR ROOT INODE DIRECTORY TOO SHORTDIRECTORY %s: LENGTH %lu NOT MULTIPLE OF %dMISSING '..'BAD INODE NUMBER FOR '..'BAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.'CANNOT FIX, FIRST ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '.' BAD TYPE VALUE FOR '..'CANNOT FIX, SECOND ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '..' EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEUNALLOCATEDDUP/BADZERO LENGTH DIRECTORY%s %s %s IS AN EXTRANEOUS HARD LINK TO DIRECTORY (IGNORED)BAD TYPE VALUEBAD STATE %d FOR INODE I=%llu ZERO LENGTHBAD/DUP%u: %2x summary info for cg %d is %d, %d, %d,should be %d, %d, %d SUMMARY INFORMATIONS WRONG FOR CG #%dblk_bitmap:bbmap:BLK(S) MISSING IN BIT MAPS #%dino_bitmap:ibmap:INODE(S) MISSING IN BIT MAPS #%dsummary info bad in superblock: %d, %d should be %d, %d SUPERBLK SUMMARY INFORMATION BADstrdup failedrealloc failedmalloc failed/r%s (%s): UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat rootCan't stat %s %s is not a character device %s: CANNOT FIGURE OUT FILE SYSTEM PARTITION %s: CANNOT READ DISKLABEL %s: NOT LABELED AS A EXT2 FILE SYSTEM (%s) %s: BLOCK SIZE DETERMINED TO BE ZERO BAD SUPER BLOCK: %s MAGIC NUMBER WRONGBAD LOG_BSIZEBAD BLOCKS PER GROUPcompat 0x%08x, incompat 0x%08x, compat_ro 0x%08x INCOMPATIBLE FEATURE BITS IN SUPER BLOCKsuperblock mismatchesoffset %ld, original %ld, alternate %ld VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATECan't stat %s: %s %s is not a character deviceCan't open %s: %s ** %sNO WRITE ACCESS (NO WRITE)cannot allocate space for superblock LOOK FOR ALTERNATE SUPERBLOCKS%s %s %s %s %s %s SEARCH FOR ALTERNATE SUPER-BLOCKFAILED. YOU MUST USE THE-b OPTION TO FSCK_FFS TO SPECIFY THELOCATION OF AN ALTERNATESUPER-BLOCK TO SUPPLY NEEDEDINFORMATION; SEE fsck_ext2fs(8).USING ALTERNATE SUPERBLOCK AT %d state = %d ** F%sile system is clean; not checking ** File system is already clean IMPOSSIBLE RESERVED BLOCK COUNT=%d IN SUPERBLOCKSET TO DEFAULTWRONG FPG=%d (BPG=%d) IN SUPERBLOCKBAD SUMMARY INFORMATIONcannot alloc %u bytes for blockmap cannot alloc %u bytes for statemap cannot alloc %u bytes for typemap cannot alloc %u bytes for lncntp cannot alloc %u bytes for inphead bad file type 0%o cannot allocate buffer pool INTERNAL ERROR: GOT TO reply()%s? no %s? yes %s? [Fyn?] (SALVAGED)SALVAGEUNKNOWN INODESC FIX MODE %d CANNOT %s: BLK %dProgram terminated WRITETHE FOLLOWING SECTORS COULD NOT BE WRITTEN: %lld (%lld), %lld,PARTIALLY WRITING %sZERO'ED BLOCK %d TO DISK UPDATE STANDARD SUPERBLOCKSPanic: lost %d buffers MARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEANcache missed %ld of %ld (%d%%) READTHE FOLLOWING DISK SECTORS COULD NOT BE READ:deadlocked buffer pool %6d %6s usage: %s [-benstuv] [file ...] benstuvTT TTTTTTTTTT,h,h,h8Lcff|g|gККS S(}8ԂDLhl[Tl[ [\`L,Nhopwx8oĖ\d\dn(nmLLLLlHzd8z0(R(R(LO4LO@LO4lLOHLOPLOXXQ`XQhLOtLO|LOLOD,UTTTT TTTT@TTTT|p <@{TbLaLaObKLr]i i@phl\i i<  (48@LT\dhpx          , 0 8 D HP\dpx (4<HT\hlxd|      (08@LX d!p"|#$%&'()*+,-. /0$102<3H4T5`6l7x89:;<=>?@ABCDE F,G8HDIPJ\KhLtMNOPQRSTUVWXYZ[(\4]@^L_Xdhpt       @$0<DLT`dlt| G\pQ  $,\8 $,\8@LT\drandommalformed link-level addressSIOCSIFLLADDRSIOCDIFPARENTSIOCDVNETIDSIOCIFAFDETACHSIOCIFAFATTACHSIOCGIFXFLAGSSIOCSIFXFLAGS[#%d]SIOCG80211WPAPARMSSIOCS80211WPAPARMSSIOCGIFFLAGSSIOCSIFFLAGSSIOCIFDESTROYmedia mode %smediaopt instance %lld"%.*s"0xSIOCGIFGROUPgetifgroups groups:usage: ifconfig [-AaC] [interface] [address_family] [address [dest_address]] [parameters] invalid channel %s: %sSIOCS80211CHANNELprefix %s: %sparent: name too long parent: %s parent: parent too longSIOCSIFPARENTvnetid %s: %sSIOCSVNETIDSIOCGIFMEDIA%s: no link type?only one `instance' command may be issuedmust specify `media' before `instance'media instance %s: %sonly one `mode' command may be issuedmtu %s: %sSIOCSIFLLPRIOSIOCSIFMTUinet6autoconf not allowed for this AFbad hexadecimal digitshexadecimal digits too longstrings too longSIOCS80211NWIDmalformed BSSID: %sSIOCS80211BSSID%s: bad value%s=%o%s=%xInvalid trunk protocol: %sSIOCSTRUNKSIOCSTRUNKDELPORTSIOCSTRUNKPORTSIOCGETVLANSIOCSETVLANvlan tag %s: %s vlan: %d parent interface: %s SIOCG80211ALLCHANS %4s %-8s %s chanfreqproperties %4d %4d MHz passive scan%d: bad prefixlen trunk: trunkproto %s trunkdev %sstrdup trunk id: [(%04X,%s,%04X,%04X,%04X), (%04X,%s,%04X,%04X,%04X)] trunkport %s MASTERSTACKACTIVECOLLECTINGDISTRIBUTINGDISABLED supported trunk protocols: trunkproto %s trunk: trunkdev %s vnetid: name is too long vnetid: none vnetid: %u invalid vlan tag and device specificationinvalid %s %s: %s%s not allowed for the AFvltimepltimeunknown %s media mode: %sinvalid media mode: %sunknown %s media subtype: %sonly one `media' command may be issuedmay not issue `media' after `mode' commandsmay not issue `media' after `mediaopt' commandswpagroupcipher: unknown cipher: %sunknown %s media option: %sonly one `-mediaopt' command may be issuedmay not issue both `media' and `-mediaopt'only one `mediaopt' command may be issuedmay not issue `mediaopt' after `instance'wpaciphers: unknown cipher: %spsk802.1xwpaakms: unknown akm: %swpa1wpa2wpaprotos: unknown protocol: %snwid chan %u bssid %s lladdr %s %u%% %ddBm powersave %uM HT HT-MCS%d %uMESSIBSSCF_POLLABLECF_POLLREQPRIVACYSHORT_PREAMBLEPBCCCHNL_AGILITY SPECTRUM_MGMT QOS SHORT_SLOTTIME APSD RADIO_MEASUREMENTDSSSOFDMDELAYED_B_ACKIMMEDIATE_B_ACK,wpa2,wpa1,wep,802.1xCACHEBSSAUTHASSOCCOLLECT no permission to scanSIOCG80211ALLNODES none restore ieee80211: nwid chan %u bssid %s %u%% %ddBm nwkey persist%d: wpakey wpaprotos %swpa2 wpaakms %s802.1x wpaciphers wpagroupcipher powersave on (%dms sleep)HIDENWIDNOBRIDGEUPBROADCASTDEBUGLOOPBACKPOINTOPOINTNOTRAILERSRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTINET6_NOPRIVACYMPLSWOLAUTOCONF6 rdomain %d metric %lu mtu %lu lladdr %s %cllprio %d status: %s %s: no media types? media: supported media: tunnel: inet%s %s -> %s:%u ttl %dunsetifgroup: group names may not end in a digitunsetifgroup: group name too longSIOCDIFGROUPsetifgroup: group names may not end in a digitsetifgroup: group name too long SIOCAIFGROUPSIOCG80211NWIDwpakey: invalid pre-shared keywpakey: passphrase must be between 8 and 63 characterswpakey: nwid not setwpakey: passphrase hashing failedSIOCS80211WPAPSKpersist:SIOCS80211NWKEY: too many keys.0x%sInvalid WEP key lengthSIOCS80211NWKEYinterface index is already filledgetifaddrscould not determine link local address inet6 %sSIOCGIFDSTADDR_IN6 -> %sSIOCGIFNETMASK_IN6 prefixlen %dSIOCGIFAFLAG_IN6 anycast tentative duplicated detached deprecated autoconf autoconfprivacy scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime infty vltime inet %sSIOCGIFNETMASKSIOCGIFDSTADDR --> %s netmask 0x%xSIOCGIFBRDADDR broadcast %sSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for namesSIOCIFCREATEinvalid carp demotion: %scarpdemoteSIOCSIFGATTRSIOCGIFGATTR carp demote count %d%s: no such interface SIOCGIFGMEMBprintgroupinterface name '%s' too longdestroy'%s' requires argument'%s' requires 2 argumentsSIOCDIFADDRSIOCAIFADDRarp-arpdebug-debugalias-aliasdeletenetmaskmtunwid-nwidbssid-bssidnwkey-nwkeywpa-wpawpaakmswpacipherswpagroupcipherwpaprotoswpakey-wpakey-chanbroadcastvlanvlandev-vlandevgroup-groupautoconf-autoconftrunkport-trunkporttrunkprotoanycast-anycasttentative-tentativeeui64autoconfprivacy-autoconfprivacypowersavepriorityrtlabelnwflagrdomain-inet-inet6descriptiondescrwol-wollink0-link0link1-link1link2-link2mediamediaopt-mediaopt-modeinstanceinstlladdrllprioinetEthernetetherFDDIIEEE802.11TDMCARPautoselectmanual10baseT10baseT/UTP10UTP10base210base2/BNC10BNC10base510base5/AUI10AUI100baseTX100TX100baseFX100FX100baseT4100T4100baseVG100VG100baseT2100T21000baseSX1000SX10baseSTPSTP10STP10baseFLFL10FL1000baseLX1000LX1000baseCX1000CX1000baseT1000T1000baseTX1000TXHomePNA1HPNA110GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10GbaseCX410GCX410GBASE-CX42500baseSX2500SX10GbaseT10GT10GBASE-T10GSFP+Cu10GCuSingle-modeSMFMulti-modeMMFCDDIFH1FH2DS2DS5DS11DS1DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72HT-MCS0HT-MCS1HT-MCS2HT-MCS3HT-MCS4HT-MCS5HT-MCS6HT-MCS7HT-MCS8HT-MCS9HT-MCS10HT-MCS11HT-MCS12HT-MCS13HT-MCS14HT-MCS15HT-MCS16HT-MCS17HT-MCS18HT-MCS19HT-MCS20HT-MCS21HT-MCS22HT-MCS23HT-MCS24HT-MCS25HT-MCS26HT-MCS27HT-MCS28HT-MCS29HT-MCS30HT-MCS31HT-MCS32HT-MCS33HT-MCS34HT-MCS35HT-MCS36HT-MCS37HT-MCS38HT-MCS39HT-MCS40HT-MCS41HT-MCS42HT-MCS43HT-MCS44HT-MCS45HT-MCS46HT-MCS47HT-MCS48HT-MCS49HT-MCS50HT-MCS51HT-MCS52HT-MCS53HT-MCS54HT-MCS55HT-MCS56HT-MCS57HT-MCS58HT-MCS59HT-MCS60HT-MCS61HT-MCS62HT-MCS63HT-MCS64HT-MCS65HT-MCS66HT-MCS67HT-MCS68HT-MCS69HT-MCS70HT-MCS71HT-MCS72HT-MCS73HT-MCS74HT-MCS75HT-MCS76t1t1-amie1e1-g.704e1-amie1-ami-g.704t3t3-m13e3e3-g.751e3-g.832e1-g.704-crc411a11b11gfh11nmasterfull-duplexfdxhalf-duplexhdxflag0flag1flag2loopbackhw-loopbacklooprxpausetxpausedual-attachdasadhochostapibssibss-mastermonitorhdlc-crc16pppframerelay-ansiframerelay-ciscoframerelay-ituno carrierno networkbackupactivekeepalive downroundrobinfailoverlacploadbalancedefaultusegroupwep40tkipccmpwep104 %s: %s: %s: directory causes a cyclefts_readCOLUMNSstdio rpath getpw1ACFHLRSTacdfghiklmnopqrstux%*llu %*qd total %llu %b %e %H:%M:%S %Y%s %*u %-*s %-*s %3d, %3d %*s%*qd %*s ls: %s: %s usage: %s [-1AaCcdFfgHhikLlmnopqRrSsTtux] [file ...] usage: sysctl [-n] name %s=kern.osreleasehw.machinehw.modelhw.producthw.disknameshw.ncpufoundusage: ping6 [-dEefHLmnqv] [-c count] [-h hoplimit] [-I sourceaddr] [-i wait] [-l preload] [-p pattern] [-s packetsize] [-V rtable] [-w maxwait] host Vr TC Flow Plen Nxt Hlim %1x %02x %05x %04x %02x %02x %s->IP6HBH DSTOPT FRAG RTHDR AH ICMP6: type = %d, code = %d ESPUnknown Header(%d) ...No Route to DestinationDestination Administratively UnreachableDestination Unreachable Beyond ScopeDestination Unreachable, Bad Code: %d Packet too big mtu = %d Time exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option Bad code(%d) pointer = 0x%02x Listener QueryListener ReportListener DoneRouter SolicitationRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementRedirectDestination: %s New Target: %sBad ICMP type: %d--- %s ping6 statistics --- +%lld duplicates, %.1lf%% packet losspath MTU for %s is notified. (ignored) nxt %u, len %u (%d bytes), type %u, %d segments, segments unknown, %d left [%d] [%d]%s nxt %u, len %u (%lu bytes) Jumbo Payload Opt: Length %u Router Alert Opt: Type %u Received Opt %u len %lu HbH Options: Dst Options: Routing: failed to get receiving hop limitfailed to get receiving packet informationsignature missing!%d bytes from %s, icmp_seq=%u hlim=%d dst=%s(DUP!)extra (%d bytes %s)sendmsgping6: wrote %s %d chars, ret=%d hoplimit is %s: %sc:dEefHh:I:i:Ll:mNnp:qS:s:V:vw:host %s: %shost resolves to multiple addressesgetaddrinfo failedinvalid source address: %sinvalid source addresssetsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionssetsockopt IP6_MULTICAST_LOOPUnable to allocate packetIPV6_MULTICAST_HOPSsetsockopt(IPV6_USE_MIN_MTU)setsockopt(IPV6_RECVPATHMTU)setsockopt(ICMP6_FILTER)setsockopt(IPV6_RECVRTHDR)can't allocate enough memoryUDP socketUDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)setsockopt(SO_RTABLE)UDP connectgetsocknamesetsockopt(IPV6_RECVPKTINFO)setsockopt(IPV6_RECVHOPLIMIT)PING6 %s (%s --> %s): %d data bytes new path MTU (%d) is notified usage: %s [-aju] [-d dst] [-r seconds] [-t minutes_west] [-z output_zone] %-*s[+format] [[[[[[cc]yy]mm]dd]HH]MM[.SS]] illegal time formatUTCcannot unsetenv TZ-t %s: %sad:jr:ut:z:settimeofday%a %b %e %H:%M:%S %Z %Yspecified date is outside allowed rangeCould not get local time of dayadjtime???date set by %sstdio rpath wpathtoo many argumentsconversion errorusage: %s ioctl SMODEWSMOUSEIO_SCALIBCOORDSmmap/dev/ttyC0open /dev/ttyC0/dev/wsmouseopen /dev/wsmouseWSMOUSEIO_GCALIBCOORDSmouse.scale=%d,%d,%d,%d,%d,%d,%d tt l 4 $ , 8  @@ H |L  T @\ (usage: %s [-23bcdilsTU] [-a maxreadahead] [-g maxgroups] [-I readdirsize] [-o options] [-R retrycnt] [-r readsize] [-t timeout] [-w writesize] [-x retrans] rhost:path node hostname too longno : or @ speccan't resolve address for host %sNFS PortmapCannot MNT RPCbad MNT RPCcan't access %s-2 and -3 are mutually exclusiveillegal -a value %s: %sillegal -g value %s: %sillegal -I value %s: %sconflicting version optionsillegal -R value %s: %sillegal -r value %s: %sillegal -t value %s: %sillegal -w value %s: %sillegal -x value %s: %s23a:bcdD:g:I:iL:lo:PR:r:sTt:w:x:Ubgconndumbtimernfsv3mntudpresvportnfsv2acunused 00000000-0000-0000-0000-000000000000DOS FAT-12 ebd0a0a2-b9e5-4433-87c0-68b6b72699c7XENIX / XENIX /usr DOS FAT-16 ebd0a0a2-b9e5-4433-87c0-68b6b72699c7Extended DOSDOS > 32MB ebd0a0a2-b9e5-4433-87c0-68b6b72699c7NTFS ebd0a0a2-b9e5-4433-87c0-68b6b72699c7AIX fs AIX/Coherent OS/2 Bootmgr Win95 FAT-32ebd0a0a2-b9e5-4433-87c0-68b6b72699c7 Win95 FAT32Lebd0a0a2-b9e5-4433-87c0-68b6b72699c7DOS FAT-16 ebd0a0a2-b9e5-4433-87c0-68b6b72699c7Extended LBAOPUS OS/2 hidden ebd0a0a2-b9e5-4433-87c0-68b6b72699c7Compaq Diag.OS/2 hidden ebd0a0a2-b9e5-4433-87c0-68b6b72699c7OS/2 hidden ebd0a0a2-b9e5-4433-87c0-68b6b72699c7OS/2 hidden ebd0a0a2-b9e5-4433-87c0-68b6b72699c7AST swap Willowtech ThinkPad Recebd0a0a2-b9e5-4433-87c0-68b6b72699c7$NEC DOS 'Win Recoveryde94bba4-06d1-4d40-a16a-bfd50179d6ac Willowsoft 8Theos 9Plan 9 @VENIX 286 ALin/Minux DRBLinuxSwap DRaf9b60a0-1431-4f62-bc68-3311714a69adCLinux DR MQNX 4.2 Pri NQNX 4.2 Sec OQNX 4.2 Ter PDM QDM RCP/M or SysVSDM TOntrack UEZ-Drive VGolden Bow \Priam aSpeedStor cISC, HURD, *dNetWare 2.xxeNetWare 3.xxfNetWare 386 gNovell hNovell iNovell pDiskSecure uPCIX ChromeKernelfe3a2a5d-4f32-41a7-b725-accc3285a309Minix (old) Minix (new) Linux swap 0657fd6d-a4ab-43c4-84e5-0933c84b4f4fLinux files*0fc63daf-8483-4772-8e79-3d69d8477de4OS/2 hidden Linux ext. NT FAT VS NTFS VS Linux LVM e6d6d379-f507-44c2-a23c-238f2a3df928Amoeba FS Amoeba BBT Mylex BSDI NotebookSaveFreeBSD 516e7cb4-6ecf-11d6-8ff8-00022d09712bOpenBSD 824cc7a0-36a8-11e3-890a-952519ad3f61NEXTSTEP MacOS X 55465300-0000-11aa-aa11-00306543ecacNetBSD 516e7cb4-6ecf-11d6-8ff8-00022d09712bMacOS X boot426f6f74-0000-11aa-aa11-00306543ecacMacOS X HFS+48465300-0000-11aa-aa11-00306543ecacBSDI filesy*BSDI swap Solaris 6a85cf4d-1dd2-11b2-99a6-080020736631CTOS DRDOSs FAT12DRDOSs < 32MDRDOSs >=32MHPFS DisbledCPM/C.DOS/C*Dell Maint SpeedStor SpeedStor SpeedStor BeOS/i386 42465331-3ba3-10f1-802a-4861696b7521EFI GPT EFI Sys c12a7328-f81f-11d2-ba4b-00a0c93ec93bSpeedStor DOS 3.3+ SecSpeedStor Xenix BBT [[oƶ~W ۅK%:pl1vb)BQ#5EҎϷ&:q:.Iq֬m\^s| [~&k^j=CWZ|t:7\U?[\Caă<fa&,r8ӱ-7iLպӹw_V~p{-Cq^x܊K\"Ofb&b6T$SLTY ɏq8ŢBOEJʊ) <63Mk~TD{of‚fڢ=*-:Kq A`XΣzF+/,J?J4\$9@:&Yk9̓y%mlZKTcŖ4<ë۩xϿpM7Sq)O/ `H]LŶd, iyl{$dFNez|V[B$Bsz2HC؎BmXZ\R.8\".Q*ؑsp1Jl ΙyiEQ#uNgN[FU>#lv) P@8| XguJIõp,4녗30!֕;/]IxV.ښP>Y$؇'(KޖZ0eUə8_t* *}H0L9uupu}Z34zF_j,u.3 $tL=wY](( =wYq{]=k]fݡM?GBAP~UPQ2Y,dK8g.өjKUV鿾"ULkvzc"s(mȆEq"k&P~}NH)} “"t\"Z ?s)o8$0Zܡ5|kuws3% +Å/6.[AIj|Hr,;Ԃ._|p^I4^iBMd̩\eDVt+:TKiU1PsQƮG~Tu IHnD(N$8z Pi5Tܦ}H6H2R)MK AI*=l+IIʉlǐ])q:,ihh]zB6Tu]HsG .UO8N Rnd*j7DQ-F05r%a +wشxAދ_/ćkq}!.;NI?.$AS|G.f15IJնSFa׋"ym~,§n$GeXa/vra=˼\vB;?X~ a4&GMQnOq}9?;;=< (d!5~|? 򭼓HM%T5zOW`18:>'7_a|6oZz[^ZpdcR(wvr6 AE]\KlbkۜjV8 6;{Z%\ΣSjLAk Ͳ|Ῥ=r/z 5O;<7 Llgd"|_q©u vje53x)HT(ɨ1)F {H::@Fy;I㜗\Q3"}aV+A &=A:7B>jֽ]`&108¢4ٖ a5YģSn}-WR81-W&ZME6C~Jp.o|7 yDNl8p?jw٦CM-$2ҫ7t22(@TB٨'+"yw2p OgWĿ^)g_#En7ϙ2Ujse"_ /_{+g|Ǚ YZJήcoWmJ~ǟ/믵GNX\/Q^ vwqPƕ@=_tKgTp@>.KQև&HN*Pg*eV|"9K&g$yK[q`~Q2VOm\ƺhݾ(׏RA/>Hywqw)tOyω˻_sd^hpΎ;ef[fGV9*I(KUG~1ߛ`%NKϐŏȉ[;A:w~!zvl+,0)dQ5M)ʅag`,A?q\X?蝠O̬?Y? \I6Ţ/?@or^i|<zr'`u ?:=N`t|_?Z!Q++(7+[%G+Ţ?0G8;ri\y‹_BovS=vu2ъ~s!.n{F\KϏ++(qkT2t9USˁN)}fvm$E#S í<*+i1,T+ggc7Ĝ>%dtkg ?a!cqQ9~9h)@zǝ_֋) d2mg cg& J#ɃUOiaU \ē=' 4xi v[_5 NuD94Yׁ>p, `zxHo kmx<wMP479I1__⾠- UbI?bc*\ o(Bv՜%FX%Ii6S*kfn")h@ucT)S_ȳ ?OȞmn^:ﷶUGzmo, qWDx=dW;LǠ6 %?ausage: %s [-egvy] [-i|-u] [-b #] [-c # -h # -s #] [-f mbrfile] [-l # ] disk -b: specify special boot partition block count; requires -i -chs: specify disk geometry; all three must be specified -e: interactively edit MBR or GPT -f: specify non-standard MBR template -g: initialize disk with GPT; requires -i -i: initialize disk with MBR unless -g is also specified -l: specify LBA block count; cannot be used with -chs -u: update MBR code; preserve partition table -v: print the MBR, the Primary GPT and the Secondary GPT -y: do not ask questions `disk' may be of the forms: sd0 or /dev/rsd0c. Cylinder argument %s [1..262144].Head argument %s [1..256].Sector argument %s [1..63].Block argument %s [64..%u].iegpuvf:c:h:s:l:b:ystdio rpath wpath disklabel proc execCan't read sector 0!disk too large (%llu sectors). size truncated.using builtin MBRUnable to read MBR from '%s'Unable to read complete MBR from '%s'Do you wish to write new GPT?Do you wish to write new MBR and partition table?Do you wish to write new MBR?Primary GPT: Not FoundSecondary GPT: MBR:Enter 'help' for informationfdisk:%c%d> Invalid command '%s'. Try 'help'. Aborting changes to current MBR.helpCommand help listShow entire OpenBSD man page for fdiskreinitRe-initialize loaded MBR (to defaults)setpidSet the identifier of a given table entryEdit current drive statseditEdit given table entryflagFlag given table entry as bootableUpdate machine code in loaded MBRSelect extended partition table entry MBRSwap two partition entriesPrint loaded MBR partition tablewriteWrite loaded MBR to diskexitExit edit of current MBR, without saving changesQuit edit of current MBR, saving current changesabortAbort program without saving current changes%s [n] %s [%llu - %llu]: [%llu] %s is out of range: %c%s%c %s is invalid: %c%s%c Partition id ('0' to disable) [01 - FF]: [%X] (? for help) '%s' is not a valid number. '%x' is out of range. %s [%d - %d]: [%d] %s is %s: %s. BytesSectorsKilobytesMegabytesGigabytesTerabytesDisk: %s geometry: %d/%d/%d [%.0f %d-byte geometry: DIOCGPDINFOCan't get disk geometry, please use [-chs] or [-l]to specify.Offset: %lld Signature: 0x%X Start of partition #%d after end! Starting Ending LBA Info: #: id C H S - C H S [ start: size ]-------------------------------------------------------------------------------%c%1d: %.2X %6u %3u %3u - %6u %3u %3u [%12llu:%12.0f%s] %s Warning CHS values out of bounds only saving LBA valuesChoose from the following Partition id values:%02X %s %02X %s %02X %s %02X %s partition number is %s: %s. flag value is %s: %s. Partition %d flag value set to 0x%llx. Partition %d marked active. Machine code updated.partition number is invalid:partition number is %s: %s %d same partition as %d, doing nothing. MBRGPT %s %s MBR contains more than one OpenBSD partition!Write MBR anyway?Writing MBR at offset %lld. error writing MBRWriting GPT.error writing GPTPartition %d is not an extended partition. Loop to offset 0! Not selected.Selected extended partition %d New MBR at offset %lld. could not create guid for partitionPartition %d is disabled. Partition offsetPartition sizepartition namepartition name must be < %d characters Do you wish to edit in CHS mode?BIOS Starting cylinderBIOS Starting headBIOS Starting sectorBIOS Ending cylinderBIOS Ending headBIOS Ending sectorChange disk geometry?BIOS CylindersBIOS HeadsBIOS SectorsgptmbrUnrecognized modifier '%s' Use 'write' to update disk.OpenBSD Area%c%3d: %-36s [%12lld: %12.0f%s] %-36s %-36s #: type [ start: size ] guid name------------------------------------------------------------------------Disk: %s Usable LBA: %llu to %llu [%.0f GUID: 0123456789A:B:CEFGHILRUVabce:f:hilnoqrsuvwxyJ;JJAJBCHDJE KFKG,KH:]]%scontext out of rangecontext %sgrep version %u.%u binarywithout-matchtextUnknown binary-files optionwarning: recursive search of stdinCan't use small fgrep with -wbinary-filesline-bufferedafter-contextbefore-contextextended-regexpfixed-stringsbasic-regexpwith-filenamebyte-offsetregexpno-filenameignore-casefiles-without-matchfiles-with-matchesline-numberquietsilentrecursiveno-messagesrevert-matchword-regexpline-regexpunix-byte-offsetsreallocarrayreallocLine is too big to process--Binary file %s matches usage: %s %s umount [-fv] special | nodeumount -a [-fv] [-h host] [-t type]%s: not currently mounted%s: not a directory or special device%s: unmount from %s afh:t:vtt H @usage: mount_msdos [-9ls] [-g gid] [-m mask] [-o options] [-u uid] special node invalid file mode: %suser is %s: %sgroup is %s: %ssl9u:g:m:o:stat %snot an MSDOS filesystemfsck_%snostart %s %swait %s%s/fsck_%sexec %sCan't set resource limit to max data sizeCan't get resource limit for data size-b %s-l %s: %sInvalid option stringusage: %s [-dfNnpvy] [-b block#] [-l maxparallel] [-T fstype:fsoptions] [-t fstype] [special | node ...] b:dfl:nNpT:t:vy%s: unknown special file or file system.Can't open checklist file: %s/etc/fstabpass %d, name %s BAD DISK NAME %s %s in fstab more than once!disk %s: Unknown pid %lddone %s: %s (%s) = %x %s: %s (%s): EXITED WITH SIGNAL %d THE FOLLOWING FILE SYSTEM%s HAD AN %s UNEXPECTED INCONSISTENCY:%s: %s (%s)%s5MS7) usage: %s [-dfln] [+linenum | +/pattern] name1 name2 ... %s: unknown option "-%c" out of memory! No previous command to substitute fortcgetpgrpTERMlicohcxnxssosgulospccmcdbcti ...Skipping back ...Skipping %sto file %s --More--(Next file: %s)(%d%%)[Press space to continue, 'q' to quit.][Use q or Q to quit]Line too longNo previous regular expression...skipping Pattern not found Pattern not found "%s" line %lld[Not a file] line %lld...back %d page...skipping %d line ***Back*** [Press 'h' for instructions.] ******** %s: Not a text file ******** *** %s: directory *** stdio rpath ttyMORE:::::::::::::::::::::::::::: Most commands optionally preceded by integer argument k. Defaults in brackets. Star (*) indicates argument becomes new default. ------------------------------------------------------------------------------- Display next k lines of text [current screen size] z Display next k lines of text [current screen size]* Display next k lines of text [1]* d or ctrl-D Scroll k lines [current scroll size, initially 11]* q or Q or Exit from more s Skip forward k lines of text [1] f Skip forward k screenfuls of text [1] b or ctrl-B Skip backwards k screenfuls of text [1] ' Go to place where previous search started = Display current line number / Search for kth occurrence of regular expression [1] n Search for kth occurrence of last r.e [1] ! or :! Execute in a subshell v Start up /usr/ucb/vi at current line ctrl-L Redraw screen :n Go to kth next file [1] :p Go to kth previous file [1] :f Display current file name and line number . Repeat previous command ------------------------------------------------------------------------------- TERMCAP/usr/share/misc/termcapTERMPATHHOME.termcap /usr/share/misc/termcapOOPS, )c]!!\cX%`-V%`,i\1Sn6i!XfffffffffffffffffffffffffffffffmRQw }dNfev_gY&V0V$xYMuAAM pywy@so+lRJ'x/C/=M+ O$+malloc %zuuntrusted comment: invalid comment in %s; must start with '%s'comment too longmissing new line after base64 in %sinvalid base64 encoding in %sEdunsupported file %sverification failed: checked against wrong keysignature verification failedSignature Verifieddup failedcan't open %s for %snot a valid file: %smsg too large in %sread from %susage: %1$s -V [-eq] [-x sigfile] -p pubkey -m message verify with /etc/signify//../untrusted path %smust specify pubkeystdio rpath wpath cpath ttyCGSVc:em:np:qs:x:setvbufmust specify sigfile with - message%s.sigpath too longmust specify messagewrite to %susage: %s [-m mode] fifo_name ... usage: %s [-m mode] name b|c major minor %s [-m mode] name p stdio dpathmkfifoinvalid file mode '%s'forbidden mode: %om:invalid device type '%s'invalid major number '%s'major number too large: '%s'invalid minor number '%s'minor number too large: '%s'major or minor number too large (%lu %lu)-1%s:*:%s:%s:%s:%s:%s usage: pwd_mkdb [-c] [-p | -s] [-d directory] [-u username] file %s.orig/etc/spwd.db%s.tmp/etc/pwd.dbat line #%dline %d: superuser override in YP inclusionline %d: wheel override in YP inclusionwrite oldcan't find user in master.passwdbasedir too longusername too longcd:psu:v_shadowcannot find `%s' in the group database, aborting%s must be specified as an absolute path%s: unable to set group to %s%s: unable to make group readablestdio rpath wpath cpath getpw fattr flock__YP!close edpclose dpclose oldfclose/etc/passwd/etc/master.passwdG\pQ 0123456789abcdefUGHRBD M@dCmLS1@2 3cPT l@bconnectedstaticospfis-isbgpbad label: %s is %sinvalid table id: %slabel too longprefixlen is not supported with af %dprefixlen %s is %s%s: link %s; %s: inet %s; %s: inet6 %s; priority is %s: %s sockaddrs: locks: inits: set_metric mtu: %s is %sset_metric expire: %s is %sking bula sez: set_metric with invalid key route to: %s routing message version %d not understoodmessage length mismatch, in packet %d, returned %dRTM_GET: %s (errno %d)destination: %s mask: %s gateway: %s interface: %.*s if address: %s mpls label: %s %s priority: %u (%s) flags: label: %s use mtu expire%8llu %8u%c %8lld%c sockaddrs: [rtm_type %d out of range]: len %d, if# %d, name: %s, link: %s, flags:, metric %d, flags:, if# %d, name %s, what: arrivaldeparture, priority %d, table %u, ifidx %u, pid: %ld, seq %d, errno %d flags: use: %8llu mtu: %8u%c expire: %8lld%cso_dstso_gateso_maskso_ifpso_ifaso_labelso_srcread from routing socketroute-sysctl-estimateactual retrieval of interface tablestdio rpath dnsgot message of size %d on %s128internal error%s: resolved to multiple valuesmpls labels require -in or -out switch%s: not a network%s: bad address%d: bad address familybotched keyword: %susage: %s [-dnqtv] [-T tableid] command [[modifiers] args] commands: add, change, delete, exec, flush, get, monitor, show setrtablemust be root to alter routing table-mplslabel requires -inet or -inet6-in requires -mpls-out requires -mpls-out requires -push, -pop, -swap-pop requires -mpls-push requires -mpls-swap requires -mplsnetmask missingwriting to routing socket%s %s %s: gateway %sentry in userouting table overflownot in tableno such interface %sactual retrieval of routing tableExamining routing table from sysctl(address family %s) write to routing socketgot only %d for rlen %-20.20s donednqtT:vrouting table %dsetsockopt(ROUTE_MSGFILTER)setsockopt(ROUTE_TABLEFILTER)addblackholechangecloningdstexpiregatewaygethopcountifaifpjumbolinkllinfolockrestmpathmplslabelnojumbonostaticpopproto1proto2pushrecvpiperejectrttrttvarsasendpipeshowssthreshRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics or flagsRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_RESOLVE: Route created by cloningRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_IFINFO: iface status changeRTM_IFANNOUNCE: iface arrival/departureRTM_DESYNC: route socket overflowPUSHLOCALPOPSWAPlink#%dillegal prefixlen%s/%d%u/%d%u.%u/%d%u.%u.%u/%d%u.%u.%u.%u/%daf %d: %s(%d) %s%-6s %-*.*s InternetInternet6Encap Protocol Family %d: MPLS%-18s %-5s %-18s %-5s %-5s %-22s SourcePortProtoSA(Address/Proto/Type/Direction)%-9s %-9s %-6s %-18s %-6.6s %5.5s %8.8s %5.5s %4.4s %s In labelOut labelOpGatewayFlagsRefsUseMtuPrioInterface%-*.*s %-*.*s %-6.6s %5.5s %8.8s %5.5s %4.4s %sIfaceLabel%-6.6s %5u %8llu %5u %5s %2d %-5.16ssysctl of routing tableRouting tablesExtra `@' characters in usernames and passwords should be encoded as %%40 KMGTPftp://http://file::/Can't allocate memory for URL decodingerror in base64 encoding <>"#{}|\^~[]`receivedCan't allocate memory to parse URLurl_get: Invalid URL '%s'No `/' after host (use -o): %sNo filename after host (use -o): %sNo filename after directory (use -o): %sCan't allocate memory for proxy host.Can't allocate memory for proxy URL.Malformed proxy URL: %sCan't open file %sCan't open %sCan't allocate memory for transfer bufferWriting %sReading from file(unknown)Trying %s... r+Requesting %sCan't allocate memory for URL encoding%%%02x (via %s) GET %s HTTP/1.0 Proxy-Authorization: Basic %s Host: %s %s%s GET %s HTTP/1.0 Host: %s %s%s GET /%s %s Host: HTTP/1.0Can't allocate memory.[%s]:%sWriting HTTP requestReceiving HTTP replyError retrieving file: %sToo many redirections requestedContent-Length: Location: Relative redirect not supportedCannot allocate memory for URLRedirected to %s Reading from socketRead short file. Auto-login using ftp URLs isn't supported when using $ftp_proxyImproper response from %sftp_proxyhttp_proxyCan't allocate memory for auto-fetch.Invalid URL: %sCan't connect or login to host `%s'*?[]{}NLSTRetrieving %s/%s mget file fetch aborted. http fetch aborted. Forced abort. The connection will be closed. local: %srunique: can't find unique file name. receive aborted waiting for remote to finish abort. acceptsetsockopt TOS (ignored)%c%c%c421 Service not available, remote server has closed connection. Lost control connection for abort.%cABOR No control connection for command.QUITRETRSTOUSTORPASVproxy server does not support third party transfers. No primary connection. PORT %slocal: %s remote: %s use of scoped address can be troublesomeEPSVwrong server: return code must be 229 LPSVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! wrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%uBad family! %c%c%c%d%cparse error! setsockopt (reuse address)setsockopt IP_PORTRANGE (ignored)setsockopt IPV6_PORTRANGE (ignored)listenEPRT |%d|%s|%s|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dlocal: %s remote: %s REST %lldnetin%s: short writeWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sftpgatehttp%s: bad port number `%s'connect to address %sfdopen failed.Connected to %s. usage: %1$s [-o output] ftp://[user:password@]host[:port]/file[/] ... %1$s [-o output] http://host[:port]/file ... %1$s [-o output] file:file ... %1$s [-o output] host:/file[/] ... FTPSERVERPORTFTPMODEpassivegateunknown FTPMODE: %s. Using defaultsgate-ftpFTPSERVERNeither $FTPSERVER nor $GATE_SERVER is defined; disabling gate-ftpdumbemacssukeep alive amount is %s: %sretry amount is %s: %s46AaCc:dD:Eegik:Mmno:pP:r:S:s:tU:vVUser-Agent: OpenBSD ftpstdio rpath dns tty inet fattrstdio rpath wpath cpath dns tty inet fattrnmap: unbalanced brackets. CWD %sCWD command not recognized, trying XCWD. XCWD %scan't get cwdSkipping non-relative filename `%s' a+winternal error: unknown type %d.TYPE %s %sTYPE %susage: %s [ | Using %s mode to transfer files. %s: unknown mode. asciiimage%lld byte%s %s in %.2f seconds (%.2f %sB/s) ETA: %02d:%02d:%02d %-*.*s%s %-*.*s%s %3d%% %3d%% |%.*s%*s|************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************* %5lld %c%c %2d:%02d:%02d --:-- ETA - stalled -%02d:%02d ETAUnable to determine real path of `%s'%s: not foundunable to create temporary file: %sftpXXXXXXXXXXLISTcan't find list of remote files, oops. can't find list of remote files, oops.anonymous%s@Name (%s:%s): Name (%s): USER %sPassword:PASS %sAccount:ACCT %sLogin %s failed.Already connected to %s, use close first. gateserver not defined (shouldn't happen)PASSERVE %sConnected via pass-through server %s non-printstreamSYSTRemote system type is %s. 215 UNIX Type: L8SIZE %sMDTM %s191Y2K warning! Fixed incorrect time-val received from server. %*s %04d%02d%02d%02d%02d%02dCan't convert %s to a time. usage: %s [-dn%sq] dlnpqhalted (with powerdown) by %shalted by %srebooted by %s~SIGTSTP init/etc/rc/dev/consolerevokesetsidopenSIGTERM processesWARNING: some process(es) wouldn't die(can't restart init): tt H @4 l!usage: mount_ffs [-o options] special node filesystem must be mounted read-only; you may need to run fsckreload.@'5"8 n(īЫ'ث Нأ &4)#n$ (08H P \!h̰ а fܰ',8HTd'P'' f'ȱ'رp4p4P0e@(qXptPp4 fp4IJp4Բp4 fp4,(q@p4Xeh(qp4'سe'(8L fd(qtee fԴش'P(q(q('@Xdp'''̵ص ,T'`lx̶ܶ $0<HT`lx̷ط ,8DP\lxĸиܸ $0<HT`lx'ȹԹ ,8DP\htȺԺ(4@LXdp|Ļлܻ $0<HT`lx̼ؼ ,8DP\htȽԽ(4@LXdp|ȾԾ'sCouldn't open '%s': %sCouldn't write contents to '%s': %sShort contents write to '%s' (%zd vs %zu)fchown(fd, %d, %d) of '%s' failed (%s)fchmod(fd, 0x%x) of '%s' failed (%s)short IMSG_WRITE_OPTION_DBwarning: hostname %s contains an underscore which violates RFC 952short IMSG_WRITE_RESOLV_CONF/etc/resolv.confwrite_option_db: imsg_compose: %swrite_option_dbwrite_resolv_conf: imsg_compose: %swrite_resolv_confInvalid option name: '%s'Unable to clone leaseUnable to apply defaultsCannot copy domain name listNo memory to decode domain searchsearch %s no memory for domainnamenameserver %s no memory for nameserver# Generated by %s dhclient no memory for courtesy lineno memory for resolv.conf contentsegresssocket errorno interface in group egress foundioctl SIOCGIFGMEMB: %sget_ifnametoo many interfaces in group egressInterface name too long: %sInterface name too longdaemoncannot forkchdir("/")%s [priv]no memory for priv_ibufpoll error: %simsg_read(priv_ibuf): %sUnable to truncate '%s': %s%s; restarting.RESTART FAILED: '%s': %s%s; exiting bootp; %s { %s interface "%s"; fixed-address %s; next-server %s; filename server-name option %s %s; renew %w %Y/%m/%d %T UTC; rebind %w %Y/%m/%d %T UTC; expire %w %Y/%m/%d %T UTC; } offeredcannot fit offered lease into option dbcannot make offered lease into stringeffectivecannot fit effective lease into option dbcannot make effective lease into stringlease file not opencannot make lease into stringoptions do not fit in DHCPDECLINE packet.options do not fit in DHCPREQUEST packet.options do not fit in DHCPDISCOVER packet.DHCPDECLINE on %saddressinuse: getifaddrs: %sdhcpoffer: no memory to create lease.option-dhcpoffer: unknown option %dBogus data for option %sMissing required parameter %s%s already configured on %sdhcpoffer: no memory for server name.Bogus server name %sdhcpoffer: no memory for filename.bound to %s -- renewal in %lld seconds.mtu size %u < 68: ignoredNo acceptable DHCPOFFERS received.Trying static lease %sTrying recorded lease %sNo working leases in persistent database - sleeping.DHCPDISCOVER on %s - interval %llddhclient cannot be used on %sDHCPREQUEST on %s to %sUnsatisfactory %susage: %s [-d | -q] [-u] [-c file] [-i options] [-L file] [-l file] interface %s: no link .... got link sleeping No memory for rtmmsgroute socket buffer overflow%s, not %s, added to %s%s added to %sActive address (%s) deleted; exiting%s, not %s, deleted from %s%s deleted from %s%s downLLADDR changed; restarting%s departuredno memory for errmsg'%s' is not a regular filec:di:l:L:quifi calloc%s: no such interfacesetting routing table to %u: '%s'socketpair: %sno memory for unpriv_ibufconfig callocclient calloc/dev/nullcannot open %s: %s_dhcpno such user: _dhcp%s.%s/var/db/dhclient.leasesasprintf/etc/resolv.conf.tailCannot open /etc/resolv.conf.tail: %sCannot stat /etc/resolv.conf.tail: %sno memory for resolv.conf.tail contents: %sCouldn't read resolv.conf.tail: %sGot no data from resolv.conf.tailShort read of resolv.conf.tailcan't open and lock %s: %scan't open %s: %ssocket(PF_ROUTE, SOCK_RAW): %ssetsockopt(ROUTE_MSGFILTER): %ssetsockopt(ROUTE_TABLEFILTER): %s/var/empty/setresgidsetgroupsstdio inet dns routestdio inet dns route proc/etc/dhclient.confno memory for reject address!expecting option name.too many options.expecting hex octet.string constant too long.expecting string or hexadecimal dataexpecting ':'.expecting identifier after option keyword.unknown option name.expecting string.option data buffer overflowexpecting signed 32-bit integer.expecting unsigned 32-bit integer.expecting unsigned 16-bit integer.expecting unsigned 8-bit integer.expecting identifier.truefalseoffexpecting boolean.Bad format %c in parse_option_param.out of memory allocating option data.expecting interface name (in quotes).wrong interface name.expecting lease declaration.expecting left brace.no memory for lease.unterminated lease declaration.Obsolete client identifier (%s) in recorded leaseexpecting a statement.unterminated interface declaration.Corrupt lease file - possible data loss!get_rdomain socket: %sCan't create socketioctl(SIOCGIFFLAGS) on %s: %sinterface_link_forceup: SIOCGIFFLAGS failed (%s)interface_link_forceup: SIOCSIFFLAGS DOWN failed (%s)interface_link_forceup: SIOCSIFFLAGS UP failed (%s)%s receive_packet failed: %s%s too many receive_packet failures; exitinggetifaddrs failedpoll: %sdispatch%s; restartingsend_packet: %ssocket(SOCK_RAW): %ssetsockopt(IP_HDRINCL): %ssetsockopt(SO_RTABLE): %s/dev/bpf0Can't open bpf: %sCan't attach interface %s to /dev/bpf0: %sCan't get BPF version: %sKernel BPF version out of range - recompile dhclient!Can't set immediate mode on bpf device: %sCan't set filter-drop mode on bpf device: %sCan't get bpf buffer length: %sCan't allocate %lu bytes for bpf input buffer.Can't install packet filter program: %sCan't install write filter program: %sCannot lock bpfcScoption %s (%d) larger than buffer.option %s has no length field.Can't allocate storage for option %s.Can't expand storage for option %s.DHCPACKDHCPOFFERDHCPNACKBOOTREPLY%s from %s (%s)no memory for info stringTruncated pointer in DHCP Domain Search option.Invalid forward pointer in DHCP Domain Search option compression.Truncated label in DHCP Domain Search option.Domain search list too long.Truncated DHCP Domain Search option.Can't allocate storage for expanded domain-search %s%s/%u %s"'$`\\%cpretty_print_option: bad code %d%s: Excess information in format string: %s%s: no size indicator before A in format string: %s%s: garbage in format string: %s%s: expecting at least %d bytes; got %d%s: expecting only %d bytes: got %d%s: expecting %d bytes: got %d%huUnexpected format code %ceof in string constantstring constant too longtoken larger than internal bufferappendbackoff-cutoffbootpdenyethernetfixed-addresshardwareignoreinitial-intervallink-timeoutmediumnext-serverprependrebindrenewrequireretryselect-timeoutsendserver-namesupersedetimeout%s line %d: %s%*c^ %s: msgbuf_write: %sRTM_DELETE write: %sshort RTM_DELETE write (%zd) DHCLIENT DHCLIENT %dcreating route label: %screating route label: label too long (%d vs %zu)default route socket: %sRTM_GET of default route: %sget default route read: %sno data from default route readdefault route read rtm: %ssendhup: imsg_compose: %ssendhupadd_address: imsg_compose: %sadd_addressset_interface_mtu: imsg_compose: %sset_interface_mtudelete_address: imsg_compose: %sdelete_addressadd_route: imsg_compose: %sadd_routeflush_routes: imsg_compose: %sflush_routessocket open failed: %sSIOCAIFADDR failed (%s): %sSIOCDIFADDR failed (%s): %sSIOCSIFMTU failed (%d): %sdelete_addresses getifaddrs: %sRouting Socket open failed: %sfailed to add route (%s/%s via %s/%s): %ssysctl size of routes:routes buf realloc:sysctl retrieval of routes:route cleanup failed - %s %s (msize=%zu)opening socket to flush routes: %s%d bad IP checksums seen in %d packets%d udp packets in %d too long - dropped%d bad udp checksums in %d packetspadsubnet-masktime-offsetroutersIAtime-serversien116-name-serversdomain-name-serverslog-serverscookie-serverslpr-serversimpress-serversresource-location-servershost-nameboot-sizemerit-dumpdomain-nameswap-serverroot-pathextensions-pathip-forwardingnon-local-source-routingpolicy-filterIIAmax-dgram-reassemblydefault-ip-ttlpath-mtu-aging-timeoutpath-mtu-plateau-tableSAinterface-mtuall-subnets-localbroadcast-addressperform-mask-discoverymask-supplierrouter-discoveryrouter-solicitation-addressstatic-routestrailer-encapsulationarp-cache-timeoutieee802-3-encapsulationdefault-tcp-ttltcp-keepalive-intervaltcp-keepalive-garbagenis-domainnis-serversntp-serversvendor-encapsulated-optionsnetbios-name-serversnetbios-dd-servernetbios-node-typenetbios-scopefont-serversx-display-managerdhcp-requested-addressdhcp-lease-timedhcp-option-overloaddhcp-message-typedhcp-server-identifierdhcp-parameter-request-listBAdhcp-messagedhcp-max-message-sizedhcp-renewal-timedhcp-rebinding-timedhcp-class-identifierdhcp-client-identifieroption-62option-63nisplus-domainnisplus-serverstftp-server-namebootfile-namemobile-ip-home-agentsmtp-serverpop-servernntp-serverwww-serverfinger-serverirc-serverstreettalk-serverstreettalk-directory-assistance-serveruser-classoption-78option-79option-80option-81relay-agent-informationoption-83option-84nds-serversnds-tree-namends-contextoption-88option-89option-90option-91option-92option-93option-94option-95option-96option-97option-98option-99option-100option-101option-102option-103option-104option-105option-106option-107option-108option-109option-110option-111option-112option-113option-114option-115option-116option-117option-118domain-searchoption-120classless-static-routesCIAoption-122option-123option-124option-125option-126option-127option-128option-129option-130option-131option-132option-133option-134option-135option-136option-137option-138option-139option-140option-141option-142option-143tftp-config-fileoption-145option-146option-147option-148option-149voip-configuration-serveroption-151option-152option-153option-154option-155option-156option-157option-158option-159option-160option-161option-162option-163option-164option-165option-166option-167option-168option-169option-170option-171option-172option-173option-174option-175option-176option-177option-178option-179option-180option-181option-182option-183option-184option-185option-186option-187option-188option-189option-190option-191option-192option-193option-194option-195option-196option-197option-198option-199option-200option-201option-202option-203option-204option-205option-206option-207option-208option-209option-210option-211option-212option-213option-214option-215option-216option-217option-218option-219option-220option-221option-222option-223option-224option-225option-226option-227option-228option-229option-230option-231option-232option-233option-234option-235option-236option-237option-238option-239option-240option-241option-242option-243option-244option-245option-246option-247option-248classless-ms-static-routesoption-250option-251autoproxy-scriptoption-253option-254option-endexpecting semicolon.time string too longinvalid time string%w %Y/%m/%d %T UTC%w %Y/%m/%d %T%u %Y/%m/%d %Tunparseable time stringtime could not be representedexpecting unsigned 32-bit decimal value.expecting CIDR subnet.expecting '/'.Expecting CIDR prefix length.expecting 'ethernet'.expecting '.'.expecting decimal octet.filename must be a stringno memory for string %s.dispatch_imsg: imsg_get failure: %sbad IMSG_DELETE_ADDRESSbad IMSG_ADD_ADDRESSbad IMSG_FLUSH_ROUTESbad IMSG_ADD_ROUTEbad IMSG_SET_INTERFACE_MTUbad IMSG_HUPreceived unknown message, code %uusage: %s [-] [-s] [-p string] [file] cannot close temp fileinvalid address/tmp/ed.XXXXXXXXXXw+cannot open temp filecannot seek temp filecannot write temp filecannot read temp fileunexpected end-of-file& no previous commandinvalid pattern delimiter%d \  \abfnrtv\cannot read stdincannot open output filecannot write filecannot close output filecannot open input filecannot read input filenewline inserted newline appended cannot close input fileed.hup/ed.hupno current filenameinvalid filenamefilename too longnumber out of rangeno matchinvalid mark characterinvalid command suffixunexpected addressunexpected command suffixinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutioncrypt unavailablestdio rpath wpath cpath proc exec ttycrypt unavailable ? p:sx ? interrupt? warning: file modifiedscript, line %d: %s no previous patternunbalanced brackets ([])trailing backslash (\)infinite substitution loopnothing to undo%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).HLPRfiprstdio rpath wpath cpath fattrthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too longusage: %s [-fip] [-R [-H | -L | -P]] source target %s [-fip] [-R [-H | -L | -P]] source ... directory update times: %schown: %schmod: %schflags: %sunlink: %smknod: %smkfifo: %sreadlink: %ssymlink: %soverwrite %s? 08<@`pĐ\x|      A@!  @a`10  @`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O @@ !1Aa  0@` #+3;CScs  Vusage: %s [-123456789cdf%sh%slNnOqrt%sv] [-b bits] [-o filename] [-S suffix] %*s [file ...] usage: %s [-cfh%slNnqrt%sv] [-o filename] [file ...] usage: %s [-f%shqr] [file ...] OK %4.1f%% -- replaced with %s %lld bytes in, %lld bytes out method crc date time compressed uncompressed ratio uncompressed_name%-7.7s %08x %s %10lld %10lld %4.1f%% %s %10lld %10lld %4.1f%% (totals) .-_tgztazfchown: %sfchmod: %sfchflags: %sfutimens: %scompression not supported%s: won't read compressed data from terminal%s: unrecognized file formatcrc errorstdio rpath wpath cpath fattr chownzcatzipunknown program nameGZIPoption -a is ignored on this systemillegal bit count -- %s-o argument is too long-o option may only be used with a single input filemay not mix -o, -c, or -t options%s is a directory: ignored: unchanged%s not a regular file%s%s already has %s suffix -- unchanged%s: unknown suffix: ignored%s%s: name too long%s: input: %sdeflate.gz123456789ab:cdfhLlNnOo:qrS:tVvcfhLlNno:qrtVvfhqrgzz1.2.3need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible versionowner[:group]usage: %s [-h] [-R [-H | -L | -P]] %s file ... %s [-h] [-R [-H | -L | -P]] :group file ... HLPRXfghorstuwxthe -R and -h options may not be specified together.stdio rpath fattrinvalid flags: %sinvalid flag: %susage: %s [-g group,group,...] [-u user] newroot [command] g:u:no such user `%s'unable to get login class for `%s'too many supplementary groups providedno such group `%s'setusercontextsetuid4fl~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@%lld %s I=%llubad size: blk %lld, offset %lld, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock.fs_fpg %d cannot allocate memory for inode cache cannot increase directory listbad inode number %llu to nextinode %llu cannot alloc %zu bytes to extend inoinfo CG %d: BAD MAGIC NUMBER %lld files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %lld files missing %lld blocks missing usage: %s [-fnpy] [-b block#] [-c level] [-m mode] filesystem conversion levelcannot do level %d conversion dfpnNyYb:c:m:EXCESSIVE DUP BLKS I=%llucannot alloc %zu bytes for inoinfobad direct addr: %lld bad indirect addr: %lld INCORRECT BLOCK COUNT I=%llu (%lld should be %lld)too many inodes %llu, or out of memory phase 1, inode %llu/%lluphase 1b, inode %llu/%llu%s %s: LENGTH %zu NOT MULTIPLE of %d%s %s: LENGTH %zu NOT MULTIPLE OF %dphase 2, directory %d/%dphase 2, parent directory %d/%d (REMOVED)phase 3, directory %d/%ldphase 4, inode %llu/%lluDELETING CLUSTERING MAPS DELETE CLUSTERING MAPSCREATCANNOT %s CLUSTER MAPS CREATE CLUSTER MAPS%sING CLUSTER MAPS UNKNOWN ROTATIONAL TABLE FORMAT %d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %lld MARKED FREE ALLOCATED FRAG %lld MARKED FREE BLK(S) MISSING IN BIT MAPSphase 5, cg %d/%d%s: NOT LABELED AS A BSD FILE SYSTEM (%s) NCG OUT OF RANGECPG OUT OF RANGENCYL LESS THAN NCG*CPGSBSIZE PREPOSTEROUSLY LARGEILLEGAL BLOCK SIZE IN SUPERBLOCKILLEGAL FRAGMENT SIZE IN SUPERBLOCKoffset %d, original %ld, alternate %ld VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN LAST ALTERNATEstdio rpath wpath getpw disklabelINFORMATION; SEE fsck_ffs(8).clean = %d UNDEFINED OPTIMIZATION IN SUPERBLOCKIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE NPSECT=%d IN SUPERBLOCK (FIXED)INCORRECT BMASK=%x IN SUPERBLOCKINCORRECT FMASK=%x IN SUPERBLOCKINCORRECT BSHIFT=%d IN SUPERBLOCKINCORRECT FSHIFT=%d IN SUPERBLOCKFormat of filesystem is too old. Must update to modern format using a version of fsck from before release 5.0 with the command ``fsck -c 2'' INCORRECT MAXFILESIZE=%llu IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%lx IN SUPERBLOCKINCORRECT QFMASK=%lx IN SUPERBLOCKINCONSISTENT CGSIZE=%d INCONSISTENT INOPB=%d INCONSISTENT NINDIR=%d cannot alloc %u bytes for cylinder group summary area cannot alloc %zu bytes for blockmap cannot alloc %zu bytes for inostathead cannot alloc %zu bytes for inpsort cannot alloc %zu bytes for inphead inoinfo: inumber %llu out of rangeCANNOT %s: BLK %lldWRITING %sZERO'ED BLOCK %lld TO DISK UPDATE STANDARD SUPERBLOCK   delete %d: %sinsert %d: %ssession database close: %ssession database open: %scannot get kernel security level: %scannot change kernel security level from %d to %d: %sfatal signal: %scan't parse getty for port %scan't allocate windowcan't parse window for port %sport %s changed utmp index from %d to %dcan't fork for window system on port %s: %msetsid failed (window) %mcan't exec window system '%s' for port %s: %mcan't fork for getty on port %s: %mgetty repeating too quickly on port %s, sleepingcan't exec getty '%s' for port %s: %msome processes would not die; ps axl advisedcan't open %s: %mcan't get %s for controlling terminal: %mcannot disable lid suspendcan't exec %s for %s %s: %m/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/bincan't exec %s for single user: %mcan't fork single-user shell, trying againwait for single-user shell failed: %m; restartinginit: shell stopped, restarting single user shell terminated.single user shell terminated, restartingautobootcan't exec %s for %s: %mcan't fork for %s on %s: %mwait for %s on %s failed: %m; going to single user modeinit: %s on %s stopped, restarting %s on %s terminated abnormally, going to single user modeinit: %s init: already running initial setsid() failed: %msetlogin() failed: %munrecognized flag '-%c'sfignoring excess argumentsusage: %s [-b block-size] [-c fragments-per-cylinder-group] [-e maxbpg] [-f frag-size] [-i bytes] [-m free-space] [-o options] [-P file] [-s size] special node usage: %s [-Nq] [-b block-size] [-c fragments-per-cylinder-group] [-e maxbpg] [-f frag-size] [-g avgfilesize] [-h avgfpdir] [-i bytes] [-m free-space] [-O filesystem-format] [-o optimization] [-S sector-size] [-s size] [-T disktype] [-t fstype] special ioctl (WDINFO)%s: can't rewrite disk labelcan't get physmeminsane maxpartitions value %dP:T:b:c:e:f:i:m:o:s:NO:S:T:b:c:e:f:g:h:i:m:o:qs:t:%s: invalid ffs versionsector size invalid: %sblock size is %s: %sfragments per cylinder group is %s: %sblocks per file in a cylinder group is %s: %sfragment size is %s: %saverage file size is %s: %saverage files per dir is %s: %sbytes per inode is %s: %sfree space %% is %s: %s%s: unknown optimization preference: use `space' or `time'.file system size invalid: %snewfs_%s%s/newfs_%s%s not found%s: getmntinfo: %s%s: not a character-special deviceempty partition name supplied%s: can't figure out file system partitionstdio disklabel tty%s: `%c' partition is unavailable%s: `%c' partition overlaps boot program%s: no default sector size%s: maximum file system size on the `%c' partition is %llu sectorswarning: changing optimization to space because minfree is less than %d%% setblock bad fs_frag %dclrblock bad fs_frag %disblock bad fs_frag %dwtfs: write error on block %lldrdfs: read error on block %lldcg 0: bad magic numberfirst cylinder group ran out of spaceinternal error: can't find block in cyl 0ilog2: %d is not a power of 2 fsinit: inode value %llu out of rangeinode table does not fit in cylinder grouppanic: cylinder group too big: %d > %dpreposterous size %lld, max is %dpreposterous size %lld, max is %lldblock size must be a power of 2, not %dfragment size must be a power of 2, not %dfragment size %d is too small, minimum is %lldblock size %d is too small, minimum is %dblock size %d is too large, maximum is %dblock size (%d) cannot be smaller than fragment size (%d)fragment size %d is too small, minimum with block size %d is %ddensity reduced from %d to %d bytes per inodecan't honour -c: minimum is %dfile system size %jd < minimum size of %d fragmentsreduced number of fragments per cylinder group from %d to %d to enlarge last cylinder groupcalloc failed%s: %.1fMB in %jd sectors of %lld bytes %d cylinder groups of %.2fMB, %d blocks, %d inodes each can't get rlimitwarning: fsck_ffs will need %lluMB; min(ulimit -dH,physmem) is %lluMBsuper-block backups (for fsck -b #) at:cannot allocate I/O bufferfsinit1 failedfsinit2 failed%s: initializing cg %ld/%d usage: %s [-dfiPRr] file ... "/" may not be removed"." and ".." may not be removedremove %s? override %s%s%s/%s for %s? %s (inode %llu): not overwritten due to multiple links%s: malloc%s: is a directorydfiPRrstdio rpath wpath cpath getpwstdio rpath cpath getpwusage: %s [-t] device usage: %s [-f device] command [count] %d: unknown tape drive type %s tape drive, residual=%d erblocksize: %d (%d) density: %d (%d) ioctl MTIOCGETf:no remote support%s: unknown command%s: illegal countbsfbsrdensityeomfsffsrofflinerewindrewofflretensionweofWriteProtectMounted76543210usage: %s [-p] [-m mode] directory ... m:pstdio rpath cpath fattr\ can not be used as a string delimiternewline can not be used as a string delimiterwhitespace after %sundefined label '%s'RE error: %sunterminated regular expressionexpected context addressunexpected EOF (pending }'s)0123456789/\$command expectedinvalid command code %ccommand %c expects up to %d address(es), found %dunexpected }extra characters at the end of %c commandcommand %c expects \ followed by textextra characters after \ at the end of %c commandfilename expectedw commandread commandbranchempty labelduplicate label '%s'substitute pattern can not be delimited by newline or backslashunterminated substitute pattern123456789\%c not defined in the REunescaped newline inside substitute patternunterminated substitute in regular expressionmore than one number or 'g' in substitute flagsnumber in substitute flags out of rangewfile too longno wfile specifiedbad flag in substitute command: '%c'transform pattern can not be delimited by newline or backslashunterminated transform source stringunterminated transform target stringtransform strings are not the same lengthextra text at the end of a transform commandunused label '%s'-i may not be used with stdinrename()%s: %s %sin-place editing onlyworks for regular files%s/sedXXXXXXXXXX ..."usage: sed [-aEnru] [-i[extension]] command [file ...] sed [-aEnru] [-e command] [-f command_file] [-i[extension]] [file ...] Eae:f:i::nrupledge: %sstdout: %ssed: %lu: %s: first RE may not be empty\ %03o\%d not defined in the RE\abfrtv\O df h` 9` tT  V \D L 4G M `` he T T 8N 0\ K K pC \ `j d h\u pj |\u x k v j v Xt P r w ~ y  j  ؀ ls j $41-a-b-c-d -e-f-G-g-h -H -k-L -n-O-o-p -r-s-S -t-u-w-x-z===!=<>-eq-ne-gt-ge-lt -le!-ef"-nt#-ot$,dIltfcdslmnp L=P  4p H X d |   X ,  ; \  \  <  <  (P 8 D L Xȼ h |   0  0    @  $p @ P d l̻ x   `0 0 l t | D p ++--==!== *= /= %= += -= <<= >>= &= ^= |= <<>><=>=<>&& || */%+-&^|? , ~!():xC%%%IFS= ${PS2=> } ${PS3=#? } ${PS4=+ }&0&P)a\)h)cp)\|))e)))i)k)l)Xm)C n)f))!b)u)**pr\<s*h(*v\(0*8*D*T*d*x$-,-4-<-@- H- , D P- X-`-m.5d-{h-}dl-p-t-x-|-- Q V G [ ^ ]]<>!let||&&() 000ؠ 0 ^ ^ %000000xC@(#)PD KSH v5.2.14 99/07/13.2 AAA  Q AA A QBafree: %p not present in area %punable to allocate memorylmmissing options argumentmissing name argument%s: is not an identifierc_getopts: no argvarguments changed since last callOPTARGbad signal `%s'usage: kill [-s signame | -signum | -signame] { job | pid | pgrp } ... kill -l [exit_status ...] %s: arguments must be jobs or process IDs%*d %*s %s%*d %*d %sjob control not enabled%%lpnzno argumentsadtdprtUxalias: -r flag can only be used with -t and without arguments alias %s alias not found L#R#UZ#fi#lprtuxonly -t, -u and -x options may be used with -ffunction %s %T %s() %T %s: not identifiertypeset -i -x -r -t -L%d -R%d -Z -l -u -U exportreadonly%s[%d]pvpvV is a reserved wordexported is an %salias for alias %s= is an exported traced undefined (autoload from %s) function special is a%s shell builtin is a tracked %salias for not found%s is *GOK*Rnprsu,-n-p: %s-u: %s: %sLPcan't get current directory - %srestricted shell - can't cdPWDOLDPWDno home directory (HOME not set)no OLDPWDdon't know current directoryCDPATH%s: bad directory+alias+cd+command*=export+fc+getopts+jobs+killletpwd*=readonly=typeset+unaliaswhence+bg+fgunalias-tacan't suspend a login shelltime: -%s unknown optiontime: -%s requires an argument:p%s%*lld.%02ld%s%s%*lldm%02lld.%02lds%sreal real user sys user system fv%s is read only%s: cannot %s%s: can only %s %d level(s)%s: bad numbertrap -- bad signal %sprsu,ugorwx%#3.3o augo=+-rwxugoXsbad masknothing to shift*=.*=:[*=break=builtin*=continue*=eval*=exec*=exit+false*=return*=set*=shift*=times*=trap+=wait+readtest+trueulimit+umask*=unsetsuspendmissing closing parenmissing argumentexpression expectedmissing second argumentmissing expression operatorunexpected operator/operandinternal error: unknown opmissing ]-t-aunlimited unlimitedinvalid limit: %s-%c exceeds allowable limitbad -%c limit: %susage: ulimit [-acdfHlmnpSst] [value]ulimit: %c%-20s time(cpu-seconds)file(blocks)coredump(blocks)data(kbytes)stack(kbytes)lockedmem(kbytes)memory(kbytes)nofiles(descriptors)IFS!"#$&'()*:;<=>?[\]`{|};|&()`+@!fileglob: substitute errorFPATHLINES nothing to yank yank something firstduplicate binding for %sPOSIX%s = %s %s = '%s' cannot bind, not a ttyauto-insert%s: no such functioninvalid return code I-search: beginning-of-historycomplete-commandcomplete-filecompletedelete-char-backwarddelete-word-backwarddelete-char-forwarddelete-word-forwardkill-lineredrawend-of-historyeot-or-deletegoto-historymacro-stringkill-to-eolkill-regionlist-commandlist-filequoteyank-popbackward-charbeginning-of-linebackward-wordend-of-lineforward-charforward-wordnewlinedown-historynewline-and-nextno-opup-historyprev-hist-wordsearch-character-forwardsearch-character-backwardsearch-historyset-mark-commandstuffstuff-resettranspose-charsexchange-point-and-markcomplete-listexpand-filecapitalize-worddowncase-wordupcase-wordset-argcomment*+?@! substituteexpand(NULL)%Rfunny $() command: %s%s: cannot open $(<) input%s: parameter not set%S%s: bad substitutionparameter null or not set%*d) %sdbteste_error: %s (offset %d)shcomexec: %shere document missingcan't %s temporary file %s: %sherein: yylexerror writing %s: %sPS4%s: restricteddupcannot %s %s: %scould not finish (dup) redirection %s: %scoprocess already existsPS3EXECSHELL%s: %s: %sbuiltin: %s: not a builtincommand -p: restricted%s: can't find function definition file - %s%s: can't find function definition file%s: can't open function definition file %s - %s%s: function not defined by %sCFUNC %d%s: cannot execute - %s-rend of expression%s: unexpected `%s'%s: bad number `%s'%s: expression recurses on parameter `%s'%s: %s requires lvalue%s: %s applied to read only variablemissing )zero divisormissing :HISTFILE%s.%dno history (yet)%s: not in history%s: invalid rangehistory functions not available-%c%se:glnrs0,1,2,3,4,5,6,7,8,9,can't use -e, -l, -n, -r with -s (-e -)substitution failedcan't use -l, -n with -e-16%.*s cannot create temp file %s - %serror writing temporary file - %s${FCEDIT:-/bin/ed} $_cannot open temp file %serror reading temp file %s - %sno coprocess%s/shXXXXXXXXbad file descriptorfd not open for readingfd not open for writingillegal file descriptor name%s[%d]: internal error: shl_stdout not validtoo many files open in shellcan't create pipe - try again RunningDoneDone (%d)[%d] %c %5d (core dumped)%s%s %-20s %s%s%s%s%5d %-20s %s%s %s%sremove_job: job not found (%s)notifyj_async: job not startedj_async: bad nzombie (%d)zombiejobsstopped and runningYou have %s%s%s jobs j_waitj: tcsetpgrp(%d, %d) failed: %sjob not job-controlled[%d] | 1st tcsetpgrp(%d, %d) failed: %sfg: 2nd tcsetpgrp(%d, %d) failed: %scannot continue job %s: %sjw:resumejw:waitforwaitlast: no last jobwaitlast: not startedjw:waitlastexchild: XPIPEI and no last_job - pid %dfork failedcannot fork - try againchildexchild: execute() returned[%d]jw:last procj_init: getpgrp() failed: %sj_init: tcgetpgrp() failed: %sj_init: setpgid() failed: %sj_init: tcsetpgrp() failed: %swarning: won't have full job controlj_suspend: tcsetpgrp() failed: %sj_suspend: setpgid() failed: %scheck_job: job started (flags 0x%x)checkjobno such jobambiguousargument must be %job or process id%a %b %d%l:%M:%S%r~/%sPS1\$PS2missing ] no closing quote here document `%s' unclosed MAILyou have mail in $_shell: %dUse `exit' to leave ksh include: %drshrkshrpdkshpdrkshstdio rpath wpath cpath fattr flock getpw proc exec ttySH_VERSIONPPIDUSER$ -c requires an argumentCannot determine current working directory/etc/profile$HOME/.profile/etc/suid_profileENVtypesetKSH_VERSION-xOPTIND=1evaltypeset -i RANDOM MAILCHECK="${MAILCHECK-600}" SECONDS="${SECONDS-0}" TMOUT="${TMOUT-0}"hash=alias -ttype=whence -vstop=kill -STOPautoload=typeset -fufunctions=typeset -fhistory=fc -linteger=typeset -inohup=nohup local=typesetr=fc -slogin=exec login-tUccmailmakeprviwho |&;<>()*@#!$-? =-+?#% "#$&'()*;<>?[\`|0123456789ABCDEF%-*s%*s'\'\'%s%s-%c: unknown option%s%s-`%c' requires argument%-*s %sA:o;sCurrent option settings %co %s%s: bad optionparse_args: `%c'allexportbraceexpandbgnicecsh-historyemacs-usemetaerrexitgmacsignoreeofinteractivekeywordloginmarkdirsnoclobbernoglobnohupnolognounsetphysicalposixprivilegedtrackallverbosevirawvi-show8vi-tabcompletevi-esccompletextracealnumalphablankcntrldigitgraphlowerpunctupperxdigitshf_flush: no fdshf_emptybuf: no fdshf_write: flags %xshf_write: nbytes %dshf_putchar: flags %xshf_putchar: no fd0123456789abcdef(null %s)shf_ungetc: flags %xshf_fillbuf: no fdshf_getchar: flags %xshf_getse: flags %xshf_read: flags %xshf_read: bsize %dshf_sopen: flags 0x%xshf_snprintf: buf %lx, bsize %dshf_reopen: missing read/writeshf_reopen: bad shf/buf/bsizeshf_fdopen: missing read/writeunexpectedunmatchedsyntax error: unexpected EOF ?%dsyntax error: `%s' %s too many <<'s too many redirections for%s: bad identifier %s: invalid function name thenelseelifficaseesacwhileuntildo{}[[&&||;;((|&too many varssetexecsig: unset signal %d(%s)ERRError handlerEXITtimed out waiting for inputSIGwdscan: unknown char 0x%x (carrying on)%S #no-vars# #no-args# ( %T) %T| %T%;%T%s %T %S ]] select %s for %s in %;do%N%T%;done case %S in%N(%S%c%;%T%N;;%Nesac if %Tthen%N%Telif %Telse%;%T%;fi %s %T%;do{%;%T%;} %T|& %T& function %s %T%s() %Ttime %T< <<- << >> >| <> <&>&No controlling tty (open /dev/tty: %s)Can't find tty file descriptorj_ttyinit: dup of tty fd failed: %s%0*s%.*s%*s%.*s%s: subscript %ld out of range%s: is read onlysetstr: %s=%s: assigning to self0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789abcdefghijklmnopqrstuvwxyzOPTINDPOSIXLY_CORRECTHISTSIZEMAILCHECKMAILPATHRANDOMSECONDSTMOUTLINENOM-grabhist: bad history arrayy$%s %dfc -e ${VISUAL:-${EDITOR:-vi}} --blowfish,%spref too longunable to get login class `%s'localciphercan't generate hashusage: %s [-b rounds] [-c class] [-p | string] stdio rpath wpath ttyrounds is %s: %spb:c:Enter string: getpassInvalid keyInvalid saltToo few rounds: %dinvalid passphrase filecan't stat passphrase filepassphrase file must be owned by rootpassphrase file has the wrong permissionscan't read passphrase fileinvalid passphrase lengthunable to read passphraseRe-type passphrase: Passphrases did not matchpbkdf2 failedinvalid KDF infoinvalid KDF hintKDF hint has invalid sizeunknown KDF type %dnumber of KDF rounds too low: %dDIOCINQ%s: <%s, %s, %s>, serial %s invalid flags listinvalid flag %sinvalid device listcould not open %scould not stat %stoo many devices on device listduplicate device in listNew passphrase: unknown errorBIOCDISCIPLINEOld passphrase: BIOCDELETERAIDno devices specifiednot enough memory for dev_t listunsupported raid levelnot enough disksnot exactly one partitionioctlPassphrase: BIOCCREATERAID/dev/bioCan't locate %s device via %sBIOCBLINKBIOCINQBIOCVOLinvalid alarm function: %sBIOCALARMdisabledalarm is currently %s %-11s %-10s %14s %-8s VolumeStatusSizeDevice %d%% done %u secondsScrubbingInvalidOnlineOfflineDegradedBuildingRebuildWTWB%s %u%14llu%11s %-10s %14s %-7s CRYPTO%s%s %11s %-10s %14s %-7s CONCAT%s%s %11s %-10s %14s %-7s RAID%u%s%s %s BIOCDISKFailedHot spareUnused %3u%14skey disk%u:%u.%unoenclunknown serial patrol %d%% done%11s %-10s %14s %-7s %-6s <%s> %11s %-10s %14s %-7s %-6s '%s'%s%s stainvalid patrol function: %sPatrol %s: %sBIOCPATROL interval=%d next=%dabortedreadypatrol mode: %s%s patrol status: %s target not specifiedTarget %s: %sDisk %s is not in an enclosureDisk %s does not existinvalid device %sBIOCSETSTATEusage: %s [-hiqv] [-a alarm-function] [-b channel:target[.lun]] [-H channel:target[.lun]] [-R device | channel:target[.lun]] [-t patrol-function] [-u channel:target[.lun]] device %s [-dhiPqsv] [-C flag[,flag,...]] [-c raidlevel] [-k keydisk] [-l special[,special,...]] [-O device | channel:target[.lun]] [-p passfile] [-R device | channel:target[.lun]] [-r rounds] device Invalid RAID levelNumber of rounds is %s: %sa:b:C:c:dH:hik:l:O:Pp:qr:R:st:u:vneed deviceneed -c parameterneed -l parametermust use bio deviceusage: %s seconds usage: %s [-fi] source target %s [-fi] source ... directory cp failedrm failed%s: remove%s: set owner/group; not setting setuid/setgid%s: set owner/group%s: set mode%s: set flags%s: set timesrename %s to %scannot resolve %scannot rename a mount pointcan't remove %s%s: destination pathname too longusage: %s [-s] [-M core] [-N system] sM:N:sysctl: KERN_MSGBUFSIZEcouldn't allocate space for buffer datasysctl: KERN_MSGBUFusage: %s [-s] [name-of-host] sethostnamegethostname/etc/networks"(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDlɼg j;ʄ 08`upW<  upWJI`[~ [~upW`@@<@TU pWqpbpWqqAypWpW*`7pW*`7` sAypWpW~H'pW~H'a )tSAypWXg#pWTO$pWTO$b qAypWP /pWaq'pWaq'c AypW 7zpW?$zpWzrd MAypW:ypW:zpW:qe ICzpW$} zpW$} zpW f 76pW:pW;pW; .fhpW~H'pW:'pW:'g pWEcE pWגpWÈ!    PLjApWJ pWNpWNh X ` ( 0 8 @ H P p PVpWOu pWNpWD &`)pWC*pW*pW* EpWSs>-pWX-pWX- |t0pW|e0pW|e0pW|e0/tmp/fstab.shadow [CpW3pW;ie4pW;ie4/tmp/resolv.conf.shadowRN pW*`7pW*`7pW*`7/tmp/hostsmX 0e!)\>”Iu7x͇xW+jGK m:⬹{ih1iV *{Ѵ!mK)m/I27meG*r/e$ջj<> T?_nWvڪQꐱ5xmݕ)p68D3r84p%eK5`/R"(uJ$݂N?*CVtxF"\E@؇;rKj(U-J1^=N,*g2Qk4<b`i~;ddB 3 |~A9V=#?NxQC6=܀].*I˩~~3 < )_i i$>ը*á 1 ^Ѓ1b)Li67=:s@Nb~&4L qm ±j[/kgK,2b"FEpE|zІ6O{:$A$3p]])y{f.+Gy|ﮏk9}WR@ . ..firmwarep5AsignifyGgrouprL protocolsdEKpasswdtmpIspwd.dbM servicesasswd.origJpwd.dbN fstab-O resolv.confP$ hosts-A .@ ..Hopenbsd-60-base.pubB . ..chown-bioctldhclient={ disklabel{dmesg-fdisk-fsck- fsck_ext2fsfsck_ffs={ifconfig={init-mknod-mount- mount_cd9660- mount_ext2fs- mount_ffs{ mount_msdos mount_nfs{newfs- newfs_msdosping-ping6-reboothalt-route-sysctlumountC . ..chrootpwd_mkdb={ztsscale={D . ..Ekeymapsmisc;E .D..F ...untrusted comment: openbsd 6.0 base public key RWSho3oKSqgLQy+NpIhFXZJDtkE65tzlmtC24mStf8DoJd2OPMgna4u8 g+rn<6_:OтRQl>+hkAكy!~[/BD7q۵[V9Y?^[1$} Ut]rހܛtiGƝ̡ $o,-tJܩ\ڈvRQ>m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxqg jgrn<:ORQhك[0.0.0.0127.0.0.1::1/etc/hosts/etc/group/etc/ethers%02x:%02x:%02x:%02x:%02x:%02x  0123456789ABCDEF0123456789abcdefnanNANinfINF(null)bug in vfprintf: bad base #;#nameserverlookupypsearchinet4ndots:lookup bind filenameserver 127.0.0.1RES_OPTIONSoptions LOCALDOMAINsearch lookup file %d.%d.%d.%d.in-addr.arpa.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.ip6.arpa.no spacetoo shortbad domain namedomain name too longbad dlen@BKMGTPE0B%lld%c%lld.%1lld%cimsg_readmsgbuf_write/dev/diskmap%s%s%s%c%s%s%shmac_sha1pkcs5_pbkdf2pw_write_entrypw_copy\fuid is %sroot uid should be 0gid is %swarning, unknown root shell%s:%s:%s:%s:%s:%lld:%lld:%s:%s:%s %s is zero length-d-s-p-u/usr/sbin/pwd_mkdb%s: unchangedre-edit the password file? [y]: %s: line too long%s: corrupted entry%s: inconsistent entry/etc/ptmplogout/var/run/utmplogin_protect%s: %s: %m/etc/fbtab/*%s: chmod(%s): %m%s: chown(%s): %m%s: opendir(%s): %m%s: bad entry: %s\\#readlabelfs       @@  |   ,   %sr%s%s: not a device node%s: couldn't read disklabel%s: bad filesystem type in labellogwtmp/var/log/wtmpSipHashYncdtscsbpxbxfxoxtxdxInfinityNaN/etc/ttyssecurertsctssoftcarwindowinet_net_ptoninet_net_pton_ipv401234567890123456789abcdef/usr/src/lib/libc/net/inet_net_pton.cn >= 0 && n <= 15n >= 0 && n <= 9assertion "%s" failed: file "%s", line %d, function "%s" assertion "%s" failed: file "%s", line %d inet_pton01234567890123456789ABCDEF0123456789abcdefSHA256EndSHA256DataSHA256FileChunk0123456789abcdefPOSIX_V6_ILP32_OFFBIGPOSIX_V7_ILP32_OFFBIG-lpthreadJJ$JN^[Yy]^[Nn]yes/var/run/dev.db[:<:]][:>:]]ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ !"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ ABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789ABCDEFabcdefNULSOHSTXETXEOTENQBELalertBSbackspaceHTtabLFVTvertical-tabFFform-feedCRcarriage-returnSOSIDLEDC1DC2DC3DC4NAKSYNETBCANEMSUBESCIS4IS3GSIS2RSIS1USexclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stopzeroonetwothreefourfivesixseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettildeDEL%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhx regerrorREG_0x%xREG_NOMATCHregexec() failed to matchREG_BADPATinvalid regular expressionREG_ECOLLATEinvalid collating elementREG_ECTYPEinvalid character classREG_EESCAPEREG_ESUBREGinvalid backreference numberREG_EBRACKbrackets ([ ]) not balancedREG_EPARENparentheses not balancedREG_EBRACEbraces not balancedREG_BADBRinvalid repetition count(s)REG_ERANGEinvalid character rangeREG_ESPACEREG_BADRPTrepetition-operator operand invalidREG_EMPTYempty (sub)expressionREG_ASSERT"can't happen" -- you found a bugREG_INVARGinvalid argument to regex routine*** unknown regexp error code ***SHA512EndSHA512DataSHA512FileChunk0123456789abcdefBLOCKSIZE%s: unknown blocksizemaximum blocksize is %dG%s: minimum blocksize is 512%ld%s-blockscrypt_checkpassRRblowfish,8blowfishbcryptbcrypt_hashpassOrpheanBeholderScryDoubtbcrypt_initsaltbcrypt_newhash_bcrypt_autoroundsbcrypt_checkpass6789:;<=>?  !"#$%&'()*+,-./012345./ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789$2%c$%2.2u$$2b$%2.2u$testpassword 1Ѭߘr/Ḗ~&jE|,G$l iciNWqX~=t XrX͋qJT{YZ90`*#`(yA8۸y:`l>w'K1/x`\`U%U攫UbHW@cj9U*4\̴ATr|*oc]ũ+1t>\3֯\$lS2zw(H;Kkē!(f a!`|H2]]]u#&܈e>#Ŭom9BD . Ji^Bh!la gӫҠQjh/T(3Ql n;zP;*~ev9>YfCoEå}^;uos D@jVbNw?6r=B$7H ۛIrS{y%P;LylO`@ž\^c$johSl>9oR;Qm,0DE ^J3(fK.WtE9_ ӹyU 2`yr,@%g̣饎"2u<kaP/R=2`#H{1S>W\o.ViB~(2gsUO'[iXʻ]=!lJ[-ySeEIҐK3~ˤAb Lw6~д+MەqՓkю%ǯ/[{AI~-%^q h"W6d$ cUYCxSZ٢[} Źv&ϕbhAJsN-GJ{RQ)S?Wƛv`+t恵oWk *!ec.4dV]-SGjnpzKD). u#&İn}ߧI`fqilRdVឱ¥6)L u@Y>:䚘T?eB[k?ҡ08-M]% L&pc^?kh >\D}W7: P tAu8/;21>8TNmO Bo ,y|$ryVw.?rU$qk.P̈́GXzt}K:zfC cdG27;C$CMQe*P:qUN1w_V5kǣ;< $Y,n<pEㆱo ^*>Zw=Ne)։>%fRxL.jxS<- N=+6&9`y#RnfE{7(2åZl!Xeh;/ۭ}*/n[(!pa)uGa0a4c\s9pL ު˼,b`\ndi#PZe2Zh@*<1! T_~}=b7w-_h)5ǡޖXxWcr"ÃF T0.SHُ(1mX4a(s<|J]d]B> EꫪOlOBBǵj;Oe!AyMjGKPb=bF&[$ti GV[ Htb#*BXU >ap?#r3A~_;"lY7|`t˧@n2w΄PU5ai Z .zD4Egɞs͈Uy_g@Cge48>q(= m!>J=+hZ=@&L4)i Av.khq$j 3ԷCaP.9FE$tO!@MpE/f m1'A9UG%ښ ʫ%xP()Sچ, mbhiHפh'?Oz|Ϊ_7әxB*k@5 ٫9N;VmK1f&tn:2C[Ah xN جV@E'H::SU kKмgUXc)3VJ*%1?~^|1)p/'\,(H"m?H܆AyG@n]Q_2Տd5A4x{%`*`lc´2Of#k>3b $;" r(-Exb}doITH}'>AcG t.no:7`L knU{7,gm;e' )̒9 i{f} ϑ^و/$[Qy{;v.97yY̗&-1.Bh;+jLu.x7BjQ满PcKkؽ%=YBD n *Ngd_ڈ鿾dW{x`M``FѰ8Ew63kBqA_^;Z4ٷ,Q+:Ֆ}}>(-}|%rZLZq)GW;()f(.y_xU`uD^mm%adâW<'*:m?!cf&(3uU4V<wQ( gQ̫_QM08bX7 z{>d!Q2Ow~㶨F=)iSHd$m-if! FEdlX [@X̻k~jEY:D 5>ʹrdfGof,ҏ"W##v215VbuZ6ns҈bIPLVq z2E{Sb%ҽ5iq"|˶+v>S@`8G% 8vFšw``u N˅؍芰z~L\HjiԐ\-% ?2aN[wߏWr:j?$.Dsp"8 1).lN!(Ew8fTl 4)P|ɵՄ? GyؗҜ<3#I9=D2[%Cod(hinityan0123456789abcdefABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/readpassphrasetcsetattr  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~glob2glob0jjjzj j(j0j4j8j@jDjLjPjXjQ`j5djljtj|jjjjjjjj`jjjSignal 0HUPINTILLTRAPABRTEMTFPEKILLBUSSEGVSYSPIPEALRMURGTSTPCONTCHLDTTINTTOUIOXCPUXFSZVTALRMPROFWINCHUSR1USR2THRUS-ASCIINONEUTF8tolowertoupperexecvpeexeclpexecleexeclexecvp: : path too long /etc/protocolsunknown option -- %coption requires an argument -- %cambiguous option -- %.*soption doesn't take an argument -- %.*soption requires an argument -- %sunknown option -- %sfstabscanxxsw%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02xmm m(m4m?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~realpath%u.%u.%u.%uinet6_rth_reverseSHA1TransformSHA1Pad\finet_ntop4inet_ntopgroup_from_giduser_from_uid/etc/shells# /bin/csh/bin/ksh/etc/services,/ ((((( AAAAAABBBBBB <clntudp_callbindresvport_sa !#&(*-/14       Hz  ABCDEF7yACnF?O8M20HwZ[%ld]Error %dsnprintfUnknown signal: Unknown error: 4D\pȍ܍$0HT`t̎ 0@Xhԏ4Ttؐ ,\t <Xp̒(<Pdtēؓ <Plؔ(Th|\Undefined error: 0Operation not permittedNo such file or directoryNo such processInterrupted system callInput/output errorDevice not configuredArgument list too longExec format errorBad file descriptorNo child processesResource deadlock avoidedCannot allocate memoryPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkOperation not supported by deviceNot a directoryIs a directoryInvalid argumentToo many open files in systemToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeNumerical argument out of domainResult too largeResource temporarily unavailableOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketProtocol not availableProtocol not supportedSocket type not supportedOperation not supportedProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceOperation timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downNo route to hostDirectory not emptyToo many processesToo many usersDisk quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC program not availableProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticatorIPsec processing failureAttribute not foundIllegal byte sequenceNo medium foundWrong medium typeValue too large to be stored in data typeOperation canceledIdentifier removedNo message of desired typeNot supportedj,4@H\lxȖؖ(4DXpȗ 8HangupInterruptQuitIllegal instructionTrace/BPT trapAbort trapEMT trapFloating point exceptionKilledBus errorSegmentation faultBad system callAlarm clockTerminatedUrgent I/O conditionSuspended (signal)SuspendedContinuedChild exitedStopped (tty input)Stopped (tty output)I/O possibleCputime limit exceededFilesize limit exceededVirtual timer expiredProfiling timer expiredWindow size changesInformation requestUser defined signal 1User defined signal 2Thread ASTvsnprintf__stack_smash_handler<10>: stack overflow in function 7|   Tܾ ,@4<H$PXeTX \@hAlKDkPxt"38}8}8}4(ܦ<@oSԀ,, x2,68_<pDpLpT4\4d4l@tT$Ц8TT  PA \PA PA    \ <  unblock and -DNO_CONV? # " ` ` @x" H @8 H P  h  x                  t@   4!!  ! !1м|^t0 Non-system disk Press any key to reboot NB:F:I:L:O:S:a:b:c:e:f:h:i:k:m:n:o:qr:s:t:u:ԖT6\6d6l6t6x6(|66T|5,6D6 X96 5666p66yx6PP& /tmp/EdDk.aXXXXXXXXXX\eeee\eeef ffff$f,f4fl~???>ccpp `8 ǃx8 089 pp<cc8` a`p ǃ0 009 0`<cg8` q`` FLJ0 009 8|cf0`8  p089 `f?0?  ?8 `f0   8 `f 1   8 `f 1`İ   08 8 `8 q`8  088 0` `qxp ap8p  008 pp ~??>?~?> 0 4f xǎv|w0xxD\1``bˌ  .&Ș|`` 00( r @ t `"b`11F0 ~sLJ;??~~c   @@? `mF8|x`a1C  mv<88J|LJϜm~|8Z cc `Ș F@F R#cHX $|B b#c0`Ș ,FF gό9>|a`G8p 9>Xa@@@x Ȏмظ11"t €u6Uu|agPtPS[X!Using drive X, partition YMBR on floppy or old BIOS Read error No O/S No active partition OxU;c ;Ll^4;\;od;;h;<o;;l;;4_< a(<DfL<lax<`Lf<<d<<d^<4\^=L=dT=x>h>>Pn>@>.>! !S @P^   memmnen n $5 n n n4,np0n.Н4nt~DN?TN@dN[xN\N\N]N^N^N_N_N`N{O{O|$O}0O}DO~LOOOOOOP$P0PHPTP`PPPPP PP PP Q$Q ?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~j\l*t*|*****`* @**HO,\@\I4JJXKDJLKNK0P? GMTUTCnt(Hd d x l@\^d}p}}dЏ<\Йxx(ܟH`̟|(ܟH`|^̹ p,l^̹ p- ^̹ p.,_^,_8_$Pt0l_l_ .shstrtab.note.openbsd.ident.init.text.fini.rodata.eh_frame.openbsd.randomdata.jcr.got.ctors.dtors.data.bss TTpp%+19CW\ahoFu`_< _z#!/bin/sh - PATH=/sbin:/usr/sbin:/bin:/usr/bin T=$0 [ "$eo" ] || eo= hex() { case $1 in [0-9]) echo -n $1;; 10) echo -n a;; 11) echo -n b;; 12) echo -n c;; 13) echo -n d;; 14) echo -n e;; 15) echo -n f;; esac } alph2d() { local t="$1" local p="0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ" local sub=${p%${t}*} echo ${#sub} } h2d() { local s="$1" local f=${s%*[0-9a-f]} n=${s#[0-9a-f]*} echo $(($(_h2d $f)*16+ $(_h2d $n) )) } _h2d() { case $1 in [0-9]) echo -n $1;; a) echo -n 10;; b) echo -n 11;; c) echo -n 12;; d) echo -n 13;; e) echo -n 14;; f) echo -n 15;; esac } unt() { arg="$1" tmp="${arg#[a-zA-Z]*}" tmp="${tmp%*[a-zA-Z]}" while [ "$tmp" != "$arg" ] do arg=$tmp tmp="${arg#[a-zA-Z]*}" tmp="${tmp%*[a-zA-Z]}" done echo $arg } dodisk() { [ "$DEBUG" ] && set -x n=$(($((${5}*${7:-16}))+${6})) count=0 [ 0$7 -ne 8 ] && l="i j k l m n o p" for d in a b c d e f g h $l do M $1$2$d b $3 $(($n+$count)) 640 operator M r$1$2$d c $4 $(($n+$count)) 640 operator let count=count+1 done } dodisk2() { n=$(($(($5*${7:-16}))+$6)) M $1$2a b $3 $n 640 operator M r$1$2a c $4 $n 640 operator n=$(($n+2)) M $1$2c b $3 $n 640 operator M r$1$2c c $4 $n 640 operator } RMlist[0]="rm -f" mkl() { : ${mklist[0]:=";mknod"} mklist[${#mklist[*]}]=" -m $1 $2 $3 $4 $5" } M() { RMlist[${#RMlist[*]}]=$1 mkl ${5-666} $1 $2 $3 $4 G=${6:-wheel} [ "$7" ] && { MKlist[${#MKlist[*]}]="&& chown $7:$G $1" } || { case $G in wheel) [ ${#whlist[*]} = 0 ] && whlist[0]="&& chgrp wheel" whlist[${#whlist[*]}]="$1" ;; operator) [ ${#oplist[*]} = 0 ] && oplist[0]="&& chgrp operator" oplist[${#oplist[*]}]="$1" ;; *) MKlist[${#MKlist[*]}]="&& chgrp $G $1"; esac } return 0 } R() { [ "$DEBUG" ] && set -x for i in "$@" do U=`unt $i` [ "$U" ] || U=0 case $i in ramdisk) R std bpf wd0 wd1 sd0 tty00 rd0 wsmouse R st0 ttyC0 wskbd0 apm bio diskmap random ;; std) M console c 0 0 600 M tty c 1 0 M mem c 2 0 640 kmem M kmem c 2 1 640 kmem M null c 2 2 M zero c 2 12 M stdin c 7 0 M stdout c 7 1 M stderr c 7 2 M ksyms c 8 0 640 kmem M klog c 6 0 600 ;; vscsi*) M vscsi$U c 100 $U 600 ;; video*) M video$U c 38 $U 600 MKlist[${#MKlist[*]}]=";[ -e video ] || ln -s video$U video" ;; uk*) M uk$U c 28 $U 640 operator ;; tuner*) M tuner$U c 75 $(($(($U*2))+16)) 644 ;; tap*) M tap$U c 104 $U 600 ;; tun*) M tun$U c 33 $U 600 ;; rmidi*) M rmidi$U c 57 $U 666 ;; *random) n=0 for pre in " " s u a do M ${pre}random c 40 $n 644 n=$(($n+1)) done ;; radio*) M radio$U c 97 $U MKlist[${#MKlist[*]}]=";[ -e radio ] || ln -s radio$U radio" ;; pppx*) M pppx$U c 103 $U 600 ;; pf*) M pf c 46 0 600 ;; hotplug) M hotplug c 37 $U 400 ;; fuse) M fuse$U c 77 $U 600 ;; fd) RMlist[${#RMlist[*]}]=";mkdir -p fd;rm -f" n=0 while [ $n -lt 64 ];do M fd/$n c 7 $n;n=$(($n+1));done MKlist[${#MKlist[*]}]=";chmod 555 fd" ;; diskmap) M diskmap c 102 0 640 operator ;; bpf) M bpf c 22 0 600 M bpf0 c 22 0 600 ;; bktr*) M bktr$U c 75 $U 644 ;; bio) M bio c 52 0 600 ;; audio*) M sound$U c 36 $U M mixer$U c 36 $(($U+16)) M audio$U c 36 $(($U+128)) M audioctl$U c 36 $(($U+192)) MKlist[${#MKlist[*]}]=";[ -e audio ] || ln -s audio$U audio" MKlist[${#MKlist[*]}]=";[ -e mixer ] || ln -s mixer$U mixer" MKlist[${#MKlist[*]}]=";[ -e sound ] || ln -s sound$U sound" MKlist[${#MKlist[*]}]=";[ -e audioctl ] || ln -s audioctl$U audioctl" ;; apm*) M apm c 34 0 644 M apmctl c 34 8 644 ;; usb*) [ "$i" = "usb" ] && u= || u=$U M usb$u c 64 $U 660 ;; ulpt*) M ulpt$U c 66 $U 660 ;; uhid*) M uhid$U c 65 $U 660 ;; ugen*) n=$(($U*16)) for j in 0{0,1,2,3,4,5,6,7,8,9} 1{0,1,2,3,4,5} do M ugen$U.$j c 70 $(($n+10#$j)) 660 done ;; uall) R ttyU0 ttyU1 ttyU2 ttyU3 ugen0 ugen1 ugen2 ugen3 ugen4 ugen5 R ugen6 ugen7 ulpt0 ulpt1 uhid0 uhid1 uhid2 uhid3 usb0 usb1 R usb2 usb3 usb4 usb5 usb6 usb7 ;; ttyU[0-9a-zA-Z]) U=${i#ttyU*} o=$(alph2d $U) M ttyU$U c 68 $o 660 dialer uucp M cuaU$U c 68 $(($o+128)) 660 dialer uucp ;; wsmux|wsmouse|wskbd) M wsmouse c 63 0 600 M wskbd c 63 1 600 ;; wsmouse[0-9]*) M wsmouse$U c 62 $U 600 ;; wskbd[0-9]*) M wskbd$U c 61 $U 600 ;; wscons) R wsmouse0 wsmouse1 wsmouse2 wsmouse3 wskbd0 wskbd1 wskbd2 R wskbd3 wsmux ttyCcfg ttyC0 ttyC1 ttyC2 ttyC3 ttyC4 ttyC5 R ttyC6 ttyC7 ttyC8 ttyC9 ttyCa ttyCb ;; tty[C-J]*) U=${i##tty[C-J]} case $i in ttyC*) n=C m=0;; ttyD*) n=D m=256;; ttyE*) n=E m=512;; ttyF*) n=F m=768;; ttyG*) n=G m=1024;; ttyH*) n=H m=1280;; ttyI*) n=I m=1536;; ttyJ*) n=J m=1792;; esac case $U in [0-9a-f]) M tty$n$U c 60 $((16#$U+$m)) 600;; cfg) M tty${n}cfg c 60 $((255+$m)) 600;; *) echo bad unit $U for $i; exit 1;; esac ;; pty*) if [ $U -gt 15 ]; then echo bad unit for pty in: $i continue fi set -A letters p q r s t u v w x y z P Q R S T set -A suffixes 0 1 2 3 4 5 6 7 8 9 a b c d e f g h i j k l m n o p q \ r s t u v w x y z A B C D E F G H I J K L M N O P Q R S T U V W X \ Y Z name=${letters[$U]} n=0 while [ $n -lt 62 ] do nam=$name${suffixes[$n]} off=$(($U*62)) M tty$nam c 4 $(($off+$n)) M pty$nam c 5 $(($off+$n)) n=$(($n+1)) done ;; ptm) M ptm c 98 0 666 ;; tty[0-7][0-9a-f]) U=${i#tty*} o=$(h2d $U) M tty$U c 12 $o 660 dialer uucp M cua$U c 12 $(($o+128)) 660 dialer uucp ;; st*) n=$(($U*16)) for pre in " " n e en do M ${pre}st$U b 25 $n 660 operator M ${pre}rst$U c 25 $n 660 operator n=$(($n+1)) done ;; vnd*) dodisk vnd $U 19 19 $U 0 ;; rd*) dodisk2 rd $U 18 18 $U 0 ;; ch*) M ch$U c 27 $U 660 operator ;; cd*) dodisk2 cd $U 26 26 $U 0 ;; local) test -s $T.local && sh $T.local ;; all) R vnd0 vnd1 vnd2 vnd3 sd0 sd1 sd2 sd3 sd4 sd5 sd6 sd7 sd8 sd9 R cd0 cd1 rd0 tap0 tap1 tap2 tap3 tun0 tun1 tun2 tun3 pty0 bio R diskmap vscsi0 ch0 audio0 audio1 audio2 bpf fuse pppx R hotplug ptm local wscons uall rmidi0 rmidi1 rmidi2 rmidi3 R rmidi4 rmidi5 rmidi6 rmidi7 tuner0 radio0 video0 video1 uk0 R random tty00 tty01 tty02 tty03 tty04 tty05 tty06 tty07 tty08 R tty09 tty0a tty0b apm pf wd0 wd1 wd2 wd3 std st0 st1 fd ;; wd*|sd*) case $i in wd*) dodisk wd $U 16 16 $U 0;; sd*) dodisk sd $U 24 24 $U 0;; esac ;; *) echo $i: unknown device ;; esac done } R "$@" { echo -n ${RMlist[*]} echo -n ${mklist[*]} echo -n ${MKlist[*]} echo -n ${whlist[*]} echo ${oplist[*]} } | if [ "$eo" = "echo" ]; then cat else sh fi wheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root bin:*:7: news:*:8: wsrc:*:9: users:*:10: auth:*:11: games:*:13: staff:*:20:root sshd:*:27: _portmap:*:28: _identd:*:29: _rstatd:*:30: guest:*:31:root _rusersd:*:32: _fingerd:*:33: _sshagnt:*:34: _x11:*:35: utmp:*:45: _rebound:*:52: _unbound:*:53: _dpb:*:54: _pbuild:*:55: _pfetch:*:56: _pkgfetch:*:57: _pkguntar:*:58: _spamd:*:62: _radius:*:63: _token:*:64: _shadow:*:65: crontab:*:66: www:*:67: _isakmpd:*:68: network:*:69: proxy:*:71: authpf:*:72: _syslogd:*:73: _pflogd:*:74: _bgpd:*:75: _tcpdump:*:76: _dhcp:*:77: _mopd:*:78: _tftpd:*:79: _rbootd:*:80: _ppp:*:82: _ntp:*:83: _ftp:*:84: _ospfd:*:85: _hostapd:*:86: _dvmrpd:*:87: _ripd:*:88: _relayd:*:89: _ospf6d:*:90: _snmpd:*:91: _rtadvd:*:92: _ypldap:*:93: _smtpd:*:95: _rwalld:*:96: _nsd:*:97: _ldpd:*:98: _sndio:*:99: _ldapd:*:100: _iked:*:101: _iscsid:*:102: _smtpq:*:103: _file:*:104: _radiusd:*:105: _eigrpd:*:106: _vmd:*:107: _tftp_proxy:*:108: _ftp_proxy:*:109: _sndiop:*:110: dialer:*:117: nogroup:*:32766: nobody:*:32767: . ..MAKEDEVconsole tty memkmemnull-zerostdinstdoutstderrksymsklogC bpfbpf0Cwd0arwd0awd0brwd0bwd0crwd0cwd0d-rwd0dCwd0erwd0ewd0frwd0fwd0g-rwd0gwd0hrwd0hCwd0i-rwd0i-wd0jCrwd0j-wd0k-rwd0k-wd0l-rwd0l-wd0m-rwd0m-wd0n-rwd0n-wd0o-rwd0o-wd0p-rwd0p-wd1a-rwd1a-wd1b-rwd1b-wd1c-rwd1c-wd1d-rwd1d-wd1e-rwd1e-wd1f-rwd1f-wd1g-rwd1g-wd1h-rwd1h-wd1i-rwd1i-wd1jCrwd1jCwd1k-rwd1kCwd1l-rwd1l-wd1m-rwd1m-wd1n-rwd1n-wd1o-rwd1o-wd1p-rwd1p-sd0a-rsd0a-sd0b-rsd0b-sd0c-rsd0c-sd0d-rsd0d-sd0e-rsd0e-sd0f-rsd0f-sd0g-rsd0g-sd0h-rsd0h-sd0i-rsd0i-sd0jrsd0jsd0kC rsd0k sd0l- rsd0l- sd0m- rsd0m-sd0n-rsd0n-sd0o-rsd0o-sd0p-rsd0p-tty00-cua00-rd0a-rrd0a-rd0c-rrd0c-wsmousewskbd- st0rst0-nst0-nrst0- est0-!erst0"enst0#enrst0$ttyC0%wskbd0& apm'apmctl( bio)diskmap*random+srandom,urandom-arandomroot:*:0:0:Charlie &:/root:/bin/ksh daemon:*:1:1:The devil himself:/root:/sbin/nologin operator:*:2:5:System &:/operator:/sbin/nologin bin:*:3:7:Binaries Commands and Source:/:/sbin/nologin uucp:*:66:1:UNIX-to-UNIX Copy:/var/spool/uucppublic:/usr/libexec/uucp/uucico _dhcp:*:77:77:DHCP programs:/var/empty:/sbin/nologin nobody:*:32767:32767:Unprivileged user for NFS:/nonexistent:/sbin/nologin ip 0 IP icmp 1 ICMP tcp 6 TCP udp 17 UDP ftp-data 20/tcp ftp 21/tcp domain 53/tcp nameserver domain 53/udp nameserver www 80/tcp http nfsd 2049/udp nfs nfsd 2049/tcp nfs bin*Binaries Commands and Source//sbin/nologin1binrdrrootdaemonCharlie &/root/bin/ksh2rootdaemonCharlie &/root/bin/ksh3MHdaemon*The devil himself/root/sbin/nologin2daemon*The devil himself/root/sbin/nologin3nobody*Unprivileged user for NFS/nonexistent/sbin/nologin1nobody f]\W operator*System &/operator/sbin/nologin2uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico3Boperator*System &/operator/sbin/nologin3operator*System &/operator/sbin/nologin1operatordaemon*The devil himself/root/sbin/nologin1daemonrootdaemonCharlie &/root/bin/ksh1rootA<bin*Binaries Commands and Source//sbin/nologin2bin*Binaries Commands and Source//sbin/nologin3uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico1uucpD6Duucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico2_dhcp*MMDHCP programs/var/empty/sbin/nologin1_dhcp^P^_dhcp*MMDHCP programs/var/empty/sbin/nologin2_dhcp*MMDHCP programs/var/empty/sbin/nologin3M@2@nobody*Unprivileged user for NFS/nonexistent/sbin/nologin2nobody*Unprivileged user for NFS/nonexistent/sbin/nologin3a  n}bin*Binaries Commands and Source//sbin/nologin1binpbprootdaemonCharlie &/root/bin/kshs2rootdaemonCharlie &/root/bin/kshs3MHdaemon*The devil himself/root/sbin/nologin2daemon*The devil himself/root/sbin/nologin3nobody*Unprivileged user for NFS/nonexistent/sbin/nologin1nobody e\[V  operator*System &/operator/sbin/nologin2uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico3Boperator*System &/operator/sbin/nologin3operator*System &/operator/sbin/nologin1operatordaemon*The devil himself/root/sbin/nologin1daemonrootdaemonCharlie &/root/bin/ksh1rootA<bin*Binaries Commands and Source//sbin/nologin2bin*Binaries Commands and Source//sbin/nologin3uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico1uucpD6Duucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico2_dhcp*MMDHCP programs/var/empty/sbin/nologin1_dhcp^P^_dhcp*MMDHCP programs/var/empty/sbin/nologin2_dhcp*MMDHCP programs/var/empty/sbin/nologin3M@2@nobody*Unprivileged user for NFS/nonexistent/sbin/nologin2nobody*Unprivileged user for NFS/nonexistent/sbin/nologin3a  n} 08`upW<  upWJI`[~ [~upW`@@<@TU pWbpWAxpWopWpW`>饋AypW# ypW# ypWd a)mCypW %ypW %ypWG&b2`AzpW?$pW^QpW^QcYPAzpW.VpWQ pWQ d.AzpWmPzpWmPzpW"e;AzpW"zpW"zpWahfrpW^QpWpWhv?pWQ pWVpWVE9NZg3Vk|U*_ql4d;0"}*=A,ٿ [:FS}.J|~OR^5 Y<$%eLrHrʷI¢QR1;Y`ƶxP*-˽9:0Yjho9yL/2UI$e'K=gϸ]ow[p,ޜuȹX d?!6=ufjE .3M6ǹ Jp5$>j4|o[%Ie> A/YZ?R&X:KصH#c4?K|yگc0)+W~+aG]&<{FnKQl,fmӀJ{3uFe] LEPIT'4c/ѧ˖$.Bu HԐɻ{9bXAೆkPRBwaO8z0R!5R-YB^+<0jŠeeu B@ئjB O$8Bpq0fY qX; . ..arch- catchmod-chgrp- cpdate- dd df edhostname={ ksh sh ln ls mtsha256sha512mkdir-eject- mv pax tar rmsleep-stty-sync- ... ... .D ..termcap . .. dbempty;F tmp runtzlist ... ... dumb|80-column dumb tty:\ :am:\ :co#80:\ :bl=^G:cr=^M:do=^J:sf=^J: vt100|vt100-am|dec vt100 (w/advanced video):\ :5i:am:bs:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :@8=\EOM:DO=\E[%dB:K1=\EOq:K2=\EOr:K3=\EOs:K4=\EOp:K5=\EOn:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=^O:as=^N:bl=^G:cb=\E[1K:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:do=^J:\ :eA=\E(B\E)0:ho=\E[H:k0=\EOy:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k5=\EOt:k6=\EOu:k7=\EOv:k8=\EOl:k9=\EOw:k;=\EOx:\ :kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:kr=\EOC:ks=\E[?1h\E=:\ :ku=\EOA:l1=pf1:l2=pf2:l3=pf3:l4=pf4:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[0m:mr=\E[7m:nd=\E[C:pf=\E[4i:po=\E[5i:\ :ps=\E[0i:rc=\E8:rs=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :..sa=\E[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t\016%e\017%;$<2>:\ :sc=\E7:se=\E[m:sf=^J:so=\E[7m:sr=\EM:st=\EH:ta=^I:ue=\E[m:\ :up=\E[A:us=\E[4m: vt220|vt200|dec vt220:\ :5i:am:bs:mi:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :%0=\E[29~:%1=\E[28~:*6=\E[4~:@0=\E[1~:AL=\E[%dL:\ :DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:F1=\E[23~:F2=\E[24~:\ :F3=\E[25~:F4=\E[26~:F7=\E[31~:F8=\E[32~:F9=\E[33~:\ :FA=\E[34~:IC=\E[%d@:LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:\ :SA=\E[?7h:UP=\E[%dA:ae=\E(B:al=\E[L:as=\E(0:bl=^G:\ :cb=\E[1K:cd=\E[J:ce=\E[K:cl=\E[H\E[J:cm=\E[%i%d;%dH:\ :cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[P:dl=\E[M:do=^J:\ :eA=\E)0:ec=\E[%dX:ei=\E[4l:ho=\E[H:\ :if=/usr/share/tabset/vt100:im=\E[4h:\ :is=\E[?7h\E[>\E[?1l\E F\E[?4l:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k6=\E[17~:k7=\E[18~:k8=\E[19~:k9=\E[20~:\ :k;=\E[21~:kD=\E[3~:kI=\E[2~:kN=\E[6~:kP=\E[5~:kb=^H:\ :kd=\E[B:kl=\E[D:kr=\E[C:ku=\E[A:l1=pf1:l2=pf2:l3=pf3:\ :l4=pf4:le=^H:mb=\E[5m:md=\E[1m:me=\E[0m:mr=\E[7m:nd=\E[C:\ :nw=\EE:pf=\E[4i:po=\E[5i:ps=\E[i:r1=\E[?3l:rc=\E8:sc=\E7:\ :se=\E[27m:sf=\ED:so=\E[7m:sr=\EM:st=\EH:ta=^I:\ :u6=\E[%i%d;%dR:u7=\E[6n:u9=\E[c:ue=\E[24m:up=\E[A:\ :us=\E[4m:vb=\E[?5h\E[?5l: #!/bin/ksh usage() { echo "usage: ${0##*/} [-a] [-f filename] [-m install | upgrade]" >&2 exit 1 } waitcgiinfo() { local _l _key _val wait "$CGIPID" 2>/dev/null [[ -s $CGI_INFO ]] || return sed -n 's,^http://\([[A-Za-z0-9\:_][]A-Za-z0-9:._-]*\),\1,p' \ $CGI_INFO >$HTTP_LIST 2>/dev/null read -r -- _l <$HTTP_LIST : ${HTTP_SERVER:=${_l%%/*}} while IFS='=' read -r -- _key _val; do case $_key=$_val in method=+([a-z])) CGI_METHOD=$_val;; TIME=+([0-9])) CGI_TIME=$_val;; TZ=+([-_/+[:alnum:]])) CGI_TZ=$_val;; esac done <$CGI_INFO } bsort() { local _a=$1 _b _l (($#)) && shift || return for _b; do [[ $_a == "$_b" ]] && continue if [[ $_a > $_b ]]; then _l="$_a $_l" _a=$_b else _l="$_b $_l" fi done echo -n "$_a " bsort $_l } isin() { local _a=$1 _b shift for _b; do [[ $_a == "$_b" ]] && return 0 done return 1 } addel() { local _a=$1 shift echo -n "$*" isin "$_a" $* || echo -n " $_a" } rmel() { local _a=$1 _b shift for _b; do [[ $_a != $_b ]] && echo -n "$_b " done } http_time() { local _sec=$(cat $HTTP_SEC 2>/dev/null) [[ -n $_sec && -n $CGI_TIME ]] && echo $((CGI_TIME + SECONDS - _sec)) } quote() ( for a; do alias Q=$a; a=$(alias Q); print -rn -- " ${a#Q=}" done | sed '1s/ //' echo ) showcols() { local _l _cdir=/tmp/cdir _clist mkdir -p $_cdir rm -rf -- $_cdir/* while read _l; do [[ -n $_l ]] || continue mkdir -p /tmp/cdir/"$_l" _clist[${#_clist[*]}]="$_l" done (cd $_cdir; ls -Cdf "${_clist[@]}") rm -rf -- $_cdir } stripcom () { local _l [[ -f $1 ]] || return set -o noglob while read _l; do [[ -n ${_l%%#*} ]] && echo $_l done <$1 set +o noglob } tmpdir() { local _i=1 _dir until _dir="${1?}.$_i.$RANDOM" && mkdir -- "$_dir" 2>/dev/null; do ((++_i < 10000)) || return 1 done echo "$_dir" } unique_filename() { local _fn=$1 _ufn while _ufn=${_fn}.$RANDOM && [[ -e $_ufn ]]; do done print -- "$_ufn" } prep_root_mail() { local _fn=$1 _subject=$2 _ufn [[ -s $_fn ]] || return _ufn=$(unique_filename /mnt/var/log/${_fn##*/}) cp $_fn $_ufn chmod 600 $_ufn _ufn=${_ufn#/mnt} cat <<__EOT >>/mnt/etc/rc.firsttime ( /usr/bin/mail -s '$_subject' root <$_ufn && rm $_ufn ) >/dev/null 2>&1 & __EOT } diskinfo() { local _d for _d; do makedev $_d echo -n "$_d: " disklabel -dpg $_d 2>/dev/null | sed -e '/^label: /{s,,,;s/ *$//;s/^$//;h;d;}' \ -e '/.*# total bytes: \(.*\)/{s//(\1)/;H;}' \ -e '$!d;x;s/\n/ /' rm -f /dev/{r,}$_d? done } makedev() { [[ -z $(cd /dev && sh MAKEDEV "$@" 2>&1) ]] } scan_dmesg() { bsort $(sed -n "$1" /var/run/dmesg.boot) } scan_disknames() { local IFS=, bsort $(for _n in $(sysctl -n hw.disknames); do echo "${_n%%:*} "; done | sed -n "$1") } get_dkdevs () { echo $(scan_disknames "${MDDKDEVS:-/^[sw]d[0-9][0-9]* /s/ .*//p}") } get_cddevs () { echo $(scan_disknames "${MDCDDEVS:-/^cd[0-9][0-9]* /s/ .*//p}") } get_dkdevs_uninitialized() { local _disks=$(get_dkdevs) _d for _d in $DISKS_DONE; do _disks=$(rmel "$_d" $_disks) done bsort $_disks } get_ifs() { local _if _iflist=$(rmel vlan $(ifconfig -C)) for _if in $(ifconfig "$@" 2>/dev/null | sed -n 's/^\([^[:space:]]*\):.*/\1/p'); do isin "${_if%%+([0-9])}" $_iflist || echo $_if done } get_dkdev_name() { local _dev=${1#/dev/} _d _dev=${_dev%.[a-p]} ((${#_dev} < 16)) && _dev=${_dev%[a-p]} local IFS=, for _d in $(sysctl -n hw.disknames); do [[ $_dev == @(${_d%:*}|${_d#*:}) ]] && echo ${_d%:*} && break done } disk_has() { local _disk=$1 _pttype=$2 _part=$3 _cmd _p_pttype _p_part [[ -n $_disk && -n $_pttype ]] || exit local _c_hfs="pdisk -l $_disk" local _c_sr="bioctl -q $_disk" local _p_gpt='Usable LBA:' local _p_gpt_openbsd='^[ *]...: OpenBSD ' local _p_gpt_efisys='^[ *]...: EFI Sys ' local _p_hfs='^Partition map ' local _p_hfs_openbsd=' OpenBSD OpenBSD ' local _p_mbr='Signature: 0xAA55' local _p_mbr_openbsd='^..: A6 ' local _p_mbr_dos='^..: 06 ' local _p_mbr_dos_active='^\*.: 06 ' local _p_mbr_linux='^..: 83 ' local _p_sr='OPENBSD, SR' local _p_sr_crypto='OPENBSD, SR CRYPTO' eval "_cmd=\"\$_c_${_pttype}\"" eval "_p_pttype=\"\$_p_${_pttype}\"" eval "_p_part=\"\$_p_${_pttype}_${_part}\"" _cmd=${_cmd:-fdisk $_disk} [[ -z $_p_pttype ]] && exit [[ -n $_part && -z $_p_part ]] && exit if [[ -z $_p_part ]]; then $_cmd 2>/dev/null | grep -Eq "$_p_pttype" else $_cmd 2>/dev/null | grep -Eq "$_p_pttype" && $_cmd 2>/dev/null | grep -Eq "$_p_part" fi } disklabel_autolayout() { local _disk=$1 _f=$2 _dl=/disklabel.auto _op [[ $_disk != $ROOTDISK ]] && return while $AUTO; do ask "URL to autopartitioning template for disklabel?" none [[ $resp == none ]] && break echo "Fetching $resp" if ftp -Vo $_dl "$resp" && [[ -s $_dl ]]; then disklabel -T $_dl -F $_f -w -A $_disk && return echo "Autopartitioning failed" exit 1 else echo "No autopartitioning template found." exit 1 fi done while :; do echo "The auto-allocated layout for $_disk is:" disklabel -h -A $_disk | egrep "^# |^ [a-p]:" ask "Use (A)uto layout, (E)dit auto layout, or create (C)ustom layout?" a case $resp in [aA]*) _op=-w;; [eE]*) _op=-E;; [cC]*) return 0;; *) continue;; esac disklabel -F $_f $_op -A $_disk return done } configure_disk() { local _disk=$1 _fstab=/tmp/fstab.$1 makedev $_disk || return rm -f /tmp/*.$_disk md_prep_disklabel $_disk || return if ! grep -qs ' / ffs ' /tmp/fstab.$ROOTDISK; then echo "'/' must be configured!" return 1 fi if [[ -f $_fstab ]]; then while read _pp _mp _rest; do if [[ $_mp == none ]]; then echo "$_pp $_mp $_rest" >>/tmp/fstab continue fi if [[ $_fstab != $(grep -l " $_mp " /tmp/fstab.*) ]]; then _rest=$_disk _disk= break fi done <$_fstab if [[ -z $_disk ]]; then cat /tmp/fstab.$_rest >/etc/fstab rm /tmp/fstab.$_rest set -- $(grep -h " $_mp " /tmp/fstab.*[0-9]) echo "$_pp and $1 can't both be mounted at $_mp." return 1 fi while read _pp _mp _fstype _rest; do [[ $_fstype == ffs ]] || continue _OPT= [[ $_mp == / ]] && _OPT=$MDROOTFSOPT newfs -q $_OPT ${_pp##/dev/} FSENT="$FSENT $_mp!$_pp" done <$_fstab fi return 0 } lock() { while ! mkdir /tmp/lock 2>/dev/null && sleep .1; do done } unlock() { rm -d /tmp/lock 2>/dev/null } retrap() { trap 'kill -KILL $CPPID 2>/dev/null; echo; stty echo; exit 0' \ INT EXIT TERM } log_answers() { if [[ -n $1 && -n $2 ]]; then print -r -- "${1%%'?'*} = $2" >>/tmp/$MODE.resp fi } get_responsefile() { local _rf _if _mac _mode _lf _hn _path AI_MODE= [[ -f /auto_upgrade.conf ]] && _rf=/auto_upgrade.conf _mode=upgrade [[ -f /auto_install.conf ]] && _rf=/auto_install.conf _mode=install [[ -f $_rf ]] && cp $_rf /ai.$_mode.conf && AI_MODE=$_mode && return for _if in ''; do [[ -x /sbin/dhclient ]] || break set -- $(get_ifs netboot) (($# == 0)) && set -- $(get_ifs) (($# == 1)) && _if=$1 while (($# > 1)); do ask_which "network interface" \ "should be used for the initial DHCP request" "$*" isin "$resp" $* && _if=$resp && break done [[ -n $_if ]] && dhclient $_if || break _lf=/var/db/dhclient.leases.$_if export AI_SERVER=$(sed "/^ *next-server /!d;s///;s/;$//;q" $_lf) _mode=$(sed -E '/^ *filename "(.*\/)?auto_(install|upgrade)";$/!d;s//\2/;q' $_lf) _path=$(sed -E '/^ *filename "(.*\/)[^/]+";$/!d;s//\1/;q' $_lf) _hn=$(sed -E '/^ *option host-name "(.*)";$/!d;s//\1/;q' $_lf) hostname "$_hn" done if [[ -n $AI_SERVER && -n $_mode ]]; then _mac=$(ifconfig $_if | sed 's/.*lladdr \(.*\)/\1/p;d') for _rf in {$_mac-,${_hn:+$_hn-,}}$_mode; do _url="http://$AI_SERVER/$_path$_rf.conf?path=$HTTP_SETDIR" echo "Fetching $_url" if ftp -Vo "/ai.$_mode.conf" "$_url" 2>/dev/null; then AI_MODE=$_mode ifconfig $_if delete down 2>/dev/null return 0 fi done else [[ -z $AI_SERVER ]] && echo "Could not determine next-server." [[ -z $_mode ]] && echo "Could not determine auto mode." fi while :; do ask "Response file location?" \ "${AI_SERVER:+http://$AI_SERVER/install.conf}" [[ -n $resp ]] && _rf=$resp && break done _mode=$(echo "$_rf" | sed -En 's/^.*(install|upgrade).conf$/\1/p') while [[ -z $_mode ]]; do ask "(I)nstall or (U)pgrade?" [[ $resp == [iI]* ]] && _mode=install [[ $resp == [uU]* ]] && _mode=upgrade done echo "Fetching $_rf" [[ -f $_rf ]] && _rf="file://$_rf" ftp -Vo "/ai.$_mode.conf" "$_rf" 2>/dev/null && AI_MODE=$_mode ifconfig $_if delete down 2>/dev/null [[ -n $AI_MODE ]] } _autorespond() { typeset -l _q=$1 _key local _def=$2 _l _val [[ -f $RESPFILE ]] || return mv /ai.conf /ai.conf.tmp while IFS=' ' read -r _l; do [[ $_l == [!#=]*=?* ]] || continue _key=${_l%%*([[:blank:]])=*} _val=${_l##*([!=])=*([[:blank:]])} [[ $_q == @(|*[[:blank:]])"$_key"@([[:blank:]?]*|) ]] && resp=$_val && cat && return print -r " $_l" done /ai.conf [[ -n $_def ]] && resp=$_def && return echo "\nQuestion has no answer in response file." exit 1 } _ask() { local _q=$1 _def=$2 _int _redo=0 _pid lock; dmesg >/tmp/update; unlock echo -n "${_q:+$_q }${_def:+[$_def] }" _autorespond "$_q" "$_def" && echo "$resp" && return trap "_int=1" INT trap "_redo=1" TERM read resp lock; rm /tmp/update; unlock if ((_redo)); then stty raw stty -raw else case $resp in !) echo "Type 'exit' to return to install." sh _redo=1 ;; !*) eval "${resp#?}" _redo=1 ;; esac fi retrap ((_int)) && kill -INT $$ : ${resp:=$_def} return $_redo } ask() { while ! _ask "$1" "$2"; do done log_answers "$1" "$resp" } ask_yn() { local _q=$1 _a=${2:-no} typeset -l _resp while :; do ask "$_q" "$_a" _resp=$resp case $_resp in y|yes) resp=y; return 0;; n|no) resp=n; return 1;; esac echo "'$resp' is not a valid choice." $AUTO && exit 1 done } ask_which() { local _name=$1 _query=$2 _list=$3 _def=$4 _dynlist _dyndef _key _q _key=$(echo "$_name" | sed 's/[^[:alnum:]]/_/g') while :; do eval "_dynlist=\"$_list\"" eval "_dyndef=\"$_def\"" set -o noglob set -- $_dyndef; _dyndef="$1" set -- $_dynlist; _dynlist="$*" set +o noglob (($# < 1)) && resp=done && return : ${_dyndef:=$1} echo "Available ${_name}s are: $_dynlist." _q="Which $_name $_query?" echo -n "$_q (or 'done') ${_dyndef:+[$_dyndef] }" _autorespond "$_q" "${_dyndef-done}" && echo "$resp" \ || _ask || continue [[ -z $resp ]] && resp="$_dyndef" if isin "$resp" $_dynlist done; then log_answers "$_q" "$resp" break fi echo "'$resp' is not a valid choice." $AUTO && [[ -n $RESPFILE ]] && exit 1 done } function ask_until { resp= while true; do ask "$1" "$2" [[ -n $resp ]] && break echo "A response is required." $AUTO && exit 1 done } askpass() { stty -echo IFS= read -r resp?"$1 " stty echo echo } askpassword() { local _q=$1 if $AUTO; then echo -n "$_q " _autorespond "$_q" echo '' _password=$resp return fi while :; do askpass "$_q (will not echo)" _password=$resp askpass "$_q (again)" [[ $resp == "$_password" ]] && break echo "Passwords do not match, try again." done } dhcp_request() { local _if=$1 _hn=$2 echo "lookup file bind" >/etc/resolv.conf.tail echo "send host-name \"$_hn\";" >/etc/dhclient.conf ifconfig $_if group dhcp >/dev/null 2>&1 dhclient -c /dev/stdin $_if <<__EOT initial-interval 1; backoff-cutoff 2; reboot 5; timeout 10; send host-name "$_hn"; __EOT mv /etc/dhclient.conf /tmp/dhclient.conf mv /etc/resolv.conf.tail /tmp/resolv.conf.tail } v4_info() { ifconfig $1 inet | sed -n ' 1s/.*/dev/null echo "$_addr $_name" >>/tmp/hosts } v4_config() { local _if=$1 _name=$2 _hn=$3 _prompt _addr _mask if ifconfig $_if | grep -q 'groups:.* dhcp'; then _addr=dhcp else set -- $(v4_info $_if) if [[ -n $2 ]]; then _addr=$2; _mask=$(hextodec $3) ifconfig $_if inet $_addr delete fi fi if [[ -x /sbin/dhclient ]]; then _prompt="or 'dhcp' " ifconfig dhcp >/dev/null 2>&1 || _addr=dhcp fi _prompt="IPv4 address for $_if? (${_prompt}or 'none')" ask_until "$_prompt" "$_addr" case $resp in none) ;; dhcp) if [[ ! -x /sbin/dhclient ]]; then echo "DHCP not possible - no /sbin/dhclient." else dhcp_request $_if "$_name" echo "dhcp" >>$_hn fi ;; *) _addr=$resp ask_until "Netmask for $_if?" "${_mask:=255.255.255.0}" ifconfig $_if -group dhcp >/dev/null 2>&1 if ifconfig $_if inet $_addr netmask $resp up; then addhostent "$_addr" "$_name" echo "inet $_addr $resp" >>$_hn fi ;; esac } v6_info() { ifconfig $1 inet6 | sed -n ' 1s/.*/dev/null | sed -n '/bytes from/{s/^.*from //;s/,.*$//;p;}' | sed -n 'G;s/\n/&&/;/^\(.*\n\).*\n\1/d;h;P')) _prompt="IPv6 default router?" if $AUTO; then _autorespond "$_prompt" && _resp=$resp && echo "$_prompt $_resp" else local PS3="$_prompt (${_routers:+list #, }IPv6 address or 'none'): " select _resp in $_routers; do [[ ${_resp:=$REPLY} == *:* ]] && break [[ $_resp == none ]] && return done fi route -n add -inet6 -host default "$_resp" && echo "$_resp" >>/tmp/mygate } v6_config() { local _if=$1 _name=$2 _hn=$3 _addr _prefixlen _prompt ifconfig lo0 inet6 >/dev/null 2>&1 || return set -- $(v6_info $_if) [[ -n $2 ]] && { _addr=$2; _prefixlen=$3; } ifconfig $_if inet6 >/dev/null 2>&1 && _prompt="or 'rtsol' " _prompt="IPv6 address for $_if? (${_prompt}or 'none')" ask_until "$_prompt" "${_addr:-none}" case $resp in none) return ;; rtsol) ifconfig $_if inet6 >/dev/null 2>&1 || { echo "No INET6 support."; return; } ifconfig $_if up ifconfig $_if inet6 autoconf && echo "up\nrtsol" >>$_hn return ;; esac _addr=$resp ask_until "IPv6 prefix length for $_if?" "${_prefixlen:=64}" ifconfig $_if inet6 $_addr prefixlen $resp up || return echo "inet6 $_addr $resp" >>$_hn addhostent "$_addr" "$_name" v6_defroute $_if } ieee80211_scan() { [[ -f $WLANLIST ]] || ifconfig $1 scan | sed -n 's/^ nwid \([^"]\)/\1/p' >$WLANLIST cat $WLANLIST } ieee80211_config() { local _if=$1 _hn=$2 _prompt _nwid _haswpa=0 _err ifconfig $_if -nwid -nwkey ifconfig $_if -wpa 2>/dev/null && _haswpa=1 rm -f $WLANLIST while [[ -z $_nwid ]]; do ask_until "Access point? (ESSID, 'any', list# or '?')" "any" case "$resp" in +([0-9])) _nwid=$(ieee80211_scan $_if | sed -n "${resp}s/ .*//p") [[ -z $_nwid ]] && echo "There is no line $resp." ;; \?) ieee80211_scan $_if | sed -n 's/^\([^ ]*\) chan .* bssid \([^ ]*\) .*$/ \1 (\2)/p' | cat -n | more -c ;; *) _nwid=$resp ;; esac done if [[ $_nwid != any ]]; then ifconfig $_if nwid "$_nwid" quote nwid "$_nwid" >>$_hn _prompt="Security protocol? (O)pen, (W)EP" ((_haswpa == 1)) && _prompt="$_prompt, WPA-(P)SK" while :; do ask_until "$_prompt" "O" case "$_haswpa-$resp" in ?-[Oo]) break ;; ?-[Ww]) ask_until "WEP key? (will echo)" if _err=$(ifconfig $_if nwkey "$resp" 2>&1) && [[ -z $_err ]]; then quote nwkey "$resp" >>$_hn break fi echo "$_err" ;; 1-[Pp]) ask_until "WPA passphrase? (will echo)" if ifconfig $_if wpakey "$resp"; then quote wpakey "$resp" >>$_hn break fi ;; *) echo "'$resp' is not a valid choice." ;; esac done fi } configure_ifs() { local _first _ifs _if _name _hn _vl=0 _vd _vi _p _tags while :; do _vd=$(ifconfig vlan$_vl 2>&1) [[ $_vd == @(*no such interface*) ]] && break [[ $_vd == @(*vlan: +([[:digit:]]) parent interface:*) ]] || break ((_vl++)) done _vd= ifconfig lo0 inet 127.0.0.1/8 rm -f /tmp/mygate while :; do ifconfig vlan$_vl create >/dev/null 2>&1 ask_which "network interface" "do you wish to configure" \ '$(get_ifs)' \ ${_p:-'$( (get_ifs netboot; get_ifs) | sed q )'} [[ $resp == done ]] && break _if=$resp _hn=/tmp/hostname.$_if rm -f $_hn if [[ $_if == vlan+([0-9]) ]]; then _vi=$(ifconfig $_if 2>/dev/null | sed -n 's/vlan: \([0-9]*\).*/\1/p') _tags=$(ifconfig vlan 2>/dev/null | sed -n 's/vlan: \([0-9]*\).*/\1/p') [[ -n $_tags ]] && _tags=$(rmel "$_vi" $_tags) if [[ -z $_vi ]]; then _vi=0 while ((++_vi < 4096)); do ! isin "$_vi" $_tags && break done fi _ifs=$(get_ifs) set -- $_ifs while [[ $1 == vlan+([0-9]) ]]; do shift done ask "Which interface:tag should $_if be on?" "${_vd:=$1}:$_vi" _vd=${resp%%:*} _vi=${resp##*:} if ! (isin "$_vd" $_ifs && [[ $_vd != vlan+([0-9]) ]]); then echo "Invalid interface choice '$_vd'" _vd= continue fi if ((_vi < 1 || _vi > 4095)) || isin "$_vi" $_tags; then echo "Invalid or in-use vlan tag '$_vi'" continue fi grep -qs "^up" /tmp/hostname.$_vd || echo "up" >>/tmp/hostname.$_vd chmod 640 /tmp/hostname.$_vd ifconfig $_vd up ifconfig $_if destroy >/dev/null 2>&1 ifconfig $_if vlan $_vi vlandev $_vd echo "vlan $_vi vlandev $_vd" >>$_hn [[ ${_if##vlan} == $_vl ]] && ((_vl++)) fi ifconfig $_if 2>/dev/null | grep -q "^[[:space:]]*ieee80211:" && ieee80211_config $_if $_hn resp=$(hostname -s) [[ -n $_first && $_first != $_if ]] && ask "Symbolic (host) name for $_if?" $resp _name=$resp v4_config $_if $_name $_hn v6_config $_if $_name $_hn if [[ -f $_hn ]]; then chmod 640 $_hn : ${_first:=$_if} fi NIFS=$(ls -1 /tmp/hostname.* 2>/dev/null | grep -c ^) _p=done done } v4_defroute() { local _dr [[ -n $(ifconfig | sed -n '/[ ]inet .* broadcast /p') ]] || return set -- $(route -nv show -inet | { set -- $(grep '^default '); print $2 $9; }) [[ -n $1 ]] && _dr=$1 [[ -n $_dr && $2 == DHCLIENT && -f /tmp/dhclient.conf ]] && return while :; do ask_until "Default IPv4 route? (IPv4 address or none)" "$_dr" [[ $resp == none ]] && break route delete -inet default >/dev/null 2>&1 route -n add -inet -host default "$resp" && { echo "$resp" >>/tmp/mygate; break; } route -n add -inet -host default $_dr >/dev/null 2>&1 done } get_fqdn() { local _dn _dn=$(hostname) _dn=${_dn#$(hostname -s)} _dn=${_dn#.} echo "${_dn:=my.domain}" } sane_install() { local _q=$1 _s for _s in $SANESETS; do isin "$_s" $DEFAULTSETS || continue [[ -n $_q ]] && return 1 if ! ask_yn "Are you *SURE* your $MODE is complete without '$_s'?"; then $AUTO && exit 1 || return 1 fi done } select_sets() { local _avail=$1 _selected=$2 _f _action _col=$COLUMNS let COLUMNS=_col-8 cat <<__EOT Select sets by entering a set name, a file name pattern or 'all'. De-select sets by prepending a '-' to the set name, file name pattern or 'all'. Selected sets are labelled '[X]'. __EOT while :; do for _f in $_avail; do isin "$_f" $_selected && echo "[X] $_f" || echo "[ ] $_f" done | showcols | sed 's/^/ /' ask "Set name(s)? (or 'abort' or 'done')" done set -o noglob for resp in $resp; do case $resp in abort) _selected=; break 2;; done) break 2;; -*) _action=rmel;; *) _action=addel;; esac resp=${resp#[+-]} [[ $resp = all ]] && resp=* for _f in $_avail; do [[ $_f = $resp ]] && _selected=$($_action $_f $_selected) done done done set +o noglob COLUMNS=$_col resp=$_selected } install_files() { local _src=$1 _files=$2 _f _sets _get_sets _n _col=$COLUMNS \ _tmpfs _tmpsrc _cfile _fsrc _unver _t _issue _srclocal for _f in $THESETS; do isin "$_f" $_files || continue _sets=$(addel $_f $_sets) isin "$_f" $DEFAULTSETS "site$VERSION-$(hostname -s).tgz" && _get_sets=$(addel $_f $_get_sets) done if [[ -z $_sets ]]; then echo -n "Looked at $_src " echo "and found no $OBSD sets. The set names looked for were:" let COLUMNS=_col-8 for _n in $THESETS; do echo $_n; done | showcols | sed 's/^/ /' COLUMNS=$_col $AUTO && exit 1 echo return fi isin "INSTALL.$ARCH" $_files || ask_yn "INSTALL.$ARCH not found. Use sets found here anyway?" || return select_sets "$_sets" "$_get_sets" [[ -n $resp ]] || return _get_sets=$resp _get_sets=$(for s in $THESETS; do isin "$s" $_get_sets && echo $s; done) _unver=$_get_sets for _issue in ''; do ! isin SHA256.sig $_files && _issue="Directory does not contain SHA256.sig" && break _tmpfs=$( ( for fs in /mnt/{{,var/}tmp,home,usr{/local,}}; do df -k $fs 2>/dev/null | grep " $fs\$" done df -k ) | ( while read a a a a m m; do [[ $m == /mnt/@(@(|var/)tmp|home|usr/@(src,obj,xobj))@(|/*) ]] && ((a > 524288)) && echo $m && exit [[ $m == /mnt@(|/*) ]] && ((a > 524288 * 4)) && echo $m && exit done ) ) if [[ -d $_tmpfs ]]; then ! _tmpsrc=$(tmpdir "$_tmpfs/sets") && _issue="Cannot create prefetch area" && break else _issue="Cannot determine prefetch area" && break fi _cfile=$_tmpsrc/SHA256 _srclocal=false _t=Get/Verify [[ $_src == file://* ]] && _srclocal=true _t='Verifying ' ! ftp -D "$_t" -Vmo "$_cfile.sig" "$_src/SHA256.sig" && _issue="Cannot fetch SHA256.sig" && break ! signify -Vep /etc/signify/openbsd-${VERSION}-base.pub \ -x "$_cfile.sig" -m "$_cfile" && _issue="Signature check of SHA256.sig failed" && break for _f in $_get_sets; do rm -f "$_tmpsrc/h" "$_tmpsrc/fail" ( ftp -D "$_t" -Vmo - "$_src/$_f" || >"$_tmpsrc/fail" ) | ( $_srclocal && sha256 >$_tmpsrc/h || sha256 -ph "$_tmpsrc/h" >"$_tmpsrc/$_f" ) if [[ -f $_tmpsrc/fail ]]; then rm -f "$_tmpsrc/$_f" if ! ask_yn "Fetching of $_f failed. Continue anyway?"; then [[ -d $_tmpsrc ]] && rm -rf "$_tmpsrc" $AUTO && exit 1 return fi continue fi if fgrep -qx "SHA256 ($_f) = $(<$_tmpsrc/h)" "$_cfile"; then _unver=$(rmel $_f $_unver) else if ! ask_yn "Checksum test for $_f failed. Continue anyway?"; then [[ -d $_tmpsrc ]] && rm -rf "$_tmpsrc" $AUTO && exit 1 return fi fi done done [[ -n $_unver ]] && : ${_issue:="Unverified sets:" ${_unver% }} if [[ -n $_issue ]] && ! ask_yn "$_issue. Continue without verification?"; then [[ -d $_tmpsrc ]] && rm -rf "$_tmpsrc" $AUTO && exit 1 return fi for _f in $_get_sets; do _fsrc="$_src/$_f" [[ -f $_tmpsrc/$_f ]] && _fsrc="file://$_tmpsrc/$_f" case $_fsrc in *.tgz) ftp -D Installing -Vmo - "$_fsrc" | tar -zxphf - -C /mnt if [[ $_f == ?(x)base*.tgz && $MODE == install ]]; then ftp -D Extracting -Vmo - \ file:///mnt/var/sysmerge/${_f%%base*}etc.tgz | tar -zxphf - -C /mnt fi ;; *) ftp -D Installing -Vmo "/mnt/$_f" "$_fsrc" ;; esac if (($?)); then if ! ask_yn "Installation of $_f failed. Continue anyway?"; then [[ -d $_tmpsrc ]] && rm -rf "$_tmpsrc" $AUTO && exit 1 return fi else DEFAULTSETS=$(rmel $_f $DEFAULTSETS) fi [[ -d $_tmpsrc ]] && rm -f "$_tmpsrc/$_f" done [[ -d $_tmpsrc ]] && rm -rf "$_tmpsrc" } install_http() { local _file_list _prompt _mirror _url_base waitcgiinfo ask "HTTP proxy URL? (e.g. 'http://proxy:8080', or 'none')" \ "${http_proxy:-none}" unset http_proxy [[ $resp == none ]] || export http_proxy=$resp if [[ -s $HTTP_LIST ]]; then _prompt="HTTP Server? (hostname, list#, 'done' or '?')" else echo "(Unable to get list from ftp.openbsd.org, but that is OK)" _prompt="HTTP Server? (hostname or 'done')" fi while :; do ask_until "$_prompt" "$HTTP_SERVER" case $resp in done) return ;; "?") [[ -s $HTTP_LIST ]] || continue cat -n < $HTTP_LIST | more -c ;; +([0-9])) [[ -s $HTTP_LIST ]] || continue set -- $(sed -n "${resp}p" $HTTP_LIST) (($# < 1)) && { echo "There is no line $resp."; continue; } HTTP_SERVER=${1%%/*} ;; +([A-Za-z0-9\:.\[\]_-])) HTTP_SERVER=$resp break ;; *) echo "'$resp' is not a valid hostname." ;; esac done set -- $(sed "/^$HTTP_SERVER/x;\$!d;x" $HTTP_LIST 2>/dev/null) resp=${1#*/} [[ $resp == "$1" ]] && resp= if (($# > 1)); then resp=$resp/$HTTP_SETDIR _mirror=yes fi : ${HTTP_DIR:=pub/OpenBSD/$HTTP_SETDIR} ask_until "Server directory?" "${resp:-$HTTP_DIR}" HTTP_DIR=$resp _url_base="http://$HTTP_SERVER/$HTTP_DIR" _file_list=$(ftp -Vo - "$_url_base/index.txt" | sed 's/^.* //;s/ //') install_files "$_url_base" "$_file_list" INSTALL_URL=$_url_base PACKAGE_PATH= if [[ -n $_mirror ]]; then PACKAGE_PATH=$(print -r -- "$_url_base" | sed -E "/\/(snapshots|[0-9]\.[0-9])\/($ARCH)\/*$/!d s!!/\1/packages/$(arch -s)/!;q") fi } install_mounted_fs() { local _dir while :; do ask_until "Pathname to the sets? (or 'done')" "$SETDIR" [[ $resp == done ]] && return [[ -d /mnt2/$resp ]] && { _dir=/mnt2/$resp; break; } [[ -d /mnt/$resp ]] && { _dir=/mnt/$resp; break; } [[ -d /$resp ]] && { _dir=/$resp; break; } echo "The directory '$resp' does not exist." $AUTO && exit 1 done install_files "file://$_dir" "$(ls $_dir/)" } install_cdrom() { local _drive=$1 makedev $_drive && mount_mnt2 $_drive || return install_mounted_fs } install_disk() { if ! ask_yn "Is the disk partition already mounted?"; then ask_which "disk" "contains the $MODE media" \ '$(bsort $(get_dkdevs))' \ '$(bsort $(rmel $ROOTDISK $(get_dkdevs)))' [[ $resp == done ]] && return 1 makedev $resp && mount_mnt2 $resp || return fi install_mounted_fs } install_nfs() { local _tcp ask_until "Server IP address or hostname?" "$NFS_ADDR" NFS_ADDR=$resp ask_until "Filesystem on server to mount?" "$NFS_PATH" NFS_PATH=$resp ask_yn "Use TCP transport? (requires TCP-capable NFS server)" && _tcp=-T mount_nfs $_tcp -o ro -R 5 $NFS_ADDR:$NFS_PATH /mnt2 || return install_mounted_fs } mount_mnt2() { local _dev=$1 _opts _file=/tmp/parts.$1 _parts disklabel $_dev 2>/dev/null | sed -En '/swap|unused/d;/^ [a-p]: /p' >$_file _parts=$(sed 's/^ \(.\): .*/\1/' $_file) set -- $_parts (($# == 0)) && { echo "No filesystems found on $_dev."; return 1; } if isin "c" $_parts; then resp=c elif (($# == 1)); then resp=$1 else cat $_file ask_which "$_dev partition" "has the $MODE sets" \ '$(disklabel '$_dev' 2>/dev/null | sed -En '\''/swap|unused/d;/^ ([a-p]): .*/s//\1/p'\'')' [[ $resp == done ]] && return 1 fi grep -q "^ $resp: .*MSDOS" $_file && _opts="-s" mount -o ro,$_opts /dev/$_dev$resp /mnt2 } set_term() { local _layouts export TERM=${TERM:-${MDTERM:-vt220}} if [[ -n $CONSOLE ]]; then ask "Terminal type?" $TERM export TERM=$resp else [[ -x /sbin/kbd ]] || return _layouts=$(bsort $(kbd -l | egrep -v "^(user|tables|encoding)")) while :; do ask "Choose your keyboard layout ('?' or 'L' for list)" "default" case $resp in [lL\?]) echo "Available layouts: $_layouts";; default) return;; *) kbd $resp && { echo $resp >/tmp/kbdtype; return; };; esac done fi } donetconfig() { local _dn _ns _f1 _f2 _f3 configure_ifs v4_defroute if [[ -f /tmp/resolv.conf.shadow ]]; then mv /tmp/resolv.conf.shadow /tmp/resolv.conf while read -r -- _f1 _f2 _f3; do [[ $_f1 == nameserver ]] && _ns="${_ns:+$_ns }$_f2" [[ $_f1 == @(domain|search) ]] && _dn=$_f2 done /dev/null 2>&1 && [[ $NIFS == 1 && -n $_dn ]]; then echo "Using DNS domainname $resp" else ask "DNS domain name? (e.g. 'bar.com')" "$resp" fi hostname "$(hostname -s).$resp" resp="${_ns:=none}" if ifconfig dhcp >/dev/null 2>&1 && [[ $NIFS == 1 && -n $_ns ]]; then echo "Using DNS nameservers at $resp" else ask "DNS nameservers? (IP address list or 'none')" "$resp" fi if [[ $resp != none ]]; then echo "lookup file bind" >/tmp/resolv.conf for _ns in $resp; do echo "nameserver $_ns" >>/tmp/resolv.conf done cp /tmp/resolv.conf /tmp/resolv.conf.shadow fi } questions() { local _d _cdef=no ask_yn "Start sshd(8) by default?" yes sshd=$resp aperture= resp= xdm= if [[ -n $DISPLAY ]]; then if [[ -n $(scan_dmesg '/^[a-z]*[01]: aperture needed/p') ]]; then ask_yn "Do you expect to run the X Window System?" yes && aperture=$MDXAPERTURE fi if [[ -n $MDXDM && $resp != n ]]; then ask_yn "Do you want the X Window System to be started by xdm(1)?" xdm=$resp fi fi if [[ -n $CDEV ]]; then _d=${CPROM:-$CDEV} [[ -n $CONSOLE ]] && _cdef=yes ask_yn "Change the default console to $_d?" $_cdef defcons=$resp if [[ $resp == y ]]; then ask_which "speed" "should $_d use" \ "9600 19200 38400 57600 115200" $CSPEED case $resp in done) defcons=n;; *) CSPEED=$resp;; esac fi fi } user_setup() { local _q="Setup a user? (enter a lower-case loginname, or 'no')" while :; do ask "$_q" no case $resp in n|no) return ;; y|yes) _q="No really, what is the lower-case loginname, or 'no'?" continue ;; root|daemon|operator|bin|sshd|uucp|www|nobody|ftp) ;; [a-z]*([a-z0-9_])) ((${#resp} <= 31)) && break ;; esac echo "$resp is not a useable loginname." done user=$resp while :; do ask "Full name for user $user?" $user case $resp in *[:\&,]*) echo "':', '&' or ',' are not allowed." ;; *) ((${#resp} <= 100)) && break echo "Too long." ;; esac done username=$resp askpassword "Password for user $user?" userpass=$_password userkey= $AUTO && ask "Public ssh key for user $user" none && [[ $resp != none ]] && userkey=$resp } ask_root_sshd() { typeset -l _resp [[ $sshd == y ]] || return if [[ -z $user ]]; then echo "Since no user was setup, root logins via sshd(8) might be useful." fi echo "WARNING: root is targeted by password guessing attacks, pubkeys are safer." while :; do ask "Allow root ssh login? (yes, no, prohibit-password)" no _resp=$resp case $_resp in y|yes) sshd_enableroot=yes ;; n|no) sshd_enableroot=no ;; w|p|without-password|prohibit-password) sshd_enableroot=prohibit-password ;; *) echo "'$resp' is not a valid choice." $AUTO && exit 1 continue ;; esac break done } set_timezone() { local _zonefile=$1 _zonepath _zsed _zoneroot=/usr/share/zoneinfo [[ ! -f $_zonefile ]] && return [[ -n $TZ ]] && return if [[ -h /mnt/etc/localtime ]]; then TZ=$(ls -l /mnt/etc/localtime 2>/dev/null) TZ=${TZ#*${_zoneroot#/mnt}/} fi waitcgiinfo isin "$CGI_TZ" $(<$_zonefile) && TZ=$CGI_TZ [[ $_zonefile = /var/tzlist && -z $TZ ]] && return while :; do ask "What timezone are you in? ('?' for list)" "$TZ" _zonepath=${resp%%*(/)} case $_zonepath in "") continue ;; "?") grep -v /. $_zonefile | showcols continue ;; esac while isin "$_zonepath/" $(<$_zonefile); do ask "What sub-timezone of '$_zonepath' are you in? ('?' for list)" _zsed=$(echo $_zonepath/ | sed 's,/,\\/,g') resp=${resp%%*(/)} case $resp in "") ;; "?") sed -n "/^$_zsed/{s/$_zsed//;/\/./!p;}" $_zonefile | showcols;; *) _zonepath=$_zonepath/$resp;; esac done if isin "$_zonepath" $(<$_zonefile); then TZ=${_zonepath#$_zoneroot} return fi echo -n "'${_zonepath}'" echo " is not a valid timezone on this system." done } get_rootinfo() { while :; do echo "Available disks are: $(get_dkdevs | sed 's/^$/none/')." _ask "Which disk is the root disk? ('?' for details)" \ $(get_dkdevs | sed 's/ .*//') || continue case $resp in "?") diskinfo $(get_dkdevs) ;; '') ;; *) isin "$resp" $(get_dkdevs) && break echo "no such disk" ;; esac done makedev $resp || exit ROOTDISK=$resp ROOTDEV=${ROOTDISK}a SWAPDEV=${ROOTDISK}b } ifstart () { local _hn=$1 if=${1#/mnt/etc/hostname.} ((NIFS++)) while :; do if [ "$cmd2" ]; then set -- $cmd2 af=$1 name=$2 mask=$3 bcaddr=$4 ext1=$5 cmd2= i=1 while [ i -lt 6 -a -n "$1" ]; do shift; let i=i+1; done ext2="$@" else read af name mask bcaddr ext1 ext2 || break fi case "$af" in "#"*|"!"*|"bridge"|"") continue ;; "dhcp") [ "$name" = "NONE" ] && name= [ "$mask" = "NONE" ] && mask= [ "$bcaddr" = "NONE" ] && bcaddr= dhcpif="$dhcpif $if" cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 down" if [[ -x /sbin/dhclient ]]; then cmd="$cmd; dhclient $if" else cmd="$cmd; echo /sbin/dhclient missing - skipping dhcp request." fi ;; "rtsol") if ifconfig $if inet6 >/dev/null 2>&1; then rtsolif="$rtsolif $if" cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 up" else cmd="$cmd; echo no INET6 support - skipping rtsol request." fi ;; *) read dt dtaddr if [ "$name" = "alias" ]; then alias=$name name=$mask mask=$bcaddr bcaddr=$ext1 ext1=$ext2 ext2= else alias= fi cmd="ifconfig $if $af $alias $name" case "$dt" in dest) cmd="$cmd $dtaddr" ;; *) cmd2="$dt $dtaddr" ;; esac case $af in inet) if [ ! -n "$name" ]; then echo "/etc/hostname.$if: inet alone is invalid" return fi [ "$mask" ] && cmd="$cmd netmask $mask" if [ "$bcaddr" -a X"$bcaddr" != "XNONE" ]; then cmd="$cmd broadcast $bcaddr" fi [ "$alias" ] && rtcmd=";route -qn add -host $name 127.0.0.1" ;; inet6) if [ ! -n "$name" ]; then echo "/etc/hostname.$if: inet6 alone is invalid" return fi [ "$mask" ] && cmd="$cmd prefixlen $mask" cmd="$cmd $bcaddr" ;; *) cmd="$cmd $mask $bcaddr" ;; esac cmd="$cmd $ext1 $ext2$rtcmd" rtcmd= ;; esac eval "$cmd" done <$_hn } enable_network() { local _f _gw _trunks _svlans _vlans for _f in dhclient.conf resolv.conf resolv.conf.tail; do if [[ -f /mnt/etc/$_f ]]; then cp /mnt/etc/$_f /etc/$_f fi done ifconfig lo0 inet 127.0.0.1/8 for hn in /mnt/etc/hostname.*; do if=${hn#/mnt/etc/hostname.} if isin "${if%%+([0-9])}" $(ifconfig -C); then case ${if%%+([0-9])} in trunk) _trunks="$_trunks $hn";; svlan) _svlans="$_svlans $hn";; vlan) _vlans="$_vlans $hn";; esac else ifconfig $if >/dev/null 2>&1 && ifstart $hn fi done for hn in $_trunks $_svlans $_vlans; do ifstart $hn done [[ -n $rtsolif ]] && ifconfig $rtsolif inet6 autoconf [[ -z $dhcpif ]] && stripcom /mnt/etc/mygate | while read _gw; do [[ $_gw == @(*:*) ]] && continue route -qn delete default >/dev/null 2>&1 route -qn add -host default $_gw && break done [[ -z $rtsolif ]] && stripcom /mnt/etc/mygate | while read _gw; do [[ $_gw == !(*:*) ]] && continue route -qn delete -inet6 default >/dev/null 2>&1 route -qn add -host -inet6 default $_gw && break done route -qn add -net 127 127.0.0.1 -reject >/dev/null } startcgiinfo() { ((NIFS < 1)) && return set -m ( ftp -Vao - "http://129.128.5.191/cgi-bin/ftplist.cgi?path=$HTTP_SETDIR" \ 2>/dev/null >$CGI_INFO echo -n $SECONDS >$HTTP_SEC feed_random ) & CGIPID=$! set +m (sleep 12; kill -INT -$CGIPID >/dev/null 2>&1) & } munge_fstab() { local _dev _mp _fstype _opt _rest while read _dev _mp _fstype _opt _rest; do [[ $_dev == @(/dev/vnd*|\#*) || $_fstype == nfs || ! -f /sbin/mount_$_fstype || $_opt == *noauto* || $_opt == *xx* ]] && continue _opt=$(echo $_opt | sed 's/softdep//') if [[ $_fstype == ffs ]]; then _opt=$(echo $_opt | sed 's/[[:<:]]ro[[:>:]]/rw/') else _opt=$(echo $_opt | sed 's/[[:<:]]rw[[:>:]]/ro/') fi echo $_dev /mnt${_mp%/} $_fstype $_opt $_rest done /etc/fstab if [[ ! -s /etc/fstab ]]; then echo "Unable to create valid /etc/fstab." exit fi } check_fs() { local _dev _dn _mp _fstype _rest _fail _f _passno ask_yn "Force checking of clean non-root filesystems?" && _f=f while read _dev _mp _fstype _rest _rest _passno _rest; do _dn=$(get_dkdev_name "$_dev") [[ $ROOTDEV == @(${_dev#/dev/}|$_dn${_dev##*.}) ]] && continue [[ -f /sbin/fsck_$_fstype ]] || continue makedev "$_dn" || continue ((_passno > 0)) || continue echo -n "fsck -${_f}p $_dev..." if ! fsck -${_f}p $_dev >/dev/null 2>&1; then echo "FAILED. You must fsck $_dev manually." _fail=y else echo "OK." fi done /dev/random 2>&1 if [[ -e /mnt/var/db/host.random ]]; then dd if=/mnt/var/db/host.random of=/dev/random bs=65536 count=1 \ status=none fi } install_sets() { local _cddevs=$(get_cddevs) _d=$CGI_METHOD _locs="disk http" _src echo ifconfig netboot >/dev/null 2>&1 && : ${_d:=http} [[ -n $_cddevs ]] && : ${_d:=cd0} [[ -x /sbin/mount_nfs ]] && _locs="$_locs nfs" : ${_d:=http} if ! isin "$_d" $_cddevs $_locs; then for _src in http $_cddevs nfs disk; do isin "$_src" $_cddevs $_locs && _d=$_src && break done fi echo "Let's $MODE the sets!" while :; do _cddevs=$(get_cddevs) umount -f /mnt2 >/dev/null 2>&1 ask "Location of sets? (${_cddevs:+$_cddevs }$_locs or 'done')" "$_d" case $resp in done) sane_install && return ;; [cC]*) if [[ -n $_cddevs ]]; then set -- $_cddevs [[ $resp == [cC]?([dD]) ]] && resp=$1 install_cdrom $resp && INSTALL_METHOD=$resp fi ;; [dD]*) install_disk && INSTALL_METHOD=disk ;; [hH]*) isin http $_locs && install_http && INSTALL_METHOD=http ;; [nN]*) isin nfs $_locs && install_nfs && INSTALL_METHOD=nfs ;; *) $AUTO && echo "'$resp' is not a valid choice." && exit 1 ;; esac [[ -n $INSTALL_METHOD ]] && _d=$INSTALL_METHOD sane_install quiet || $AUTO && _d=done done } apply() { if [[ $sshd == n ]]; then echo "sshd_flags=NO" >>/mnt/etc/rc.conf.local elif [[ -n $sshd_enableroot ]]; then if ! grep -q "^#PermitRootLogin $sshd_enableroot\$" \ /mnt/etc/ssh/sshd_config; then sed -i "s/^#\(PermitRootLogin\) .*/\1 $sshd_enableroot/" \ /mnt/etc/ssh/sshd_config fi fi [[ -n $aperture ]] && echo "machdep.allowaperture=$aperture # See xf86(4)" \ >>/mnt/etc/sysctl.conf [[ $xdm == y && -x /mnt/usr/X11R6/bin/xdm ]] && echo "xdm_flags=" >>/mnt/etc/rc.conf.local if [[ $defcons == y ]]; then cp /mnt/etc/ttys /tmp/ttys sed -e "/^$CTTY/s/std.9600/std.${CSPEED}/" \ -e "/^$CTTY/s/unknown/vt220 /" \ -e "/$CTTY/s/off.*/on secure/" /tmp/ttys >/mnt/etc/ttys [[ -n $CPROM ]] && echo "stty $CPROM $CSPEED\nset tty $CPROM" >>/mnt/etc/boot.conf fi ln -sf /usr/share/zoneinfo/$TZ /mnt/etc/localtime } encr_pwd() { local _p=$1 if [[ -z $_p ]]; then echo '*' elif [[ $_p == \$2?\$[0-9][0-9]\$* && ${#_p} > 40 || $_p == '*************' ]]; then echo "$_p" else encrypt -b a -- "$_p" fi } store_random() { dd if=/dev/random of=/mnt/var/db/host.random bs=65536 count=1 \ status=none dd if=/dev/random of=/mnt/etc/random.seed bs=512 count=1 status=none chmod 600 /mnt/var/db/host.random /mnt/etc/random.seed } finish_up() { local _dev _mp _fstype _rest if [[ -x /mnt/sbin/swapctl ]]; then /mnt/sbin/swapctl -a /dev/$SWAPDEV >/dev/null 2>&1 while read _dev _mp _fstype _rest; do [[ $_fstype == swap ]] && /mnt/sbin/swapctl -a $_dev >/dev/null 2>&1 done $/\1/p') md_installboot $ROOTDISK if [[ -f /mnt/bsd.mp ]] && ((NCPU > 1)); then echo "Multiprocessor machine; using bsd.mp instead of bsd." mv /mnt/bsd /mnt/bsd.sp 2>/dev/null mv /mnt/bsd.mp /mnt/bsd fi [[ $MODE == upgrade ]] && echo "/usr/sbin/sysmerge -b" >>/mnt/etc/rc.sysmerge echo "/usr/sbin/fw_update -v" >>/mnt/etc/rc.firsttime prep_root_mail /tmp/$MODE.resp "$(hostname) $MODE response file" store_random cat <<__EOT CONGRATULATIONS! Your OpenBSD $MODE has been successfully completed! To boot the new system, enter 'reboot' at the command prompt. __EOT [[ $MODE == install ]] && cat <<__EOT When you login to your new system the first time, please read your mail using the 'mail' command. __EOT md_congrats $AUTO && >/ai.done } do_install(){ ask_until "System hostname? (short form, e.g. 'foo')" "$(hostname -s)" [[ ${resp%%.*} != $(hostname -s) ]] && hostname "$resp" THESETS="$THESETS site$VERSION-$(hostname -s).tgz" echo donetconfig ((NIFS)) && startcgiinfo echo while :; do askpassword "Password for root account?" _rootpass="$_password" [[ -n "$_password" ]] && break echo "The root password must be set." done rootkey= if $AUTO; then ask "Public ssh key for root account?" none [[ $resp != none ]] && rootkey=$resp fi questions user_setup ask_root_sshd set_timezone /var/tzlist echo get_rootinfo DISKS_DONE= FSENT= rm -f /tmp/fstab* while :; do if ! isin "$ROOTDISK" $DISKS_DONE; then resp=$ROOTDISK rm -f /tmp/fstab else ask_which "disk" "do you wish to initialize" \ '$(get_dkdevs_uninitialized)' done [[ $resp == done ]] && break fi _disk=$resp configure_disk $_disk || continue DISKS_DONE=$(addel $_disk $DISKS_DONE) done for _mp in $(bsort $FSENT); do _pp=${_mp##*!} _mp=${_mp%!*} echo -n "$_pp $_mp ffs rw" [[ $_mp == / ]] && { echo " 1 1"; continue; } echo -n ",nodev" case $_mp in /sbin|/usr) ;; /usr/bin|/usr/sbin) ;; /usr/libexec|/usr/libexec/*) ;; /usr/local|/usr/local/*) ;; /usr/X11R6|/usr/X11R6/bin) ;; *) echo -n ",nosuid" ;; esac echo " 1 2" done >>/tmp/fstab munge_fstab mount_fs "-o async" feed_random install_sets _mp=$(df /mnt/usr/local | sed '$!d') _mp=${_mp##*/mnt} sed -i "s#\(${_mp:-/} ffs rw\)#\1,wxallowed#" /tmp/fstab if [[ -z $TZ ]]; then (cd /mnt/usr/share/zoneinfo ls -1dF $(tar cvf /dev/null [A-Za-y]*) >/mnt/tmp/tzlist ) echo set_timezone /mnt/tmp/tzlist rm -f /mnt/tmp/tzlist fi if _time=$(http_time) && _now=$(date +%s) && (( _now - _time > 120 || _time - _now > 120 )); then _tz=/mnt/usr/share/zoneinfo/$TZ if ask_yn "Time appears wrong. Set to '$(TZ=$_tz date -r "$(http_time)")'?" yes; then date $(date -r "$(http_time)" "+%Y%m%d%H%M.%S") >/dev/null fi fi if [[ -s $HTTP_LIST ]]; then _i=${INSTALL_URL:+install=$INSTALL_URL&} _i=$_i${TZ:+TZ=$TZ&} _i=$_i${INSTALL_METHOD:+method=$INSTALL_METHOD} _i=${_i%&} [[ -n $_i ]] && ftp -Vao - \ "http://129.128.5.191/cgi-bin/ftpinstall.cgi?$_i" >/dev/null 2>&1 & fi sed "/^console.*on.*secure.*$/s/std\.[0-9]*/std.$(stty speed /tmp/ttys mv /tmp/ttys /mnt/etc/ttys echo -n "Saving configuration files..." (cd /var/db; for _f in dhclient.leases.*; do [[ -f $_f ]] && mv $_f /mnt/var/db/. done) hostname >/tmp/myname echo "127.0.0.1\tlocalhost" >/mnt/etc/hosts echo "::1\t\tlocalhost" >>/mnt/etc/hosts if [[ -f /tmp/hosts ]]; then _dn=$(get_fqdn) while read _addr _hn _aliases; do if [[ -n $_aliases || $_hn != ${_hn%%.*} || -z $_dn ]]; then echo "$_addr\t$_hn $_aliases" else echo "$_addr\t$_hn.$_dn $_hn" fi done >/mnt/etc/hosts rm /tmp/hosts fi _f=dhclient.conf [[ -f /tmp/$_f ]] && { cat /tmp/$_f >>/mnt/etc/$_f; rm /tmp/$_f; } (cd /tmp; for _f in fstab hostname* kbdtype my* ttys *.conf *.tail; do [[ -f $_f && -s $_f ]] && mv $_f /mnt/etc/. done) echo "done." apply if [[ -n $user ]]; then _encr=$(encr_pwd "$userpass") _home=/home/$user uline="${user}:${_encr}:1000:1000:staff:0:0:${username}:$_home:/bin/ksh" echo "$uline" >>/mnt/etc/master.passwd echo "${user}:*:1000:" >>/mnt/etc/group echo ${user} >/mnt/root/.forward _home=/mnt$_home mkdir -p $_home (cd /mnt/etc/skel; cp -pR . $_home) (umask 077 && sed "s,^To: root\$,To: ${username} <${user}>," \ /mnt/var/mail/root >/mnt/var/mail/$user ) chown -R 1000:1000 $_home /mnt/var/mail/$user sed -i -e "s@^wheel:.:0:root\$@wheel:\*:0:root,${user}@" \ /mnt/etc/group 2>/dev/null [[ -n "$userkey" ]] && print -r -- "$userkey" >>$_home/.ssh/authorized_keys fi if [[ -n "$_rootpass" ]]; then _encr=$(encr_pwd "$_rootpass") sed -i -e "s@^root::@root:${_encr}:@" /mnt/etc/master.passwd 2>/dev/null fi pwd_mkdb -p -d /mnt/etc /etc/master.passwd [[ -n "$rootkey" ]] && ( umask 077 mkdir /mnt/root/.ssh print -r -- "$rootkey" >>/mnt/root/.ssh/authorized_keys ) finish_up } do_upgrade(){ get_rootinfo while :; do ask "Root filesystem?" $ROOTDEV resp=${resp##*/} [[ -b /dev/$resp ]] && break echo "$resp is not a block device." done ROOTDEV=$resp echo -n "Checking root filesystem (fsck -fp /dev/$ROOTDEV)..." fsck -fp /dev/$ROOTDEV >/dev/null 2>&1 || { echo "FAILED."; exit; } echo "OK." echo -n "Mounting root filesystem (mount -o ro /dev/$ROOTDEV /mnt)..." mount -o ro /dev/$ROOTDEV /mnt || { echo "FAILED."; exit; } echo "OK." for _f in /mnt/etc/{fstab,hosts,myname}; do [[ -f $_f ]] || { echo "No $_f!"; exit; } cp $_f /tmp/${_f##*/} done hostname $(stripcom /tmp/myname) THESETS="$THESETS site$VERSION-$(hostname -s).tgz" enable_network startcgiinfo munge_fstab check_fs umount /mnt || { echo "Can't umount $ROOTDEV!"; exit; } mount_fs feed_random install_sets finish_up } AUTO=false MODE= PROGNAME=${0##*/} RESPFILE= while getopts "af:m:" opt; do case $opt in a) AUTO=true;; f) RESPFILE=$OPTARG;; m) MODE=$OPTARG;; *) usage;; esac done shift $((OPTIND-1)) (($# == 0)) || usage if [[ -z $MODE ]]; then case $PROGNAME in autoinstall) AUTO=true;; install|upgrade) MODE=$PROGNAME;; *) exit 1;; esac fi . install.md rm -df /tmp/lock rm -f /tmp/update if ! $AUTO; then ( while :; do lock if [[ -e /tmp/update && "$(dmesg)" != "$(/tmp/update kill -TERM 2>/dev/null $$ || exit 1 fi unlock sleep .5 done ) |& CPPID=$! retrap fi AI_MODE= AI_SERVER= ROOTDISK= ROOTDEV= PACKAGE_PATH= SETDIR="$VNAME/$ARCH" CGI_INFO=/tmp/cgiinfo CGI_TZ= CGI_TIME= CGI_METHOD= INSTALL_URL= INSTALL_METHOD= HTTP_DIR= HTTP_SEC=/tmp/httpsec HTTP_LIST=/tmp/httplist WLANLIST=/tmp/wlanlist for _opt in d f l m n p s; do ulimit -$_opt unlimited done dmesg | sed -n '/^OpenBSD /h;/^OpenBSD /!H;${g;p;}' >/var/run/dmesg.boot HTTP_SETDIR=$SETDIR set -- $(scan_dmesg "/^OpenBSD $VNAME\([^ ]*\).*$/s//\1/p") [[ $1 == -!(stable) ]] && HTTP_SETDIR=snapshots/$ARCH MTDEVS=$(scan_dmesg "${MDMTDEVS:-/^[cms]t[0-9][0-9]* /s/ .*//p}") NIFS=0 DISPLAY=$(scan_dmesg '/^wsdisplay[0-9]* /s/ .*//p') CONSOLE=$(scan_dmesg '/^\([^ ]*\).*: console$/s//\1/p') CONSOLE=${CONSOLE% } [[ -n $CONSOLE ]] && CSPEED=$(stty speed /dev/null 2>&1 for _if in $(get_ifs dhcp); do set -- $(v4_info $_if) [[ $1 == UP && -n $2 ]] && continue ifconfig $_if delete down -group dhcp 2>/dev/null done if ! $AUTO; then cat <<__EOT At any prompt except password prompts you can escape to a shell by typing '!'. Default answers are shown in []'s and are selected by pressing RETURN. You can exit this program at any time by pressing Control-C, but this can leave your system in an inconsistent state. __EOT elif [[ -z $RESPFILE ]]; then if ! get_responsefile; then echo "No response file found; non-interactive mode aborted." exit 1 fi rm -f /ai.done echo "Performing non-interactive $AI_MODE..." /$AI_MODE -af /ai.$AI_MODE.conf 2>&1 ct-c;c $0@9t-cT &t-cT &t-cT &V(\T(dT(HT( 9 &&,ct-ct%ؼ%t% %%%P&dd&hd&<.cd8ffs8ext2fsW8cd9660l8msdos2lockf@`  d&d& d&%&&4&% ' '''' '`'d&d& d&t''0'c&d& 't'"'T '''t'Pd&t'#'4''p'%'t't'%t't'd&t't'''t'p)'t'-'d& d&-',','<.'%%-'%,'%T-'-'Pd&-',',','.'-',','%-'-'-'-','.'-'-'. .. T'0' 'd&l'''d&`'''l'4C'<''Po'P'4'X'D'''Ī'P'(='̏'p'd&'l'H''t''Љ'H''H''H'X' ܻ''x''$'9T2c @(`2ct('$(2c''^^333394(3(   ʚ;  ʚ;ʚ;ʚ;@B T T T T T@B@B@KLا O [ @T  6nQ%l7J.c@])Su|@@]Su/ 2!@G"#)$S%|&/'@G(_L )u *v +,u-/.2/_L 0e 1 2I34S5u6@7|8/9`:u;@<@=/>l?l@2A/B`C`D@GE "F "G_L H@I/JlK/LlM2N@GO2P@GQRST`U@GV "W@GX "Y_L Zu [_L \u ]v ^v _ pp@@@@   j  j  j @ p\(\;c;c ((\T(|((HT((9<~(;c;cd,2>cT2*#*p#**>cC**|B**4**>cl*̾******>cY* X*DV*X\*>c * X*DV*X\*l**>c0+ X*DV*X\*t+>c)0+ X*DV*X\*>cT) X*DV*X\*,)d))d)>cY* X*DV*X\*Y*$9Hc dXL>cP>cX>c\>cT>c<8Q @X,>c>c>c>c4c>c>c>c>c>c>c>c>c>c>c>c>c>c>c h;c>?? ' ` ~ ^ "' ,AAA AA'CEEEEIIIINOOOOOUUUUYaaaa aa'ceeeeiiiinooooouuuuyy"A"E"I"O"U"a"e"i"o"u"yA^A`A*A~ACE^E`EI^I`I~NO^O`O~OU^U`UYa^a`a*a~ace^e`ei^i`i~no^o`o~ou^u`uy:8`4@4Բ4h44 4444غ4d4`4C9D44444|4L4 444 4444????@`px|~ 08<>????????????????????????? @`px|~ 08<>????????????????? @`px|~ 08<>????????? @`px|~ 08<>? Boldface.iso1 c@cwfllllllll||| 0 `F8ll8vv0 000000 0 0f<0p000x6 0>p00p>p|`08l 8llF`0| 0| /t> Y> /> Y? /(? Y@ /@ Y D /PD YD /D Y!/D>!Y@!/@!YC!/C!Y(H!/`H!YI!/I!YK!/$K!YxK!/|K!YL!/ L!YM!/$M!YhO!/pO!YQ!/ Q!YR!/R!YDT!/LT!YT!/T!YU!/U!YLW!/XW!YX!/ X!YZ!/ Z!Y|_!/_!Y_!/_!Y`!/`!Y4d!/Pd!Yd!/d!Yj!/j!Ym!/m!Ys!/s!Yu!/u!YTw!/tw!Y8{!/\{!Y@}!/L}!Y~!/~!Y!/h!Y!/!Y!/!Y!/!Y!/P!Y!Y;/!Yp!/x!Y!/!Y!/$!Y|!/!YĨ!/Ȩ!Y!/!Yt!/|!Y!/!Y!/б!Y!/@!YD!/X!Y̾!/о!Y0!/4!Y!/!Y@!/D!Y8!/8"/8"Y"/"Yh"/l"Y"/"YH"/T"YD!"/P!"Y@%"/L%"Y&"/&"Y<*"NdW8 /L*"YP/"/X/"Y/"W//"Y0"/0"Y3"apW8 /,3"YpW8tzD3"/D3"Y5"W8W85"/5"6"p YA"W8 /(A"YlA"/tA"YA"/A"YB"/ B"YB"/B"YD"/D"Y`E"c hE"/hE"Y,F"ȧcc@,c0cDF"/DF"YF"/F"YH" c/H"Y8J"/XJ"YtL"/|L"YL"/L"YN"/$N"YLcYW8/hN"'/8O"YX"7/X"YZ"EZ"</Z"Y\"/\"Y0]"/4]"Y]"/]"Y ^"/^"Uc$a"/$a"v#/?#YG#Pc "Dc /G#YhH#/pH#YI#Yl$c0/I#YlI#/tI#YI#/I#Y@J#/HJ#YJ#Y$c?KYJ#@/J#YdK#/tK#YL#/M#YM#d\ch/M#YN#/N#YP#/P#YpQ#s/tQ#YQ#/Q#YpR#/tR#YS#@Y8P/S#YT#/T#YHT#/LT#Y@Y8/T#YW#/W#YlX#/tX#YX#/X#Y(Y#/0Y#YxY#|Y#/|Y#Y`[#/h[#Y]#/]#Y^#/^#Y^#/^#Y`#/`#Ye#/e#Ye#/e#Yh#/h#Yli#/ti#/Pu#Yv#/v#Yx#/(x#Yy#/y#Y z#/z#Y0z#/4z#Yz#c/z#Y,}#/H}#Y~#/~#Y#/ #YH#Y$c/L#YĂ#/̂#Y#/#Y#/#Y,#c8t/0#YȌ#\e8/Ԍ#Y#/ #Yt#/#YL#/T#Y#/#Y#/ #Y#/ȥ#YY8/#Y#/#Y#/#Y# c/#Y#/#Yh#/l#Yȩ#/̩#Y(#/,#Y#/#Y#/$#Y4#/8#Yԫ#/ث#Y#/#Y#/#YH#c/\#YȮ#/Ю#Y #/#Yt#/x#Y#/#YL#/d#YP#/X#Y#-/#Y#/#Y#/#Yܷ#/#Y(#/,#Y#/#Yؼ#/ܼ#Y$#/(#Y4#/P#YD#/H#Y#/#Y#/#Y#/#Y#/#Y@#/L#YP#/T#Y$#/(#Y`#/d#Y#/#Y#/#Yh#/x#YX#/\#Y#8c/#Y`#/d#Y#Y$cK/#Y#/#YL#YL%cW/P#Y#/ #Y#/#Y#/#Y0#/#Yt#/#Y#/#Y#/\#Y#/#Yp#/#Y$YT%ce/$$YH$/L$Y$/$Y$rp%c/$Y $/($Yd$/h$Y$/$Y$c/$Y$/$Y$/$Y8$/<$YT$/X$Y8 $/D $Y $/ $YD $/P $Yd $c/h $Y $%c/ $Y $/ $Y $/ $Yd$c/t$Y4$/D$Y$/$Yt$%c/$Y`$/h$Y$/$Y $c/$Y$c/$Y0$c/8$Y@$/\$Y$/$Y $/$Y$/$Y$/$Y$/$YP$/T$Y$/$Y$/$YL$/P$Y$Yt%c%c,%cH&cHL&cH &cH &cH$'cHl'cH'cH'cH!D(cH%/$Y$/$Y$/$Y$/$Y $/ $Y"$/"$Y@$$/D$$Y&$/&$Yd'$/l'$Y($/($Y|*$1c/*$Y`+$/h+$Y+$/+$Y /$/4/$Y0$/0$Yx1$/|1$Y(c@/1$Y 2$/2$Y(3$/D3$Yd5$/x5$Y5$/5$Y6$/6$Y 7$/$7$Yx7$/|7$Y7$/7$Y08$/48$Y8$/8$Y9$/9$Y@:$Y(cO/H:$[/8<$Y=$/=$YP?$/\?$Y@$/@$Y@$/@$Y@$/@$YhA$/lA$YB$Y(cYf8g/B$YC$/ C$r/C$}/C$YD$/ D$YD$/D$Y|G$/G$YH$/ H$Y`H$/dH$YI$/I$Y&YL?&/T?&Yx@&/@&YD&/D&Y`E& /lE&YE&/F&YDF&/HF&Y0H&/V(t/(Y<(]p8b@(8/@(Yt(/x(Y(/(Y(/(Y((i/,(YT(/\(Y(/(Y(/(Y(/(Y(r8r8/(Y((/@(Y(/(Y(r8r8/(Y8(/<(YP)r8/l)Y` )r8/l )Yl )r8 /t )Y)/)Y )/0)Y)/)Y)/)Y$)/,)YD)/P)Y@)/D)Y )/ )/&)Y')/')Yt))/))Y8)r8/9)Yx9)/9)YdD)/lD)YD)/D)YH)/H)Y,J)/8J)YM)/M)YtO)/|O)YHR)/XR)Y S)/S)YS)/S)YT)r8/T)/T)YU)+r8 /U)YV)/V)YY)/Y)YtZ)9r8/xZ)Y`[)/[)Y^)Cr8Mr8/^)Y_)Wr8/ _)Y_)/_)Yb)/ b)Yf)/f)Yh)/h)Yj)/j)YXm)/lm)Yo)Yr8a/o)Yt)/$t)Y{)wr8/{)Y<)r8r8/T)Y)r8/)/)Yx)/|)YԌ)/،)Y)/)Y)/ )Yt)/|)Y)/Ē)Y)/)Y)/)Y8)/@)Y)/,)Yh)/|)Y)/К)Y)/)Y)/)Y)Ls8/)Y)/)Y)/)Yx)/|)Y )/)Y)Yr8/)Y@)/T)/)YH)`s8p/P)Y){8P/)Y)/)Y@)/D)Yܦ)#x8L/)Y8)/<)Yds83/T)YX)/\)Y4)/8)YX)/`)Y)/)Y)/)Y)/)Yp)/|)Y)/)Y)/)Y,)/8)Y)> cOx}8/)Y@)]l}8 Y;ck/d)Y)/)Y4)r(c/@)Y)/)Y`)$c/d)Yľ)/̾)Y\)/`)Y)/)YD)/H)Y)/)YD)/T)Y)/)Yp)/t)Y()/,)Y)}8 /)Y)/)Y)/)YD)/L)Y)/)Y)/)Y$)/@)YX)/l)Y)/)Y)/)YD)/H)Y)/)Y)/ )Y)/)Y)/)Y\)/`)YT)/X)Y )/)Yh)/p)Y)/)Y)/)Y4c,c /)Y$)/0)Yh*}8/l*Y*>c/*Y*/*Yd*/l*Y*/*Y*/*Y */ *Y */ *Y*/*YT>c/H*Y*8c4cG/ *YL*Rc/5*Y8*/8*Y09*/49*Y;*/;*Y@*/@*YC*/lD*YE*/F*Y0/>0Y>0/>0YD?0/H?0Y@0/@0YA0/A0YB0/B0YC0PNc\8 /C0Y4D0/TD0YF0/F0YH048 /H0YJ0/J0YK0/L0Yg%D9>q%/P1Y1/1{%1(YH 1%L 1D/L 1% 10Y1%1/1%L1LY1/1Y1%9x/1Y1%1/1Yt$1%$1T/$1Y(1%(1/(1Y*1/*1YP,1/T,1Y /1/,/1Y9%/d/1Yl/1/p/1Y/1Y89&//1&&/1//1YD01/\01Y01%&`Nc3&tNcA&NcP&01l/01Y821[&@21L/@21Y31e&31/31Y91/ :1Y:1o&;1/;1Y@1~&l 9t& 9t&T 9x& 9x&0@1h/0@1Y|F1&F1/F1Y0G1/8G1YI1&`9&J1/J1YJ1/J1YK1/L1YtR1&X 9& 9xYl 9Y`Nc&D 9L&/R1YLS1/PS1'/S1-'/V1YTX1/dX1YY1YNc7'/Y1YY1='g/Y1YX[1/\[1Yd\1B'Oc/h\1Y]1/]1Y@]1/D]1Y^1/^1YX`1/``1Ya1/a1Y@a1/Da1Y0b1/4b1Yb1/b1Yc1/c1Y e1/e1Ye1/e1Ye1/e1Ypf1/xf1Yf1/f1Yj1/j1Yl1/l1Ym1/m1Y@n1/Hn1Ypn1/tn1Yn1/n1Yo1N'/o1Y,p1/0p1Yp1/p1Yp1/q1Yhq1Y'g'tq1/tq1z'|q1(Y Oc'/q1''xt1't1/t1(t1'(t1?(t1W(t1o(t1(t1(t1(u1(u1( u1)0u1)@u12)Pu1K)`u1d)pu1})u1)u1)u1)u1)u1)u1*u1,*u1E*v1^*v1w* v1*0v1*@v1*Pv1*`v1*pv1 +v1&+v1?+v1W+v1o+v1+v1+/v1Y4w1+/8w1Yw1+Yw1/w1Y0x1/@x1Yx1/x1Yy1/y1Y(z1/8z1Yz1/z1Y{1/{1Y|1/$|1Yl|1/|1YH}1/X}1+Y\~1/`~1+/x1Y1/1Y1,ȏg,̏g1,ďgY4OcE,/81l,/܂1,/1YOcYԃ1/1,/1,/d1Yĉ1,/ 9Y 9 - 9YOc-/ȉ1Y1-/1Y 1/$1YT1)-Џg 0-`1|/`1Y̌1/܌1Y81/L1<-/1Y̏1_-/1Yx1/1Y1/1Y1/1Y1/1Y|1/1Y<1o-OcYOc-/H1-1Y1/ 1YX1/d1Yh1/p1Y\1/d1Yx1/|1Y|1/1Yh1/l1Y|1/1Y<1- 9-/X1Y1-<9@/1Y`1Y 9-|9@-9@-9@-<9@.|9@.Yh1/1;.Y1/Į1`.Ю1p.1.԰1Y1YOc.1/1.1.l1Yl1.p1/p1.x1.1/P1YP1'/Pc/T1K//1Y1S/1/1Y1]/9i/81L/81t/1`YX1/h1Y|1Y9~//1Y1/1Yh1/p1Yܻ1/1Y1//01Yܾ1/1Y1/1Y1/1YX1/g/\1Y$1/(1Yp1/1YD1/X1Y1/1Y<1/H1Yd1/l1YP1/T1Y41/H1Y1/1Y1/1Y1/1Y1/1Yx1/|1Y1/1YL1/1Y1/1Y1/1Yp1/t1Y1/1Y1/1Y 1/g/(1Y\1/,Pc/0Pc/h1Y1/ 1Y1/g/1Yp1/g/g/1Y`1/g(0g 0g0g)0gB0DgQ0܏g@ /1Y1/1Yl1/1Y1/1Y1/1Y`1/l1Y1/1Y1/1Y1/1Y41/D1Y1/1Y01/D1YT1/d1Y1/1Y1/1Y1`0<9@/81YT2/x2Y<2/T2Y2/2Y2/2Yt2/2Y2/2Yt2/2YT2/h2Y2/2Y 2o0gYPcY<90/!20/8!2Y,"2/H"2Y$2/H%2Y%2Y4Pc0/D&2Y&20/&2YX'2/d'2Y0(2/<(2Y@)20/H)20/)21)2'18*201)2;1,*2G1h*2S1t+2^1-2j1-2v1-21-21-21-21-21-21-21t-21h-21\-21P-21D-2 28-22,-2%2 -222-2?2-2L2,2Y2,2f2,2s2,22,22,22,22,22,22,22,22x,22l,22-23.23/4.23/`.2 3/|.2*3/.243//2=3/H/2F3//2O3//2Y3/(02c3/t02l3u312/12}3/223/223322X/22Y823@Pc3/823/923/H923/h923/923/92Y92/92Y,:2/0:2YD:2YDPc3/H:2Yx:2/:2Y:2/:2Y:2/:2Y;2/;2Yx<23oc/<2Y=2/>2Yd?2/?2YI24K2|/J2YK2/K2YPL24ocY oc"4/XL2YL2/L2YL2/L2YN2/N2Y$P2.4g:4|9@E49/XP2YP2/P2YR2/S2Y|S2/S2YS2/,T2YU2/U2Y,V2/TV2YV2/V2Y(W2/,W2YlX2/pX2YZ2/Z2Y_2K4|&9 /_2Y`2/`2Y(a2/,a2Ya2U4&9/a2Ya2/a2Ylb2/tb2Y`c2^4&9/hc2Y e2/$e2Y,f2/4f2Yf2/f2Y0g2/4g2Y8h2/909{c>9/3Y3/3Yl3/t3Y3K9gV90|c /3Y3/3Y3/3Y@3Y>9Y{c_94?9 o9T?9|9/x3Y3/3Y(3/03Y43/@3Y3/3Y3/3YH3/L3Yx3/|3Y3/3Y3/3Y3/3Y$3/(3Y39 g9d|c/ 3YT3/X3Y3/3Y3Y<|c9/3Y3/3Y3/3Y3/3YP3/T3Yx3/3Y3Yh|c9/3Yl3/p3Y3/3Y|c9/3Y03/43YL3/T3Y3/3Y3/3Y43/@3Y3/3Y(3/03Y3Y|c9/3Y3/3Y3/3Y4/ 4Y4/4YD4/H4Y`4/d4Y4/4Y\4/l4Y4/4Yp 4Y|cY@99/ 4YP 49g/` 4Y 4/4Yp4/t4Y4/4Y4/ 4Y4/4Yh4Y|cY,A99/4Y4/4Yx4/4Yd4/p4Y4/4Y49\}c9`}c :d}c/4Y4/4Y4/4Y4/4Yx4/|4Y 4/ 4Y!4/!4Y!4/!4Y$"4/,"4Y $4/$$4Y%4/0%4Yx&4/&4Y'4/'4Y(4/(4Y(4/(4Y,4Y4}c:/-4Yx54/54Y 64/864Y:4/:4Y=4/=4Y$>4/(>4Y?4:/?4Y?4%:}c 4:h}c /?4YB4Yh}cC:/B4YC4/ C4YC4Y}cN:/C4YE4/ E4YE4Y:/E4YDF4/HF4YF4/F4YXG4/`G4YH4/H4YH4/H4YHI4/LI4YJ4/J4YJ4/J4YJ4/J4YJ4/J4YLK4/XK4YLL4/PL4YM4/M4YM4/M4Y,N4/8N4YO4/$O4Y0P4/DP4YQ4/Q4YHR4/LR4YXS4/\S4YS4/S4YU4/U4Y V4/V4YtV4/xV4YZ4/0Z4YxZ4/|Z4Y[4/[4YP]4/h]4Y]4/^4Y^4/^4Y a4/a4Y c4/c4Ypf4/f4Yg4/g4Yti4/i4Yhj4Y}ce:/|j4Yk4/k4Ydm4/pm4Y8A9o:/m4Yn4/n4Yn4w:g:g: g(/n4Y,o4/4o4Yp4/ p4Y\q4/dq4Yr4/r4Ys4/s4Ytt4/t4Yy4/y4Yz4:~c:g/z4Y,{4/0{4Yp{4/t{4Y |4/(|4YL|4/P|4Y|4/|4Y|4/|4Y4/ԁ4YԂ4/4Yh4/l4Y܃4/4Y4/4Y\4/`4Y<4/@4YP4/l4Y4/4Y 4/ 4Y4Y(~c:/4YH4:HA9/L4Yh4/|4Y4/4YГ4/ܓ4YX4:~c:~c;/`4Y4/4Y 4/P4Yȡ4/̡4Yh4/l4Y4/4YЪ4/Ԫ4Y4/4Y4/4Y84/@4YȬ4/ج4Y4/4Y4/4Y@4Yc ;/X4Y4/$4YX4/\4Y4/4Yظ4/ܸ4Y04/44YD4/X4Yl4/4Y4/4Yԁc;/@4YT4";c/X4Y̿4Yc.;/п4Y4/4Y4/4Y4/4<;/4YH4/4Y44/L4Y4/P4Y4/x4Y4/4Yl4/4Y4/ 4Y4/4Y4/(4Y4/4Y4/4Y4YC9YcK;/4Y4/4YX4/4Y 4/4Y$4_;/|4Y,4t;C9 };D90/44Y4; E9; F9YD9;/$4Y4/`4Y4; G9`;G9;G9(Y G9;/|4Y4/4Y4/4Y 5/ 5Y5/5Y05/45Y5/P5Y5/5Y5;/5Y5;Y9>dZ9n)>Z9,9>Z9P>[9$`>2[9w>B[9>[9 >[9F>(\9>\9>]9d>^9>|`9 ?4a9$?La94?ba9D?a9Z?b9j?b9z?tc9?c9?d9?d9`?*e9?:f9?Lg9? h9 @@h9~@h9(@i9?@i9O@Bj9f@/5Y(5/,5Y5m@k9/5YT5@k9/X5Y5@"k9/5Y5@ k9/5Y5/5Y5/5YH5/5Y5YLj9YHc@/5Y5/5Y5/5YD5/H5Y5/<5Y85/P5Y5/5Y 5/,5Y5@pc/5Y5/5Y5/5Y5/5YT5Y\cY4k9@/5Y85/<5Y5Yhk9@/5Y5/5Y5/5Y5/5Y5/5Yx5/5Y(5/,5Y5Ytc@/5Y(5/,5Y5/5Y5/5Y5/5Y@5/D5Y85/<5YX5/\5YH5@r9 /T5Y05/45Y5/5Y`5/l5Yt5/x5Y5/5Y5/ 5Y5/5Yd5/h5Y5/5YD5/H5Yx5YcYr9A A5/5Y6As9 /6Y6/ 6Y6/6Y,6/46Y6/6Y|6/6Y 6/ 6Y 6/ 6YL6$As9/`6Y6/6Y\6/h6Y6/6Yd6/t6Yh6/x6Y$6/<6Y6YcYs9-A/6Y"67A t9 /"6Y,#6/0#6Y<&6AA,t9/T&6Y'6/'6Y(6/(6Y)6/)6Y.6/4.6Y16/26Y36/36Y 56/56Y66/66Y`76/d76Y:6/:6Y;6YcY t9JA/;6Y(?6TAHt9 /4?6Y?6^ATt9H/?6Y4A6/8A6YB6hAt9/B6YTC6/XC6YD6/D6YE6/E6Y\I6/I6Y`L6/L6Y$N6/0N6Y0O6/8O6YP6/P6YpS6/S6YT6/T6YU6/U6YPV6YĢcY4t9qA/XV6Y W6/,W6YX6/ X6YY6/Y6YZ6/Z6Y[6/[6Y]6zAt9 /]6Y^6/^6Y$_6/(_6Ya6/Ha6Yd6/d6Yf6/(f6Y h6/h6Yi6/i6Yk6YcYt9A/k6Y\l6/hl6Y0m6/F)IFp4]FncliF4c|F( /Fx.FA)XF$(F07LF-LFȉ1 F4t9Fb(G+G 'G8O62G+.?G zcLG>caG$clG~1vG5Ga#G(Gx.%8G8G,7\G4PcG((GLb%G%0 HB$,H%&H,;5H<(\HHh+$VH|s0hgHHcI@!I3I6I'@I"\Je5JF483Jl(AJA%$KJR,h[J+hJh#sJi)JT J GjJ|.2LJ0 'J$d/hJA(TJ&JH?0J2cJ viK) Kе0K5K,.K"8K82|DKCc$VK!oK%!,Kx pK  4KC/,KW)pK30KXC6Kl4<Kx"DK)L+LI!(5L4HLtr1^L(sL\&(L60LHZ3L L46PL}/L#4LܦcL4c"Ml',M$&:M&JM hSM,"4]MV2`oM86,yMhM&pM|5M2cMhM H$XM\;M$%0MX4M8cNXP2LN8# N %N$)NE6p8N'pDNX)$ON1`N.XrN"tN ;Nx+No2Nh;cN#N\"`Nd3!TN.lOЌ-O )\+O(~c4O18EO|7WO\&LrO08wOq1OK)@Oa0O$OgO( OT+LO1hOH)O P2 POc4Ph $EP+0TP "8]PDP4`nPP9 {PHc$P-P,)cP4PjP=jPt*XP1PDa1 QV1Q'6p)Q)XIQH_5D_Q7nQ3({Qo3Q3 Q+PQ*Q hQy4Q,&8QdF%4Q$Gj Q%8Q,J7 RC0`R')R`h3Rd$T@RDPc GRhv#PR!h@`R uR"7Rl.R0RgR.<R #TRԲ4R+cR{9RxY0S'S%8S0l&S$T%1S6!LBS@"KS h'DTSܑ6hS!hS!/PSh#S,S"DS$SH/2xS@4Sl%cS|1$dT4C7T@ *T83P:T;XCTOjRTs$H\T<5ThT*zTp7T2DT%(T4tT8)(T<#T@#PT t9T*!xT$UcU*%U52Udx'$AUd2UUh5loUd|$|U "dU1 U #PU3Uh1U"@Uj!U). Vl-V;c0'V`7 =V:5HV/TV0\bV'DlV1"DVآhV0$Vĥ3V@2V,$V|.DV2cV]7dVLy'V$ W3W$e2.WP6L?W*NWX$c^Wt.oW,|W`m5XW'hW-W4'4W^#<Wp#*HW@)lW<5`W4%X4.2, X?.(X<\7`+X|G33X`#@X(s"LXT`/]XdhmX. X.XW5$X 40X4& X/cXT)X&pX̏'X4"X<) Y#@#Y@ -Yah9YcCYP|48QY ,_YHB9`pYD.YY5@Y,5dYx3Yl.,Y<$tY42\Yhu9NYF"YDq3Zd0Z8$ZhBc7ZU6KZLjVZ8%cZt+ptZTL%<|Zp4(Z0dZ 'PZ{1ZX-8Z4lZ[4ZTn-Z-HZg(Z(#[!3[P@c'[ľ+3[",?[a4U[ga[c\+]0']<5%]th0]0%t;]#8K]\% Y]0 6a]68p]85}] w5$]>c]d(H]7]6]?%0]F5]|)l] 8`]4<^ #&^)2^8E^8HV^3Tr^0d$`~^]#^L0l^H.^}5^4$^'\^p'^"l^/^*c_H# _,W2L_|h)_84_d1XO_i]_)i_&@t_!_\{!_|c_0Gj_v1_'(_B"_7_k5X_E)|`cT#`6-`@49`cB`(8N`4^`cc>cc1c.cgc9)c(c(c2dXX)xd-d,,d*L8d&XBd+4OdD' \dl'kdx$wd2d7xd6d.dpm44dH.jx d4 d.ddgd\7e $he &H!e|'(0e 5@e\{i0IegUe6\_e;cieL*8l~ed1e@je$e$e {#ecj0kH3t k6hkLo5P'k4$;kQ7GkO*Qk$,bk'kk$czkc$Hks6tk,$pkH"/kd3`k3k.lk(k'4k| "8lT(3l $Tl% $lt"x4lX!CldI&Sl#algllH'yl 6@l((<l#llh2/l8lLhlQ!pl\%cl| "lg mt1m, &m!5m1FmP'Wm1tmmT(mo5Pmcm,X&hmOcm@$mĽ m$t-dm+(m,5m7n||cnKc)n`"L2n$K!X>nԣcFnu6`PnJ9^n1tnP n8@n7`n|"n)nL.nxu*n8 !,nc4@ olho,.,o!.;o ,&dBoDcLo;Oo^7,[oH08ko\"{o#0o$&,o oZ%oL%coT8o@jo(.$oi p t6pa(,p$9pt&HAp`7\Np1TYp jp7`xprcp|*7pd/1 p5TpH44pP2Dp(d&(p4p<%tp#dqHa#q`gq 9`&qp"p7q-Bq^1XLqd#ZqM&bql5oq`1qPU,qXu7hq86qȐ4q1q%8qHcq8O"qa#`r;.drh2<%rt&(X3r0'$Br hJr 1Wr$LcorL20|rH#XrX80r;*drT32r@jr3Tr#'Lr1r&0slBcs$'tsH !h*s(H4t>s-xMs^5d]su3,ms`?j ys(Lcs+sIcs5s/ sر.,stC$s$csԢ"8 t( "tj+ 2t"?tG#<It1$Zt(ocet.ptt90x{'xt& y .<#y%.yc9yPD Ay` 4Ky&Vy|6lgy3lxyp"0y %dyQ#0y)3y - y@(y(4 yPcy`4y z)  zZ(D,z[10:z7&Qzp"xXz3\nz8/Hzܻ'zlE&z+lz([(\z%,z.z)xz1\z6 {0<3!{ 381{cB{8AcP{ 5xd{3@x{@.l{T2c{d&{e+{Z6l{$6{hv1{)c{l"{tQ#|4|oc)|+9|0!@J|D _|.4n|&L|(Pj|t-|hW |7|܏2`|5|&4|#|(+@|;)8}-*}E/8}9&d@}:#xN}(\a}PG3,o}xu1})D}'}.c}$7\}G)d}dT(0}nc},5}hu1 ~\!~f%8 '~H0P-~j9 :~$1&hB~f1|Y~03 g~hhq~p/4~7x~0N6~Hc~o-~$T~&(~ X6~5~Fc~,%!"h,@,'@Z5hQ8\)7 j4.6v`9W&l`.2$8ܔ('T4*'tb68$H0L_2%u9-|y+L8P4, PH5h_t%f`!|4Gj<]530ԧhb5ˀahր!hc;';4lT6-),+41`j#=1XY m ;jwK(,Ԍ#`",)c :/` &Ёv.$߁-3A"g %@ "X/3@6T$`?;I 8]D>9p2؞6@)p N, ̂(ׂ0@|0pocm/4% 3\4(.A3`C(,^T=(\h'`rh'},'``"<45844$>cƒ$σQ$܃ &(!01̵% )p(H ؤ%*+:<'4Hا!aTz9h%tv3P!\Oj.h-0˄~&lфxv1:.,h@- 00 ,'!@j3܂9 ? JhT8R1XcL.pw+ ph`#pX(4x64|5l˅?4tօ(@.@l:/` ̾) )#62u1EhOh(`\&Lm \u 6P$<0'<+%|+&Ɇd7`ކ,5H,cH."$T8B'D1 J(cO%,X3 ns1~C5-#![(@"gƇL"Hч9 ݇X68zi6T*c @45D1/ C|)[2cq,]$Lc)X-,%<'͈c݈cJ4xT2  \(9  Pc:/+JHn#WN+X`^5 o76(Y.m4@0oc`0 ȉt PՉ32Dе-%@& 6#'p68t(M<',\HX5o*y H4+9x8Hj2'Hħ @ϊtBc׊t6x_5@/,&t "cкg(\$c 7ș%?%|J HUOc^s-(nHk9 Lj`1H4, x H&(7ɋt/ ՋX$#P6l4 )̖&%4D-l->Ԣ(hQh8Y`6Pc1iK$ uT&64tU3.HH9 (̌i6|֌,A9 y0PlFc(_6  3%`"t5T8 ?95Q̙4H]7k7G384@/|0x/ˍ"Dҍ)x4$P$tLj4),`&L*D6>5TFI)d`#jT)}x'Hln&$ hآc +5Žl)x͎`)$ȁ9 ԁc08.D$l 43 .#:8*%CX"Wp6dhV3HA)L (d h5O%c7\͏ԏ5*c 0:2 @;#=!X*$)&p?$NBc$d\'Pzp43c,G%%)!ƐH38֐4#l-7xPj @!  01<.`- &< &tG &dQ'`t#\iĆ%`p5|U7 (4!h,T4ʑ~c ّ>c0@-5x2#(, 0 $"I#X/$i2t?`(4N [6Yx$@h#w&`G40X\*< (8,.0#ʒ0#גp)'08$c`K84) "44<5&l?j129kgA/pQP3#XWU7g`#Ht 5~hl6/(T-|)Hē*ؓ"ߓa78g`i,8 ,d(tqc3ȟ6G\1T/$hw%$odF'Tu$t}HJ#|)88, lȔ6lڔ$h2p(s1v3P%p1@<Q0DI4!DSħ6_,Hlб!p xo68GjP&ɕx`$`g!20-T D%.g;/I$cV! bh%iJ&sp'58\p*cT6/2L̃0|'Dϖx0TږB$ 2l\h,24-'36p21@,K&P(7]*kT$}@jh&a60  TǗN9ϗ6lڗ4Ic,x ,)oc+&5dc<.5G3,YH!i8c54\E/͘8`/٘$3p|.h8$pܼ#L+y":|4TT)g@+xp\(8P\&Xd#|23|P/c1֙@(4$;j+L "x .%$p44z#<T?&,GM Y3dhi2lwM.\`*x6hv3<h(ʚ!ך@-<P($$5ld0|K!$8PHNjÜ<{'Ӝt)cd"W&<`>$%X=j8%C!N'\|7n(d6xt1"4)2%ϝy"T۝еg,7`474H38&w$;(%`E,R <Z 6Tk,| X*8R#<rc-d&0h-Ҟ$cܞ{7Ե0`4# ( 0$D%W!H/0<8 hCؚ"X+Xg*8xt7(4@c<~(Pj$h}(Οd ۟2jzc ?%|п4@)0104V3CLԑ"`M&\7hV4hv@&( x444X82D#ä Lߤ*p5$%44{**9 |..(h `)`;#(\a# 3<ץ0'85h4@|c$L>c18)(FP'LTLe%^Kcoz.,z8426t88C3Lؼ%0Ǧ$tѦ3|ݦ@jl4xM4(o1h2)<dB.MlU'XT4xh /u2x؛4T!6(ǧX5|ߧP3l.,%($D,$%db#,3c"\J<4bJ4w8*hh"@ Lc$5hd0ɨ2\ۨ%H'a7X+dhD#'lA$P4D5\H$dTL/D^8$tfp#xă(Nc'D4"܃, épa# ѩ4"ܩ 68 "(54=4D,H0\=̎%B`gO6Y&eD.t'0gp61܈2Tª5L̪2֪x&\=jK'ce7H'\%!@$-L&D9)8L<3X Lcl')!7l"dg8ccH%X«|37իpL)(D1D)c.')0@+AgK{cX(tlQ4XCc(gn3Dtn1TĬ,ά"X(#<2$Y8X \%T!#18X>%<PpL$ _ +$r#; +(h`=jĭ"\ҭLcۭ~(c2D . c%$~c/309r9BgNl&Xd&n̩#`Dc+`$$((W8Ϯ1,ۮj/Lq#X!%8X,H/>#)4Qz'd$Psd=j ( G% 6LNj- įd#ͯ$,ݯ(cdgl6xl1.X'T(h5a#A`7DX.Ll/ 55 /-ϰFcְ74+ 7%'@;2 HI8@7L-P4->1/Nt#@]x6Xe+,uR$d7'<{i$c#!4ϱ5@Gj P{( L}!3!)= ;CpcI.@V0)<c<cN-c]((lrg {h5P% (c g4ȹl 8Dܹ-(%(X&`1H<2c"%T)5 A` . Wit[bhi<&Ds2,@20 :j;c63Dĺ\/cκgֺQ0)-20j2.(Kc; N1e-`s81!L2H0 %XQ$"L30ػ\4@;c;8%lL#(Tg3(":g2`O-7^(;g(7s-c}$\,;@3('0/`Ƽk7ּi74xV)H'4Fp$cOP.lddhkd78x.Lt .<$15Xxf1$ýJ'Xн !XL;c| F-Xl&x "3-ds1C@.W6_*k 5|u@jp#ductZ5<6D̾\gپ([5$&8 dX1H0&!+/%72tMLc Y%&n6(w4*v#L$l@Nc*$ǿ%п8ٿ4y*Xhm('$[&t6 L5X"'l,\ @ucdV0;bDc(yx3d?#&HF&X64-'0<,؎&Tq% h-D*"!g+289&(C0DR@.Xgh-x,6xg0h92,hx)l=j\.Kc+L$`g!6,2|>4T-p^;in*py4483]10 ) -c<2L/8 dx+6 3&( .Tb#:h 4IncPD-DaT"nh{081+ T)HcS#\p hc@4,ċ" X5L.(r8@CgJh.XT&xp,"4$7$X!,[ 5<j0$$c !t*+  }c'Lj930D8'OhW,`H!(xp%wh)c $DP3\L30+|<7c)U!tw!(h~26gA$XQ;[%Hn3%x}" h6X~1,80 |51 /L-(H0!Y#)8(5.<La7cP}2nG/{=(L<c4H92  /<48X`3t3<0+ 5 lcp((Th2h-EPd!xXH%Hb@jt.X;$|8,'L5&- #"8%T S!@@xi# )P~cA&9S)$l-hw'@Ѓ&,.+Tn44P6dt"Љ X̪&X"88u3ج4:'4"@(R'9`(0lCTjK v2DYa$0c3 zhx+; ؠ00Lf$p5v585dT0xU-P#!D,$5?q-0M-cZt> @h@j{U.@X6% T$L\c(74$x5@xK.tT*)%t$+ -PJ$#n5t;2Q1^;.Lm#v, D~!4$5Tw/$t)^(x&Z2<2Љ'x l1t)'#t/H E$78U\x'ctk&xl̬1{- lXL2 ',(T0"95@T3<h0<.h\1(H34|c" h+ 46)LO1^&g {I8@2(xT#$v1(p|( Pj18u1+."p=j8K#pLscPXT5h3y|.8h2,]2 -cz9.DDa'4% 9 V7t03%+-|7"?&4H3DRX-\`gid!ytA".4d8)c1(<(Xc $ ,h.'Oc.p&,9ocD6O}50]e#$d0"\k5y/lh$ W8 N9<*L$D744(T$T2t. C4% Nh.<k/x5he-47X*&XԲ"0o"t 7(-2*c,5@"oc*&/4h!ChcJ7Y 8\hx-xxp1hW#851dX'4!l(02c 4)`5t!15ĥc?*,J\8\$f u0D}#8.d8.lp'|68H%D$,D`)l0($ (1@'-70<H'DXl%0a8Dqt638j0"T"4Եg C)t\(,1%#p47 p4X+|1d?H"@P`n7cп'Hq46l!2gX 3 x2 5<I6 40$H-  h $<3BD3N3,c8@cr)c $b7X)s( . T%(d(8Oj Ic$8.cDx5x &D Nj8LgC5XS2pm(cvx^-h-cб+|)\P#|lgD7 7T,x4" v0hPi' g(TL'/J1\@,0DP\"]"-l$u0hh`s"hg``1l$k# $d,@<4t0|h3,#q1,'3<p1A(tUt,XbL7r'#!$)l$ct$8' ;z\j |96H$xTO$">c7!IlM!U1md,Lx(c 4&h,H|+8)L3 $g10|jhp" d3$Y8/#?'I`3%xW2mPCc$h%ocT5D3Xhc2,&,.8$:/(PZ5$"Pj200:&C\%K0\,-g\-uX'He#4-h+^"< ;Ԫ4@%x2($T#5L64&40}cT*(,(c : )\P cX,(c &nd'PuLGj ~,&X%41},D3H],h `&h0$+ x&\ `qc7!8:2M-l^л0<b]'Tm2(yQ4P/\4h0 %t8D; ;0cr0P~o-H&6%`!X5|'Dscp-%p+$  *  7"d13i4I'8P^4o4pj\'-8xx(Xsc(*̖ 58,.&hH'$'@ Z!x 'P(),54$H#<R%]8j$0A"g6.l|3(z3ta()c&L$3|^$0A6hO,K9`Z02c f'q̐&Hx(е2D2,@ch)"@@cP% y#b#l"XH)2 /0t(%$'T+L"@6$hQ<-,a(rD%|К @8d7(6PU7\*1P'8"pi($4<'@6\Hc,D';T&4D!]* m9 z[5tt'TL8*WM)k Y"<+7H4}i((4b(4>& "!p 1$c(>4+Kc:`%DJ7N 5^4kL(~6.h(02LPc\/5HD+  !|*@@ct(p(p&H2P2,2>a10H.cX.Dgh/pW!@x,a23\|6@19.V(|t["X ~6T$X48$ 30t.c$&t08%,;["HK̃,Yl'g'Hu; |,/180H7,x$,(u71\}0L"|%P20<`+L&`#@58+@jB10V"e@k5Tu\)c ̡40i  , r(T;#|#cx5015 t3#18O&D&8MhT$9`'k*P{$,z'@%&gP4%Hp.ti5d5+8DhPv3LLNj%H,2/19)pHp7(SqceEct`4D$|,(l`!5)c"8L4C'h 53H4F6Q5_S2jT\-|(.cg02P4hT5|,,g)2w1 D;76`_"*@ 0AHv1T ih,|u L&$g(p30g$2c285@jؿ0 %9 "X]7L53?(.Rx% Z$xbgi!z;8b%L/c-078:6L.$8L<5,( 4 ,P,2c 6LcE}1Tla(a\1cn"(hP$"S; F4X) B8\1(v1t (@!y'<. C7OL'^%`hS.,r8.@ H\;c\+ +l6|D/cp]%$!(0&Xh'C$.Lg9&"8F)cS2a4+ol )-'D4Y8 j73<,Lg P,6P$%(Pj`uc&D#v+*6T4P#xA5QLNcm)wp 0м3$X)&(Hsc8,785'<58&O!\3|j4lDT &8Oș7_O3PqTj,(,[(\T.dXT &0dg5_4tu2D0-'67F,S")jcq:%|{95\f/| Kch+dc$j3$*Y)<$@o7H0,;j=6tG 3<d.ux 06̾*$'("X:,P4(4# 8<4`~i&' .#6x7d/CdM2<\h&<i $4w0g~%3D+dLY2pzil824 Gc*c(Y$8Nj$$l̎5X3\--GtiVh[,\`5n9 zH9 8(ؿ0>c,cT7|hgKc5&L[5T#`t3;(?(G&0Q.\^5DwX5dI/u.04-0n(\'%t+Xv1 'pE)dT#(&(- l5D$?5tLT6Vzibx38m'x1T %4&(3o)(@ 4 DL(D%"0%<=%F1UMcd $rg/d%cdg`k9(xgp#Dvc2@M2$oc4%X45$3L4gD5*$$1%07L-\>9`Cr1Y-c`z5 u200!T(PjLI4 0|L"`t "~iĒ)<"(_$$O4 -4; \(OLA&]H&4j"-Dv.2Pt1x/1d !,1Kc0 x2k&g(@'\7$< ;\3!144b1@0@cN\"g5|tPj14-*p\' D2%,Ե75\ 03D24&h)5P4'B"Nc0Zغ4i&htX>c$.c$ 4#Y6y/0p.c8g7|6X#!X3L$XNc:gB'"<Np4lUp *c̹"tQ6~<3G"pg[5$cd'2tcxh*c,2D 3 .< K,K zi` h,k %'xu &t~ 7< ) c 3 1 *c X]. , (t2 `X(h &P s$! `2D* ]2h7 D -lL 2x\ zi4d (p j$ x Lj} 2 )7 $2  )8 @" d6p 9(t Pj 9   ! 4~5 $  Z)3 Z1LB @B(T !b x2n \z2<~ Z(\ @& a*4 {2 zi, "8 92 cr\&<'0 Oc8u6\1g5lO.X%`[#3|1&@+9 4@XPL4$m24"P%<'"-,2f)h$3d#\ t#,+ p3LJ%=T6H5`/s)U4\8v1|{6dP415hġ1h80;' (\;0|N7;A60D&dMt%cY,8hL"`rj&}!8%ܓ4T/T '49/p'TDV*Ec'p(42( "L)c- $;#H ocV2#`Lco)@&85T3 l3oc@jt%l#l#NjH) 0XL$DxJ5T-\fDc(}.TX-|8,\c0w5M5"4Oc'3$H1$(^): (lX1bV)Hx'h.d D$<! l7#cn4D$4V P % d1@x](<'ܚ%81|@j:hH`Z(lVPC,f2y/3`.( +x ;0/2x7(48.?cTC$d `7!%*7>0#6@O 5e 0<jgwx#$L$4L/4&8tR#Le1H5D-$!.<Y18$0 1@&, >d1L8].<s$q%{8/L̢7(T08`)<Խ0`Njhz5H B6 6h&s-L5p#C(X5S'0c`*cqo/{ \0D@j&%L8W)Hv163$b*'(3x-#%02G$x:4"DXR)Yhl8bt-c0m;HqL2,Pcc80  ;3p?jE(\6<hLU52c %2p#B%,.<8%cHL#8Z !,tHc||c pLj4t3*c6<>c$|1X0p$%;df7+4\:ȃ1Pp.LeHcnT-'<yx5HE5h J8(48&\\2cx $& $ @j*H'#<s5PI'<V(2^h,0l<-9` w({0X-0p'4L ,D TT)pgl4`pBc(j&x )c p@c) h5(V%$eT%vL!-cpI!0d24T&%,Q'Ha6x?4 &XS!`65,(T,16<"O#@YgfD "8vHl5`'XT%c 0h%0D5#p(%( B)P Ь1-ؿ03pgBA/O g*L]8;'jh#tx$M!HLR4='G5P4lxg+xc 22(K/x?j,) t=j. t%7 "$E )cS \G7] |Z4Hl L7,y D$T T' v& `Z$L t  ]6 @9H Dpc 8#  !D7(!p5L)!0t$5!%C!,cO!N8d_!j1v!q5\!'!5l!ph$!%!Xz2!`8!1!L&!X%8", "(5"4)"6l:"XjM"{c8f"56q"D!"С&"D1"'@"O&"Tk9 "2"9 "}7L"5H# ,*#J4,C#X'T#$g\#g j#p2T}# h# 58#$j#"#e%#0K%H#{c#-<#P!"#84#&#4g2$-l $+$(2$\&t=$|cM$)cZ$m!f$h,v$.,$,g$<;$?6l$1,$+3$:*$&$3$)%L" %0;%D7`%D)3%TcG%'V%tgc%gp%+z%L1%@4%(?9 %~!x%X$%1%0D7%[6% U1%(&T' #&%+&NjD&T%N&d^2[&ԃ,n&&4{&`08&(& Z &&L&P $&T-&r1&I#p'F"'3&'!44-'Xh5' #@'cJ'*S'J8b'ԁ3Lp'@j'$'g'"',&<'8*4K*(6Y*L`(8_*'&8p* 9{*(f6*(O5*H1X*#`*, 5*1*$/* -**+<& +LV-+y(x(+ 2+ C+d+ R+44Tl+`+@w+4$,+<|c+r1+ 6(+(3+0+v/L+S0L+Ĺ.|+_(`+}5t, ,P|c',66,,C,>cX,k6Ta,L4u,/,0,t08,4,R&8,Lj,(,'-s"-3-@j.- 87-<+F- ;S- ;[-/h- .<}-yi-<(-%d-$1<-/8-T&(-I)D-̑+-0f#L.F7p.4.=j@).&@4.c7@I.:7T[.#0i.C$(t.3.3..Gc.$h.x X.6..#.D 0/`9/1&/#81/@(2:/-R/`{ hc/hNjs/ h{/|4 /-4/ 9/*1d/@-8/+/T%/ !/Hu9/00/c/Z"0<~c047*0Pc30TI30H0L%PT0x'<e03u0PNj030,# 0f80&D0,0T8,0B/p0\h04j$0m#H0.41"1 c$1l5`<1I5R1,i1l%p1 !1" 1|{c01!1g71@51.1H;31`*X 2|P(2! '2u/827F254O23Hc29$r2;w2,c2Z2H24f2x212"P2Q!l2,232,#d2P+\ 3 |3c3c85+G5.cO5V$[5: h534~585!,5@j5E3@5 @c5pg`5n65$658/75T,c6, t6h-("60d.6 @6@8 T65j6#`v6760006{,6ܸ4X6"6|4X62't60'@6إc6l46Ec$7D;c7%7d}74.7<8`A7+Q7%$Y7 a7@;j7L$Tr7c&@74`7tb27@9 7X+7#7h `7(2*,7$7\$\7|O88+88$c&84I798q5L8t-[8h/k8B4{838*&8!8R08(c(8% 8@j8b18ħc 98t9m*$9X50941@91$T9T2*@\9e'8c9 n9$7z9g"9,H9#X9290)X9879L3H9Y29h :LT!:$c'):'D3:($A:|b7<R:gb:(Dq:'8:0h:':8":g:D'<:&8: :X'x:2;1T;8$;$H);hc=;D;jM;H-pa;Cc$p;( ;ܡ% ;/;1; D;h;Pu#;0'T;Dc(;2;&(<`!L<Q8!<H:28*<g3<d'><<3O<Oci<،)<$g<H}c<6<4g7<N%<\)8<5p<l1<'=TIc<=;c4=1c@=Nc*=D3 >= |.J= Z=M3Pj=,?)4=(5`=`h=x4(=|3 =0%7$=|6(=J9P=c=87(=3>03,>zi/>8d1L=>p6pO>'Z>3h>,8q>L-#L>3>-$>h>(,> 8P>H!>34>L2>1>d->r7 ?54?(d.?*%8?a78T?.\j?',w? 8?'d?}c?\)?2d?R1?/L?u1? .D@xM%@@$(%@953@3 K@)LZ@B$f@'q@4@ T8@Xj@.@ 6@Į1@.@ @ p@0l A?c$Az#8A!%Al75AcGA3aA#*mA" tA+ At<#pAT/hAk(A#AcAX(,Aq6A$+A'< B9 Bx.B+ 0Bl4t:B<%IB$0XBoc^B{3vB؃,B|$B@4B'$BH0Bd+B5%pB2pB8, Bb)CT# C+!Cuc\/C`u/$>Cد6GC(4DPCbh@^C7sCh3CJ/C)@C.hCt%C3Cti#C"C5C9 D 5hD (D&(L>D2cFD7(RDW1xhDh'4zDd5XD$tD"6lD(4D!0D-70D"*D(EHn6El"tE45t,EG.=E1KE-`E*DkEcuEo7E3Ev1E(6E,/(E+E#cED6E<&F0Y#L F"$F+ %Fa(2FS!=FL2 NF+ZFN9hFP%@nF82!$yF&0F- F1F$$@F$FgF&lF4 G-G4"X GXGj-G"8Gx5AGP(TGT%,\G|gjG!\xG,I)dGЍ-G g&G<#!GV1LGX'HGf&\G\8 Gx6\H8!2H+,H< (HNjAH-'LH+\H(x#cH&nHL) {H`q(Hx@cH2H8v-4HL,HP;c H@&H#HL6lH.H#IK4<I@j)I5/$2I 0:ID#TIIu1\IP.nI6yIx2I\;jIs$I$,<I\?$I%IЀ$8I|1I+DI*J!pJ6 "J2<*J\q5|6J6 AJgdGJ6QJ, \Js9cJ~iqJ!~J 6Jp .LJ,!`J@p5tJ(JF%8J (J@3K-K`,TK&*K189Kx%?K3DK|2XK7eK8sK\"K 7K5K$/$K3lK@cKh5`K/4K847K&4L4/$\LKc%L8# 2L`1ILx/TLx&|eL<6oL@jL.XL6tL'.DL2$L0"4Le#`L82,LB$L^4LM0M$M1&M42/MЧ29Mlw-FM TPM@jbMC-rM&M~7dMtcM4MR#8Mt8 Mx",M+0MX;(TMgMs7Mr0M43xNЅ1Ng.0'N>c0N6<9N/8IN!YN&eNV8}Np8tN&,N"@N5N-(dN$N$=6Np2Nl@cN(PO/|Oh1L"Ob7T2Ot1DO`6MO#! ZO85lO0)yOl84O"Ol5dO2OxK%O/O`3O.Or9P PjPg$Pء!1Ph2,FPH(|TP-4pjPm/wPt?j~P/<Pl?6P*PgP$P"pP'PgP[/P&P6 Qt9Qv1"Q%+QKc;Q,KQC$[Q\#$lQ.\QcQ7(Q+Qu1Q.'lQ1 QD-@Qc!WW)h;WH !HUWh5iW$/hW'WK3WXi*W(6W@/cW4lW,HW84`Wa2X8/Xv5*XJ4 AXv%NXg#ZX pjXT/lxX\& Xd76 X|"X+X.Xh$X6Xu1X8YD5|Yȥ#"YL*" .Y"+?Y4XPY4hY )|Y6 Y0{4DY8PcY%Y8YN9@Y:28YD>!Y8A6`ZԘ$Z<.8$Z$0Zĸ&;Zm5XRZ\Gc^Z gZ3\xZ7ZԹ#Z6`Z&Zt5Z0'Z('Zh`Z00Zܿ&Zد5TZ\(X[2![X*h*[8<[6F[,0 L[=/d[[|hb[ci[.[#4[9 ['d[~,[x!H[0pc[ [\5[P/$ \i\l'$%\$9 1\0/@?\#xK\-LV\/$^\6xp\ 5z\x=j\,_(\"T\H@4\<7p\P|*\h\0%3,\H[%(\9)< ] d&]31] iA]4@\]a4hl]%w]4;]>9]Cc$]10],]м7]|O)]@j]1^ 0 ^_!'^/(0^lT$xG^hM^P6 Y^H5\e^89(n^yiy^ ^M3^.^0+\^5\^|7$|^\Ac^|%^>.8 _T,d_|5T*_L(.;_D)XT_%4]_$\(Lj_\hz_dh_68_(3_T&l_,_# _&4_/1_6_H97 `x3(`I/#`G/82`c(d@`cI`2P`0U`ha`D&(m`g/py`#$`3`T2`/X`Ԛ-``@(` %`c4`L2`.! `4a L2ȁ1=a@'DHan5T]at.ia2,wa%`a ;a,aDK ,ad%/aga0s"$a( t aJ9a7aHT(aQ.ax#db\,b4Ac b@c.bp6X>b$ HSbt& _b%jb.8b,,b _)8b+,b' Xb.cbDC/pb0w.b68cp2(cTx$hc|4 -c,/l>ccDc)hMcd8&<Wc bc0(ycH6tc,7ct1c.' c|gc87cܥ7cL9xc`H!c&4$d$< d *8dg d 9(d +3d 1?d)|Yd `dl ndp,&zd#0d_!d]5Pd1dN%dL-Pdp(dD&2d gd+eH"De,)'e79e|=jXeY&be"+Hje`|ize1\ed84eK#\e eh)e3 eԁ/le.e|*.tf0fd f 'Xg8"ga7g87-g2@:g*9dFg/20Og@,$^gP!tg2gX]2gL.Lg`S(Lg[2(g|1,g.7g56gu1hgh,lT#@KlL3[lD2hl3ltl(1l)`ltQ0@l4\lȢ-lh:7l1cl4l3l .,mP" m9!mx!L/m'=m|gDm@"TmC/$amY6kml5vmd2%lm/#mn-4m1dmH14m ^5`m6lmh 5tmcmu!`nx"n" /n%9nXJ"hHn,5`WnAjknOcngnx,cnLi$nj4Tnx6 n3n$8n A&,nL)Hnd0L oh-lo>c#o S4P5o2Fo`e(Zo(|4(ho3qo5{o` xoU)odNjo)6o^4od(o#ocp1pM2@)p*04p+X@p(Xp2kpt1.|p|- p*pP5(@pg7 pX((p84p*.p/-$pXuiq<.'Pq'"q%/qܙ%0:q1Fqm5XYq44xq-q# <q`7qTNjq"4qgq<"q\+!pq q`'q"0q@$ r-`r8o3h%r"6r ' >r pNr,0,]r /,er\1LsrHhrL, pr(r.xr:2,r,$r*r,6r2rď7 s,sT:(JsxL2 Zs8<$cs|3(xs$ "Ts2sY.ls$!8s0s,s̼'Ts$s#4sg t<"tL4L/t1@tP'LLt6Ytdp4,it@/ utR1tAjt .ctD4`tca) l4 (} h7\H8g7^5 .@4!\$'m.XS-(}c0Q#H"@!4D"Ps0`>cl@I% w(N93)<(0iрtA)tr(cgXf%p$$4`z|4`93e7pEc4.cʂX%8Ղ5$ Oc/*&Njh!\%3$2g =+7N\@c`.xn3h},W6@4,7Dx7T)`/&^-(ȃgЃ2ڃ ;7LL68#8 xK4P20EO.V*c]L$Tk4zcy'0 7Щ!Tx702ȄgЄ0cڄ0d@c̏&)c38!&L3(/f6\<d%<M2_Ocw'~p; 22.$!2υg)ش+L|l*% D%/ @)!dv2/<1KĔ)$b8$pl7w3xg $ 5+Άq1LjtCc$|%L.!LD2'10E$N&$Z2&e|e#k0@pP8l33(,(ȇ8"0ه!,Mc"0   u1r7@(Lj-:2;4&J "hQ&p[x/jHg}Ln4HPjL@cc=jш5!݈F%8#m1̀"|X1)c/h68.[t$c h7(t@/!t;T7(?9 0j6*8ʼnc !h$L"`(+|L&Lɍd7%t׍ 1 s"(&!Ll*`g6X,;6P845O 3X]8e7dm-4yL)(%cHc.ǎ6PюL<6l@5@8jT.<D%!@8$(@c; "F3b83vt11#8D3$4ŏ,"ΏcՏ6X,+O%0% X"$x#t(K*4 #?|c#,N&Yxf+c#lwg $xЯ$6XIpm8c hn$,whGj|f#/+Xv$7Hb6ÕȺ3Hd%dg+8b5H3)3`;hGЏ%PPC!]A7xh0cu8#/23(T1t3xǖ\hΖ,28'5(u1/ )`O(*)c /<(283G/,W$5/_X4m\&x !DX@ch&(!\jʗLcח7P7412l<- -`,L;phEd1hSOc_ %8g\2lw>cnc4}c\S4`%N<3d0}ix$,s!`@,Hl*4ct P8A9Τ(p&2c x72 )c4d#(&3о!C A9 T1'_u2`o h|h"|c t- T-|T6ɥr0(0)8T@&P.#l)76@N9Ol~c\8!%f\%tz30 'p5\0d.`/Ǧ8&Ѧ'%ܦ3\14)}1Pd&0<{c,A8_H$g-'LqP)PziTJjhNc@ƧD$$ԧdr"ߧ6HNc<6l 44&(7;d@6LLd$U|4b%,l, w!( "p\5(|c`**%TƨT &Ҩb0\ߨ/"|&h4h+ 08,86Oc;3Lw7X&at%n#c x2cD",j5|,h©Ȗ ЩEc٩&&g3(  \<.T)H) 7)C" SL8<h2`qPS1 zH#F%$(5!44>c-DͪP)c #l($2t<_*\7'9*6"\I8St02\50l(gwJ; 2<,'02B! {6\ǫ8"(Ϋ$Lܫ4 D7(@/((  h)t&l6@$C`cLd'S#0cL2Hu87P*`m8Ȧc21ͬ*ڬ(%/L.,'h $&"'%073FiZC)q(lv2x*X'0 .c|#Dí2Dέ0p3٭5XDc(5@0.<-":48Ldy5[(Nce8;rH%xp,0 5L7ce%0 g$ͮx Pg8 DG5( 'd\65,a(As74La5\ X5 lPd4@,(4%lB0Kců,c үz#$گ& . hp7(p#3(3$Cxf7S 7T`22n$|814]"Є74z4`12N9˰6ذ>c(A"8c6\-,03;e70I,&$QXJj \'9p)c(gOcL(3@V3ͱ8e'ٱ!0r08\- /c$+\3?T&xFgPԡ!cS6Ln2`z#`.c$<g 1Բd1HJ*`+\('@J'lXH.gE5ToȪ J-(B%n4\ q6p.Tg̻v$ػL<$l04f8@KjXcV7,4c&T`6h>.*1$4P^6\TR( 2 H'86L(P74 6H5@U$&b2tdJj }M$6`2H(/d)&P#P"8dF5hA%,!@c/k.9ī5dIPi ](Ajqq1tH@c ;70|)L;c0[26Lj9  4a#X5!85X28F7O-T`+hiT'DuX,c}82@1S1d$|`hX4x b)l/ui %c/S4>u1Qc``#,m Kc Z53]"P5<>c+ hcT j5($ )Po' 84'F#U<@ce&o1-t#)c -ppcu3T0scX2OchLqc t-p\50/p%:\1Gy+R% `gi&$Pu+44 OcR!$4\4@d-'p4 h2\$h.pX28=H7LL|4_.doA(l{o5Td&f(.ȫc @)(C'0c\3(&! 8(DN\#t]\5n*wأhp@Ac.@p%,8%;L64L400"L t)%X/c4T#\?)K|cU}c\,g`v/0v8'4g5'D $08+5l&049*d_!\J)h`%0v1R0,,1?\K)dWx'@f,Ajxu1c1t@h'(40LZ)4oc0"X#XLjui 0|"P=G9I4+V0+x`*(&j({j(<^$@h]48Nc(6H*Y*tp9 h 6P 54\[5\9 :1C*P7[@8q6<$T\5 $"*#Lw& T7pOc̙/ -cM# 7/@k0p<D1GL$8R,`[;(i\7zA.\g"4, pH#$!\$G8|7<Xx2p؛%|gH%5(%0 3 "l= 7Np2`T#0o h(|cLj+ %@1d1$x1150(l'Lc+%l4C4PC4)XO']0AjoC9(f/8"\ l7(6LEjT1c# ^# \Nj&Ī', 6,'A$Q89,c$P #`$3-/l43,, "h @|9+23PBKcU$g${&$\1@8c-"X55`\4@3,D%Hn1,@),##p)r&4%8AtM8P 7h\\4DjM#o((&L\ d4(3`*,$ 4 / `$Xȃ24W&l0"P $48.l,c 80a#D5O0k7dNj%,65 t1%̖6@c<.T!8ui<p ('4L9+LncT/,`܌1pu8.cP&89.c../../../../arch/zaurus/zaurus/zaurus_start.S$azaurus_start_ramLcopy_sizeLstart_off$dmmu_init_table2Lstartup_pagetablemmu_init_tableLstart../../../../arch/arm/arm/locore.Ssvcstkparam.cioconf.clocvers.cmii_bitbang.cwdc.cinited.7594if_wi.cC.27.6942if_wi_hostap.cne2000.ctest_pattern.4941dl10019.cax88190.ccom.ctiocm_xxx2mcrcomcons.8194lsrmap.7935ohci.csoftraid.csoftraid_concat.csoftraid_crypto.csoftraid_raid0.csoftraid_raid1.csoftraid_raid5.csoftraid_raid6.crd.ccf.7114hfsc.cbio.ccons.crefcount.6711diskmap.cfirmload.cdp8390.cdp8390_test_memC.5.5201rtl80x9.crtl80x9_media.4940rnd.cchacha_keysetuptausigmachacha_ivsetupchacha_encrypt_bytestwist_table.10261extract_pool.10322_rs_seedrs_bufrsrs_havers_count_rs_stirrs_initializedcd9660_bmap.ccd9660_lookup.ccd9660_node.ccd9660_chars2uicd9660_rrip.ccd9660_rrip_reldircd9660_rrip_stopcd9660_rrip_looprrip_table_getsymnamerrip_table_analyzecd9660_rrip_defnamecd9660_rrip_deftstampcd9660_rrip_tstampcd9660_rrip_defattrrrip_table_extrefrrip_table_getnamecd9660_rrip_extrefcd9660_rrip_idflagcd9660_rrip_altnamecd9660_rrip_slinkcd9660_rrip_contcd9660_rrip_devicecd9660_rrip_pclinkcd9660_rrip_attrcd9660_util.ccd9660_vfsops.ciso_mountfscd9660_vnops.cclock_subr.cmonth_daysexec_conf.cexec_elf32.cexec_elf64.cexec_script.cexec_subr.cinit_main.cinitpathsinit_sysent.ckern_bufq.ckern_clock.cpsdivpscntkern_descrip.ckern_event.cfilt_timer_timeout_addkern_exec.ckern_exit.ckern_fork.cidx.14119lastpid.14105lasttfm.13929lasttfm.13930kern_kthread.ckern_lock.ckern_malloc.cBUCKETINDXkmem_map_storekern_rwlock.crw_opskern_physio.ckern_proc.corphanpgkern_prot.ckern_resource.cinitialized.11841kern_pledge.cpledgereqpledgenameskern_sched.ccpuset_allnum.4879kern_sensors.ckern_sig.csigwaitsleep.13863kern_subr.ckern_sysctl.ckern_synch.cunlocked.10469globalsleepaddrkern_tc.cnow.3458timehandstc_ticktimecounterstimestepwarningsboottimebincount.3712dummy_timecounterth0th1th2th3th4th5th6th7th8th9kern_time.cnanowait.11374kern_timeout.ckern_uuid.ckern_task.ckern_srp.ckern_xxx.csched_bsd.cschedcpu_to.4895subr_autoconf.cmapplysubr_disk.cduid_str.9291init.8324uuid_unused.8330uuid_openbsd.8325uuid_msdos.8326uuid_chromefs.8327uuid_linux.8328uuid_hfs.8329uuid_efi_system.8331gpt_uuid_openbsd.8332gpt_uuid_msdos.8333gpt_uuid_chromerootfs.8334gpt_uuid_linux.8335gpt_uuid_hfs.8336gpt_uuid_unused.8337gpt_uuid_efi_system.8338gpt_uuid_openbsd.8354subr_evcount.cevcount_listnextid.3321subr_extent.cextent_alloc_region_descriptorextent_free_region_descriptor__func__.3336extent_insert_and_optimizeinited.3103subr_log.cdropped_count.12174orig_error.12175subr_pool.cC.52.5769C.50.5720C.51.5742__func__.5291__func__.5091__func__.5474__func__.5126dma_alloc.cdmanamessubr_prf.cpanicbuf.7381subr_prof.csubr_userconf.csubr_xxx.csys_generic.cflag.12363sys_pipe.camountpipekvapipeopssys_socket.ctty.cprocess_sumttyechottyrubottnreadtty_conf.ctty_subr.ccctty_tty.cuipc_domain.cpffast_timeout.3765pfslow_timeout.3766uipc_mbuf.cnum_extfree_fnsmextfree_fnsmclnamesuipc_mbuf2.cuipc_proto.cuipc_socket.cuipc_socket2.csblowmem.4136uipc_syscalls.cdns_portcheckuipc_usrreq.cfptounpvfs_bio.cvfs_biomem.cvfs_cache.cnamecache_comparevfs_default.cvfs_init.cvfsconflistvfs_lockf.clockstr.4712vfs_lookup.cvfs_subr.crb_buf_comparexxxfs_mntid.16014toggle.16049vfs_sync.csyncer_workitem_pendingnext.5054incr.5053start.5052vfs_syscalls.cchange_dirvfs_vops.cvfs_vnops.cvfs_getcwd.cspec_vnops.cdead_vnops.cmsdosfs_conv.cdos2unixu2lunix2dosmsdosfs_denode.cmsdosfs_hashremmsdosfs_hashinsmsdosfs_fat.cfatblockmsdosfs_lookup.cmsdosfs_vfsops.cmsdosfs_vnops.cfileidhashbpf.cbpf_sysctl_lk.9730bpf_filter.cbpf_mem_opsif.cif_idxmapifq.cC.9.4572C.7.4506C.5.4487C.6.4488if_ethersubr.cetherbuf.6095digitscrctab.6159crctab.6178rev.6177unit.6111if_loop.cif_media.cradix.cmax_keylenrn_zerosrn_onesaddmask_keylast_zeroed.3438normal_charsraw_cb.craw_usrreq.crtable.croute.crt_init_donert_timer_timeout.6665__func__.6380rt_hashjitterrtsock.cieee80211.cbasic.6618ieeerates.6810rates.6784mopts.6407chanflags.6651ieee80211_amrr.cieee80211_crypto.cieee80211_crypto_bip.cieee80211_crypto_ccmp.cieee80211_ccmp_phase1ieee80211_crypto_tkip.cPhase1SboxPhase2ieee80211_crypto_wep.cieee80211_input.cC.21.7169C.22.7176C.19.7148C.20.7155C.28.7579C.24.7358C.12.6964ieee80211_ioctl.cempty_macaddr.5940ieee80211_node.czero.6605ieee80211_output.cup_to_ac.6567C.16.6815C.18.6838C.19.6839C.22.6892ieee80211_pae_input.cC.14.6274C.10.6017C.11.6024C.8.5867ieee80211_pae_output.cieee80211_proto.c__func__.6604ieee80211_rssadapt.cieee80211_regdomain.cieee80211_r_ctryieee80211_r_namesieee80211_r_mapif_ether.carptimer_to.4962__func__.4966__func__.5152igmp.crouter_alertrti_head__func__.4828in.cin_pcb.cin_proto.cinet_ntop.cinet_ntop4ip_icmp.cicmperrpps_counticmperrppslim_lastmtu_tableicmp_redirect_timeout_qip_id.cipid_initialized.2760ip_shuffleisindexip_input.cipsend_mqipsend_taskip_send_dispatchC.3.7499C.4.7500defbaddynamicports_tcp.7477defbaddynamicports_udp.7478ip_output.craw_ip.ctcp_debug.ctcp_input.ctcp_output.ctcp_subr.ctcp_timer.ctcp_usrreq.cudp_usrreq.cip_gre.cip_ipip.crijndael.cTe0Te1Te2Te3rconTd3Td0Td1Td2Td4md5.cPADDINGrmd160.csha1.csha2.cK256K512sha384_initial_hash_valuesha512_initial_hash_valuesha256_initial_hash_valueblf.cinitstate.3046cast.ccast_sbox2cast_sbox1cast_sbox3cast_sbox4cast_sbox6cast_sbox5cast_sbox7cast_sbox8ecb_enc.cdes_SPtransset_key.cweak_keysshifts2des_skbodd_parityecb3_enc.ccrypto.ccriov.ccryptosoft.cxform.cxform_ipcomp.carc4.cmichael.cpad.2818cmac.chmac.cgmac.cC.5.3075key_wrap.cIVidgen.cidgen32_gidgen32_ftableidgen32_rekeychachapoly.czeroes.3638poly1305.cU8TO32U32TO8poly1305_blockssiphash.cSipHash_RoundsSipHash_CRoundsffs_alloc.cfsnoinodes_last.5403fserr_intervalfsfull_last.5322fsfull_last.5273ffs_balloc.cffs_inode.cffs_subr.cffs_softdep_stub.cffs_tables.cffs_vfsops.cdone.9204ffs_vnops.cufs_bmap.cufs_ihash.cufs_inode.cufs_lookup.cufs_quota_stub.cufs_vfsops.cdone.4781ufs_vnops.comastertemplatemastertemplateext2fs_alloc.cext2fs_hashallocext2fs_fserr__func__.5489ext2fs_nodealloccgext2fs_alloccgext2fs_balloc.cext2fs_bmap.cext2fs_bswap.cext2fs_extents.cext2fs_inode.cext2fs_indirtruncext2fs_lookup.c__func__.5665ext2fs_readwrite.cext2fs_subr.cext2fs_vfsops.ce2fs_sbchecke2fs_sbfillext2fs_vnops.cuvm_addr.cuvm_amap.camap_small_pool_namesuvm_anon.cuvm_aobj.cuao_find_swhash_elt__func__.4895uao_flushuao_list_lockuao_initialized.5250kobj_alloced.5209kernel_object_store.5208uao_listuao_getuao_pagein_pageuvm_device.cudv_referenceudv_flushudv_faultudv_detachuvm_fault.cuvmadviceuvm_glue.ctoggle.5623uvm_init.cuvm_io.cuvm_km.ckernel_map_storeuvm_map.cuvm_kmapent_mtxkernel_map_entry.6977uvm_kmapent_last_warn_timeuvm_kmapent_warn_rateuvm_meter.ccexpuvm_mmap.cuvm_object.cuvm_page.cinitialized.6784virtual_space_startvirtual_space_enduvm_pager.cuvm_pdaemon.cuvm_pmemrange.cuvm_stat.cuvm_swap.ccount.15990uvm_unix.cuvm_user.cuvm_vnode.cip_ecn.cin6_pcb.cin6.cC.21.6608in6_ifattach.callzero.5306allone.5307in6_cksum.cin6_src.cin6_proto.cdest6.cfrag6.cip6q_lockedicmp6.cicmp6errpps_counticmp6errppslim_lasticmp6_mtudisc_hiwaticmp6_mtudisc_lowatbuf.8003icmp6_redirect_timeout_qip6_id.crandomtab_20ip6_input.cip6send_mqip6send_taskip6_send_dispatchip6_forward.cip6_output.croute6.cmld6.cmld6_sendpktip6_optsmld_timers_are_runningmld_all_nodes_linklocalmld_all_routers_linklocalhbh_buf.4772nd6.c__func__.6545nd6_init_done.6304__func__.6305__func__.7113__func__.6734nd6_nbr.cdadqdad_initnd6_rtr.craw_ip6.cudp6_output.cgetsn.crandom.cexplicit_bzero.ctimingsafe_bcmp.cstrchr.cstrrchr.c__main.cimax.cimin.clmax.clmin.cmax.cmin.culmax.culmin.cmemchr.cmemcmp.cbcmp.c../../../../lib/libkern/arch/arm/bzero.S../../../../lib/libkern/arch/arm/bcopy.S../../../../lib/libkern/arch/arm/memcpy.SLmemcpy_backwardsLmemcpy_fl4Lmemcpy_fdestulLmemcpy_fsrculLmemcpy_ft8Lmemcpy_fl12Lmemcpy_fl32Lmemcpy_floop32Lmemcpy_floop12Lmemcpy_fsrcul3Lmemcpy_fsrcul2Lmemcpy_fsrcul1loop4Lmemcpy_fsrcul1loop16Lmemcpy_fsrcul1l4Lmemcpy_fsrcul2loop4Lmemcpy_fsrcul2loop16Lmemcpy_fsrcul2l4Lmemcpy_fsrcul3loop4Lmemcpy_fsrcul3loop16Lmemcpy_fsrcul3l4Lmemcpy_bl4Lmemcpy_bdestulLmemcpy_bsrculLmemcpy_bt8Lmemcpy_bl12Lmemcpy_bl32Lmemcpy_bloop32Lmemcpy_bsrcul1Lmemcpy_bsrcul2Lmemcpy_bsrcul3loop4Lmemcpy_bsrcul3loop16Lmemcpy_bsrcul3l4Lmemcpy_bsrcul2loop4Lmemcpy_bsrcul2loop16Lmemcpy_bsrcul2l4Lmemcpy_bsrcul1loop4Lmemcpy_bsrcul1loop32Lmemcpy_bsrcul1l4../../../../lib/libkern/arch/arm/memmove.Sffs.ct.1532fls.cflsl.c../../../../lib/libkern/arch/arm/memset.SLmemset_lessthanfourLmemset_addralignedLmemset_lessthan32Lmemset_loop16Lmemset_loop4strcmp.cstrlcat.cstrlcpy.cstrlen.cstrncmp.cstrncpy.cstrnlen.cscanc.cskpc.c../../../../lib/libkern/arch/arm/htonl.S../../../../lib/libkern/arch/arm/htons.Sstrncasecmp.cadler32.ccrc32.ccrc_tablegf2_matrix_timesgf2_matrix_squareinfback.corder.3171lenfix.3149distfix.3150inffast.cinflate.csyncsearchupdatewindoworder.3243lenfix.3191distfix.3192inftrees.cdbase.3077dext.3078lbase.3075lext.3076deflate.cputShortMSBlongest_matchlongest_match_fastflush_pendingfill_windowconfiguration_tabledeflate_slowdeflate_fastdeflate_storedzutil.czopenbsd.ctrees.cinit_blockstatic_l_descstatic_d_descstatic_bl_descpqdownheapscan_treesend_treecompress_blockextra_lbitsbase_lengthextra_dbitsbase_distbuild_treebi_flushstatic_ltreebi_windupbl_orderstatic_dtreeextra_blbitscompress.c../../../../arch/arm/arm/in_cksum_arm.Smainbus.cfdt.ctreetree_initedofw_gpio.ccpu_mainbus.ccpu_mainbus_attachcpu_mainbus_match../../../../arch/arm/arm/bus_space_asm_generic.S../../../../arch/arm/arm/bus_space_notimpl.Sbs_notimpl_messagebs_notimpl_panicLbs_notimpl_bs_mmap_textLbs_notimpl_bs_r_1_textLbs_notimpl_bs_r_2_textLbs_notimpl_bs_r_4_textLbs_notimpl_bs_r_8_textLbs_notimpl_bs_w_1_textLbs_notimpl_bs_w_2_textLbs_notimpl_bs_w_4_textLbs_notimpl_bs_w_8_textLbs_notimpl_bs_rm_1_textLbs_notimpl_bs_rm_2_textLbs_notimpl_bs_rm_4_textLbs_notimpl_bs_rm_8_textLbs_notimpl_bs_wm_1_textLbs_notimpl_bs_wm_2_textLbs_notimpl_bs_wm_4_textLbs_notimpl_bs_wm_8_textLbs_notimpl_bs_rr_1_textLbs_notimpl_bs_rr_2_textLbs_notimpl_bs_rr_4_textLbs_notimpl_bs_rr_8_textLbs_notimpl_bs_wr_1_textLbs_notimpl_bs_wr_2_textLbs_notimpl_bs_wr_4_textLbs_notimpl_bs_wr_8_textLbs_notimpl_bs_sm_1_textLbs_notimpl_bs_sm_2_textLbs_notimpl_bs_sm_4_textLbs_notimpl_bs_sm_8_textLbs_notimpl_bs_sr_1_textLbs_notimpl_bs_sr_2_textLbs_notimpl_bs_sr_4_textLbs_notimpl_bs_sr_8_textLbs_notimpl_bs_c_1_textLbs_notimpl_bs_c_2_textLbs_notimpl_bs_c_4_textLbs_notimpl_bs_c_8_textarm_machdep.cast.c../../../../arch/arm/arm/bcopyinout.S../../../../arch/arm/arm/copystr.Scpufunc.carm_dcache_l2_assocarm_dcache_l2_linesizearm_dcache_l2_nsets../../../../arch/arm/arm/cpufunc_asm.S../../../../arch/arm/arm/cpufunc_asm_armv4.S../../../../arch/arm/arm/cpufunc_asm_xscale.Sprocess_machdep.csig_machdep.c../../../../arch/arm/arm/sigcode.Sesigfillsyscall.cundefined.cgdb_uhgdb_trapper../../../../arch/arm/arm/vectors.Sarm32_machdep.cbootsyncdone.9101bus_dma.c_bus_dmamap_sync_segment__func__.8828cpu.cwtnamesi80321_steppingsi80219_steppingspxa2x0_steppingspxa27x_steppingsgeneric_steppings../../../../arch/arm/arm/cpuswitch.S../../../../arch/arm/arm/exception.SLreset_panicmsgLprefetch_abort_handler_addressexception_exitabortprefetchabortprefetchmsgLdata_abort_handler_addressabortdataabortdatamsgLaddress_exception_msgLundefined_handler_indirectionLundefined_handler_indirection_datafault.cdab_fataldata_abortsdab_buserrdab_alignmem.cpmap.cl1_lru_listpmap_pv_poollast_bootstrap_pagefree_bootstrap_pagesl1_listpmap_l2ptp_poolpmap_l2dtable_poolstatic_l1.7352csrcpcdstppmap_kernel_l2ptp_kvapmap_kernel_l2dtable_kvapmap_pmap_poolstatic_l2.7353pmap_vac_flagspmap_kernel_l2ptp_phys../../../../arch/arm/arm/setstack.Sstubs.csys_machdep.cvm_machdep.c../../../../arch/arm/arm/bcopy_page.S../../../../lib/libkern/arch/arm/divsi3.SL_udivideL_divideL_overflowL_divide_l0L_divide_l1L_old_codeL_divide_b1L_divide_b2L_divide_b3L_divide_b4L_divide_b5L_divide_b6L_divide_b7L_divide_b8L_divide_b9L_divide_b10L_divide_b11L_divide_b12L_divide_b13L_divide_b14L_divide_b15L_divide_b16L_divide_b17L_divide_b18L_divide_b19L_divide_b20L_divide_b21L_divide_b22L_divide_b23L_divide_b24L_divide_b25L_divide_b26L_divide_b27L_divide_b28L_divide_b29L_divide_b30L_divide_b31L_divide_b32L_divide_b0L_udivide_l1adddi3.canddi3.cashldi3.cashrdi3.ccmpdi2.cdivdi3.ciordi3.clshldi3.clshrdi3.cmoddi3.cmuldi3.c__lmulqnegdi2.cnotdi2.cqdivrem.cshlzero.1475subdi3.cucmpdi2.cudivdi3.cumoddi3.cxordi3.cconf.czaurus_machdep.cconsinit_called.8818bootstrap_bs_mapsection_freescsi_base.crqsbuf.5005sense_keysadescC.31.4768C.6.4258C.7.4355scsi_init_done.4064scsi_ioctl.cscsiconf.ccd.csd.csddoingadumpsoftintr.cpxa2x0.c../../../../arch/arm/arm/irq_dispatch.Spxa2x0_space.cpxa2x0_dma.cpxa2x0_intr.cpxaintc_attachedhandlerextirq_levelirqstr.7192pxa2x0_mutex.cpxa2x0_gpio.cpxagpio_softcpxagpio_regsirqstr.5782pxa2x0_clock.cpxaost_scpxaost_timecounterpxa2x0_com.cpxa2x0_a4x_space.c../../../../arch/arm/xscale/pxa2x0_a4x_io.Spxa27x_udc.cpxa2x0_ohci.cpxa2x0_lcd.cstatus.7751basic_color_mappxa2x0_apm.capm_evindex.7501../../../../arch/arm/xscale/pxa2x0_apm_asm.Ssleepdatasleepdata_svcpxa2x0_cpu_resume_virtcache_flush_loopdisable_fastbusenable_fastbusfrequency_change_91frequency_change_208frequency_change_highfrequency_change_on_cachepcmcia.cpcmcia_cis.cinit_cfe.3770pcmcia_cis_quirks.cpcmcia_cis_quirkspcmcia_3cxem556_func1pcmcia_3cxem556_func1_cfe0pcmcia_megahertz_xjem1144_func1pcmcia_megahertz_xjem1144_func1_cfe0pcmcia_sierra_a555_func1pcmcia_sierra_a555_func1_cfe0pcmcia_sveclancard_func0pcmcia_sveclancard_func0_cfe0if_ne_pcmcia.cwdc_pcmcia.cwdc_pcmcia_attachwdc_pcmcia_matchif_wi_pcmcia.cwi_pcmcia_productspxa2x0_pcic.cpxa2x0_mmc.czaurus_lcd.clcdbrightnesscurvallcdislitcurval.6494lcdisblanklcd_scr_descrzaurus_kbd.czkbdondownzkbdontvzkbd_keydesctabzkbd_keydesc_uszaurus_scoop.cdk.5969state.5970scoop_pcic.cscoop_mmc.czaurus_ssp.czaurus_apm.czts.ctail.6567wd.cwddoingadumpwddumprecalibratedwddumpmultiata_wdc.cata.cerrstr0_3.3725errstr4_5.3726autoconf.cdisksubr.cwsdisplay.cwsevent.cwskbd.cwskbd_console_inittedwskbd_console_devicewskbd_console_datanum.8437pos.8438wskbdutil.clatin1_to_uppercompose_tab_inordercompose_tabwsmouse.cwsmux.cwsemulconf.cwsemul_confwsemul_subr.cwsemul_vt100.cwsemul_vt100_subr.cwsemul_vt100_chars.cnrctablenrcovlposdecspcgr2unidectech2uniwsemul_vt100_keys.cvt100_fkeysvt100_pfkeysvt100_numpadrasops.crasops_masks.cflipped.1383rasops4.crasops8.crasops15.cwsfont.cagain.3144builtin_fontswsfont_find0cookiegen.3193bold8x16_iso1_datahid.chid_get_bytehidkbd.cusb.cusb_run_abort_tasksusb_run_tasksusb_nbusesusbdi.cerrinterval.4601usbdi_util.cusb_mem.cusb_subr.cusbd_trim_spacesusb_delay_wchan.4396buffer.4185usb_quirks.cuhub.cuhidev.cuhid.cukbdmap.cukbd_keydesc_usukbd_keydesc_deukbd_keydesc_de_nodeadukbd_keydesc_frukbd_keydesc_fr_appleukbd_keydesc_fr_dvorak_bepoukbd_keydesc_dkukbd_keydesc_dk_nodeadukbd_keydesc_itukbd_keydesc_ukukbd_keydesc_jpukbd_keydesc_svukbd_keydesc_sv_nodeadukbd_keydesc_noukbd_keydesc_no_nodeadukbd_keydesc_us_dvorakukbd_keydesc_swapctrlcapsukbd_keydesc_iopenerukbd_keydesc_esukbd_keydesc_beukbd_keydesc_ruukbd_keydesc_uaukbd_keydesc_sgukbd_keydesc_sg_nodeadukbd_keydesc_sfukbd_keydesc_ptukbd_keydesc_pt_appleukbd_keydesc_ltukbd_keydesc_laukbd_keydesc_brukbd_keydesc_trukbd_keydesc_tr_nodeadukbd_keydesc_plukbd_keydesc_huukbd_keydesc_siukbd_keydesc_cfukbd_keydesc_cf_nodeadukbd_keydesc_lvukbd_keydesc_nlukbd_keydesc_nl_nodeadukbd_keydesc_isukbd_keydesc_is_nodeadukbd.capple_fn_trans.4122apple_iso_trans.4137apple_fn_trans.4112apple_iso_trans.4131umass.cdCBWtag.7283umass_quirks.cumass_scsi.cif_aue.cC.13.5632if_axe.caxe_get_phynoC.18.6199C.3.5888if_axen.cC.12.6163C.3.5886if_smsc.cC.20.6290smsc_devsC.9.5894if_cue.cC.11.5171if_kue.cC.8.5206if_cdce.cC.13.5272cdce_crc32_tabif_udav.cC.16.5640udav_devsif_upl.cC.7.4999if_ugl.cC.6.5001if_url.cC.23.5617__func__.5844__func__.5820url_devsif_ure.cC.11.6517if_wi_usb.c__func__.8352__func__.8059if_ral.cural_def_bbpural_rf2525_hi_r2ural_rf2525_r2ural_rf2526_hi_r2ural_rf2526_r2ural_rf2522_r2ural_rf2523_r2ural_rf2524_r2ural_rf2525e_r2ural_def_macural_devsusbf.cdq.4987zero.5097status.5101zero.5106usbrev_strusbf_subr.csd0.4481sd1.4482usbf_error_strsbuffer.4304if_cdcef.cC.6.5069zaurus_udc.cmii.cmii_physubr.cukphy_subr.cnsphy.cnsphysnsphyter.cnsphyterphysqsphy.cqsphysinphy.cinphysiophy.ciophyseephy.ceephysexphy.crlphy.crlphyslxtphy.clxtphysmtdphy.cmtdphysicsphy.cicsphyssqphy.csqphystqphy.ctqphysukphy.cbmtphy.cbmtphysamphy.camphysacphy.cacphysnsgphy.cnsgphysurlphy.c__func__.4100__func__.4057__func__.4031rgephy.crgephyssdmmc.csdmmc_cis.csdmmc_io.csdmmc_mem.csdmmc_scsi.cswapbsd.cswap_onwi_set_nwkeypfslowtimonanouptimebuf_rb_bufs_RB_REMOVErandomreadaxe_ticklongjmpwi_usb_rx_list_initproc_freefd_getfile_modesr_crypto_discipline_initvfs_allocate_syncvnodetc_setclockpcmcia_printarpresolvechange_displayparamchrtoblktblcd9660read_filtopssw_reg_strategysys_minheritieee80211_tree_RB_NFINDputcharural_update_promiscuvmfault_unlockmapschild_returnsmsc_cartlabel_unrefHMAC_SHA1_Updatene2000_write_mbufsmsc_startuvm_map_initne_pcmcia_caipsec_soft_first_usenkmempagescopyinstraue_miibus_readregsys_getgidieee80211_tkip_micdofilewritevsdmmc_intr_establishwi_inquire_usbdumpmagieee80211_derive_ptkttyflushsys_setsockoptsrp_v_gc_startsys_ppollcomdefaultrateieee80211_watchdogclock_gettimedefrouter_lookupinetswwi_get_fid_usbcdce_rxeofuuid_enc_beip_reassrt_maskedcopyin6addr_anyVOP_ACCESSusbd_get_quirkswsmouse_init_scalingip6_get_prevhdrscheduler_startpxa2x0_gpio_intr_stringpmap_alias_bitsuvm_maxkaddrnsphy_cdsdmmc_mem_sd_switchumass_io_puticsphy_resetieee80211_getmgmtrlphyattachpxa2x0_gpio_intr_establishipmforwardingohci_waitintrzssp_read_max1111ure_init_fifofilt_msdosfswritesys_closeusbd_do_request_flagswsemuldisplaydevsubmatchrtflushclone1sys_pipe2ffs_inode_allocdes_encrypt2sys_setsidieee80211_encapax88190_init_cardzaurusmod__ashldi3vn_statin6_hasmultirn_initmaskunp_detachnd6_nud_hintether_ip6multicast_mintcp_secretrti_find__mainaue_stopufs_quota_deletehardclocksd_vpd_thinenc_xform_aes_ctrsr_raid5_discipline_initsr_rebuild_threadwi_read_data_iowdc_reset_channelin6_domifdetachieee80211_get_authmtx_enter_trysmsc_sethwcsumwskbd_cndetachcd9660_vgetieee80211_inputcrypto_dispatchsr_discipline_shutdownwsmouse_touch_syncgeneric_armv4_bs_wm_2if_group_routechangesys_fstatatnd6_timer_workpxa2x0_apm_sleepohci_device_intr_closeurl_csr_read_2dest6_inputgsignalacphy_caipport_firstautomii_mediachgwi_txeofaue_devsipsendredirectsbpf_setifbuf_flip_highunp_internalizetk_rawcc__wdstartscsi_xs_sync_doneaxen_initfc_lfcemptyvfs_export_lookuprasops_eraserows_rotatedifnetif_cloners_countyieldohci_endpdm_freemwsmuxattachuhid_seltrue_filtopssc_print_addrfilt_seltruecomspeedlogsmsc_tick_taskvn_writechkin_ifscrubarmv4_tlb_flushIuvm_pmr_freepageqdp8390_media_initpdevnames_sizemichael_updatescsi_mode_select_bigroute_dstsingle_thread_clearinit_execsr_schedule_wuuvm_pmr_size_RB_NEXTuvm_addr_alignieee80211_send_4way_msg4wskbd_cdsdmmc_mem_enablezaurus_udc_attachnamecache_rb_cache_RB_FINDbcmpgeneric_bs_r_1ieee80211_node_detachnd6_dad_startgpt_chk_hdrexec_maxhdrszieee80211_ifattachSHA512Initmmmmapieee80211_clean_nodessetjmpsd_read_cap_16prefetch_abort_handler_addresswdc_disable_intraes_ctr_reinitbio_infowsdisplay_switchurlphy_funcsuvm_deviceopsuvm_addr_align_backlogread_filtopsrasops_cursorvndxfer_poolcpu_info_primarytcp6_mtudisc_callbackcopyoutstrfdt_node_propertymainbus_matchaxen_tick_taskieee80211_countrycode2regdomainusb_transfer_completelxtphy_servicepxammc_matchapm_suspendscoop0_set_card_powerswcr_newsessiontcp_attachla_hold_totalwskbd_cngetcbuf_dirtysoo_writesystempagem_zeroural_alloc_tx_listnd6_llinfo_timervn_fsizechkunp_gcingreaddoslabelbdevswcalctsrubaddynamicportsohci_root_ctrl_closeural_ack_rateuvm_mk_pclusterbswap16domainnameuvm_pmr_addr_RB_REMOVEpledge_flockwsmouse_detachttywrite_filtopswi_usb_devsnd6_ns_outputbpfkqfiltersorwakeupinflateCopyttyunblocksr_meta_opt_loadbiocloseremovedeudav_miibus_statchgigmp_timers_are_runninguvm_deallocatefilt_procattachufs_quota_free_inode2filt_procdetachsys___thrwakeup__divdi3wsemul_getnameallowpowerdownsys_clock_settimeural_txeofwdc_floating_buspxa2x0_spllowerlocnameshidkbd_bell_fndisk_busyhidkbd_belltcp_pulloutofbandsqphy_statussddetachifq_barrier_taskzapm_power_infoarprequesttfork_child_returnsiginitaxen_casr_wu_enqueue_ccbpool_set_constraintsusb_task_thread_procip_sysctluhidev_closemsdosfs_vptofhscsi_mode_sense_bigusbd_clear_endpoint_stallsetdisklabelbio_registerdeflateknote_removescoop_pcic_writepmap_bootstrap_pv_page_allocbufq_nscan_createsr_hotspare_rebuilduvm_mapent_addr_insertext4_ext_in_cacheroutedomainusbf_interface_numberhid_locateicmp6_errornd6_rs_attachVOP_MKDIRrtl80x9_media_initip_protoxsys_settimeofdaypcmcia_read_cissdstrategyaddloguvm_page_physgetif_input_task_lockedusbf_add_taskmsdosfs_synccheckdisklabelscoop_pcic_attachscsi_mode_senseure_ocp_reg_readip_savecontrolstackgap_randomvm_map_unlock_lnffs_clrblockusbd_set_hub_featureif_congesteduvm_addr_linsearchbpf_filterchgproccntip_drainieee80211_tree_RB_PREVumass_init_shuttlesoqremque__adddi3uvm_map_inheritusbf_rem_taskapmopensys_getthridcd9660_syncin6_ifawithscopebuf_page_offsetuvm_pmemrange_addr_cmpkm_freeusbd_is_dyingzts_pollsync_printvnopsieee80211_rssadapt_inputsys_lchownmsdosfs_removecd9660_readieee80211_regdomain_compare_rnfilt_timerdetachwi_get_idzeroin_addrbmtphy_cdwskbdkqfilterwdc_set_drivecyrillic_to_koi8uvm_map_protectusbd_get_xfer_statuswsfont_enumpxammc_clock_stopuvm_map_setup_mdprintfpxa2x0_splraisecdce_devsrandomwritepxa2x0_cpu_suspendprelist_updatehmac_ipad_buffercrypto_drivers_numsmsc_miibus_readregip6_protoxsys_recvfromswcr_freesessionttrstrtwskbd_mux_openrandomif_getkcopysdmmc_mem_mmc_initzts_sync_sendwsdisplayopenext2fs_initext4_ext_put_cachertfreesingle_thread_checkpxaudc_freemtcp_syn_hash_sizecuio_getptrcd9660_linkwsdisplay_emul_detachhostnamelenupl_cdusb_needs_reattachdeflateTuneusbd_get_hub_ss_descriptorzkbd_cnpollcuaddr_hint_selectxscale_cache_purgeID_rngttyopenraw_ctlinputwi_usb_ctl_unlockzkbd_devpxa2x0_gpio_iohfdt_initbpf_insn_dtornd6_ioctlsched_chooseprocbpf_mem_ldwzssp_ic_stoplcd_set_brightness_internalphyslockspec_setattraxe_miibus_statchgpte_l1_s_protoarpinputusbd_get_stringfill_prlistipsec_exp_allocationsHMAC_SHA256_Finalbpfcloseusbd_probe_and_attachdirtyqueuesys_writevsys_setprioritym_tag_prependaxe_cmdurl_unlock_miiumass_detachusbd_free_iface_dataip_defttlif_inputwi_usb_attachurl_rx_list_initdopipeusb_schedsoftintrarpintrsdmmc_activatewsemul_vt100_output_scs94_percentkqueue_registerin_delmultisdmmc_io_rw_directsdmmc_io_write_2pxa2x0_init_interrupt_masksdisk_lookupuid_findnd6_rtrequestuvm_km_suballocusb_delay_msrasops_eraserowsif_getgroupattribsbpfdetachsys_closefromip6id_pmodttydefcharssigexitscsi_link_openhidirtypagesin6mask128bus_space_read_raw_multi_4uvm_amap_poolin_pcballocVOP_LOOKUPsr_raid5_regeneratesr_meta_readapm_pxaip_caphysical_startbs_notimpl_bs_c_8ifa_delenqueue_randomnessexphyattachusbd_set_idleieee80211_find_node_for_beaconemul_nativeaxe_txeofwskbd_inputacphy_cdsdmmc_printwsmux_attach_sccpu_do_powersaveaue_rx_list_initwsdisplay_kbdholdscreenuvm_km_pagesufs_quota_alloc_inode2ieee80211_name2countrycodemicrouptimesr_validate_ioaes_xts_decryptsocket_poolsr_raid_recreate_wupgrphashsys_setpgidpledge_sysctlprofhzAES_GMAC_Updatesr_meta_init_completeohci_setaddrntp_update_secondcache_enterexec_elf32_makecmdsusb_rem_wait_taskext2fs_bufatoffsys_setlogininitarmamap_listpxa2x0_lcd_suspendconfig_process_deferred_mountrootip6_maxifprefixestcp_do_rfc3390ieee80211_req2nodesys_setresuidpxa2x0_lcd_load_fontrn_deletesd_get_parmsiskmemdevstat_rush_requestswi_watchdogipsec_def_compfc_lmdistancepxa2x0_intr_stringure_ifmedia_updnch_poolphtree_RB_REMOVEsomaxconnsdmmc_card_intrural_readugl_initpxapcic_socket_enablescsi_xs_get_donepxaudc_ctrl_methodsipsec_exp_timeoutip_directedbcast_bus_dmamap_loaduvm_pmr_pg_to_memtypeuihashtblieee80211_node_getrssitaskq_syssd_buf_doneieee80211_get_rtsamap_initffs_flushfilesicmp_sysctlsys_lseekdes3_decryptmsdosfs_pollmsdosfs_accessaddupc_intrdvd_read_bcaamphy_serviceure_stopvm_map_lock_read_lnwsevent_finiip6statwsmux_set_layoutuvm_pageboot_allocconfig_pendingmii_phy_updatesys___thrsleepsys_accept4ether_crc32_leaue_csr_write_1ipipstatsecurelevelurl_matcharpt_keepsdmmc_mem_mmc_switchsavectxpte_l2_l_cache_mode_ptpool_multi_allocbinuptimedogetrusagesys_seteuidpxa2x0_bs_allocuao_shrink_hashugl_rx_list_initwskbdpolluvm_map_checkprotauth_hash_chacha20_poly1305max_protohdrdes_is_weak_keyural_rf_writezapm_poweroffieee80211_add_qos_capabilityieee80211_cipher_keylensdmmc_alloc_ccbsumass_scsi_attachsr_raid1_discipline_initrandomkqfilterbufpagessleep_setup_signalrlphy_cdpool_countprocess_newsys_keventcopyargsarc4_reinitsr_chunk_in_usewd_standbymi_switchcd9660_statfsrasops_rotate_fontsr_scsi_wu_puttsleepkern_sysctlnd6_delayin_pcbinitsys_fchmodatsqphymatchbs_notimpl_bs_rm_4Chacha20_Poly1305_Reinitnmbclust_updatehw_prodfdremovepxaudc_softintrigmp_fasttimouserconf_cmdbufwi_get_pmumass_bbb_stateohci_device_ctrl_abortxin_rootonlycdce_startapmioctlusbd_port_disown_to_1_1uvm_map_entry_poolcrgetunp_bindtcp_delackcsignalreaddisklabelvm_map_unbusy_lnusbd_clear_endpoint_stall_asyncwskbd_set_displayvirtual_availbs_notimpl_bs_rr_2tcpstatpledge_adjtimea4x_bs_r_2dma_constraintuvm_anon_poolicmp6_mtudisc_timeoutfillmapentrytcp_timer_persistugl_intrwsemul_vt100_output_esc_hashcpufunc_ifarudav_newbufsys_umask_tr_flush_blockpow2dividesyn_cache_reaperieee80211_find_rxnodefilt_fileattachsysentcpuset_addpmap_alloc_specialsbs_notimpl_bs_r_8tcp_setpersistufs_ihashlookupscsi_inquire_vpdicmp_rediracceptmemmoveapmcloseure_matchusbd_get_hub_statuswsemul_vt100_detachural_attachip_outputrefcnt_rele_wakebpf_mtapnkmempages_maxfindblknamekue_rx_list_initpool_inituvn_referencelcd_ioctlpcmcia_card_attachuvm_pmr_addr_RB_PREVrt_sendaddrmsgbpfreadbio_errorpxaudc_ep0_intrpool_putm_copym2cd9660_kqfiltersr_raid5_addiobuf_alloc_pagessysctl_structbufqs_stopunhandled_afaxe_ifmedia_stsif_input_localsysctl_rdstringuvn_attachsdmmc_send_if_condlasttimesr_wu_putsysctl_disklockcnkqfiltermountroot_config_queuebs_notimpl_bs_r_2ufs_pollsr_raid5_writepmap_map_sectionmsdosfs_readlinkpmap_devmap_bootstrapieee80211_decryptusbd_get_device_statussdmmc_verbosenchinitexec_mapsnprintfcomcngetcext2fs_readlinkether_ioctlumass_bbb_transfertqphy_servicescoop_pcic_functionsip6_forwardingsys_dup3sr_shutdownural_cdkue_resetrasops_isgray_bus_dmamap_load_mbufwdc_print_capssdmmc_io_write_1wi_watchdog_usbcd9660_ioctlin_pcbnotifyalluvm_pglistallocsyn_cache_addohci_device_ctrl_transferwsdisplay_addscreenbuf_kva_enduvm_map_splitentryvm_map_lock_lnincoreurlphy_cdhzusbf_attachdefrouter_resetcd9660_ihashinssched_exitcheckaliasdl10019_mediachangettyretypestartuphook_listsdmmc_card_detachpte_l1_s_cache_modeuvm_pmr_remove_addruaddr_pivot_poolkue_detachrt_timer_queue_changepool_p_alloclf_initwi_ioctl_usbcpu_attachwdc_preata_drivemii_phy_matchpxaudc_cdural_amrr_timeoutzlibVersionrasops_list_font_cbzapm_enable_chargingsdclosevop_generic_kqfilterzts_attachpffasttimoinitsiginfosys_getuidcomconsunitcpuidsexec_setup_stackuao_createskip_nodesensor_detachbuf_mapaue_lock_miiidentify_arm_cpuffs_realloccgcdcef_newbufure_detachwskbd_load_keymapxscale_cache_cleanD_rngm_clpoolpxaudc_zaurus_cacd9660_bufatoffgroupmemberuvmspace_initscsi_plug_detachether_sprintfmsdosfs_unlockselwaitpmap_init_l1icmp6_mtudisc_callbacksnd6_slowtimosys_forkbufq_implsip_setmoptions__qdivrempmap_deadproc_cache_statepxagpio_reg_readspec_openpmap_vac_me_kpmapmld6_checktimerswcr_sessionsfilt_bpfreadsr_disk_attachwsdisplay_emulinputuvm_fault_wireusbd_abort_pipepcmcia_ccr_readkernelstackicmp6_mtudisc_timeout_qcrypto_initvm_nphysseguhidev_get_report_async_cbip6_randomiduvm_pseg_initsrpl_rc_initproc_filtopself32_os_pt_notewdc_print_current_modesSHA512Transformfiledescopensys_vforkpmap_vac_me_usercomcnspeeduvm_pager_initcpufuncswinChkNamepxaip_matchdvd_read_copyrightieee80211_recv_4way_msg1sys_getlogin_rbio_delegate_ioctluvm_pmr_addr_RB_MINMAXnd6_rs_detachuvm_uarea_freepxapcic_scoop_casys_mkdirdl10019_media_finiaxen_watchdoguao_reference_lockedcom_resumepmap_devmap_tableufs_fhtovpcrypto_donewskbd_translatedumppcbusbf_string_descriptorrttrashtargetpagesohci_root_ctrl_abortmblowatrasops_rmaskgetnewvnodeufs_inactivekue_load_fwnd6_mmaxtriessingle_thread_waitsys_socketusbd_request_async_cbffs_cgreaduvm_mmapanonwi_init_usbwsemul_utf8_translatevm_map_lock_try_lnzssp_read_ads7846spec_close_clonevop_generic_bwritenanotimescsi_detachfdt_next_propertyufsspec_writelxtphy_casd_read_cap_10iso_disklabelspoofpcmcia_cafdfreeuvn_detachieee80211_ccmp_set_keyuvm_km_valloc_trytty_countugl_cdhidkbd_detachdeflate_globalpxaudc_intrraw_disconnectpxaudc_ctrl_closemsdosfswrite_filtopssensor_task_registerusb_attach_roothubip6_neighborgcthreshbufkvmKERNEL_BASE_virtpxaohci_activateremove_coproc_handlerumass_polled_transferdeflateSetHeaderuvm_pmr_extract_rangesensor_attachbrelvpgpio_strobe_pins_c3000msdosfs_mountfsvfs_relookupuvm_map_addr_augment_getsys_utracencpusfoundwi_stopzts_ioctlsync_fsyncure_rx_list_initsetstatclockratecd9660_strategyuserconf_parserrw_initpxaudc_intr1ext2fs_allocif_input_processzapm_ac_onpmap_cachevivtwskbd_deliver_eventcom_fifo_probeieee80211_delba_requestrtable_walkskip_propertybread_cluster_callbackfdcopypxapcic_event_processin6_proto_cksum_outbpf_d_refbuf_acquire_nomapAES_GMAC_Finalrtable_matchb_to_quvm_pmr_size_RB_INSERTin_len2maskbus_space_read_raw_multi_2ugl_startpxa2x0_lcd_setup_rasopsscoop_set_irledusb_blk_freelistudp_sendspacerasops_alloc_screenscoop_gpio_pin_readuvm_objtree_RB_PREVifg_headvfs_rootmountallocSHA1Updatecue_tx_list_initaxen_iffbs_notimpl_bs_sr_2pool_wait_freecd9660_openrw_initwsemul_vt100_output_dcsglass_consoleAES_GMAC_Reinitsr_uuid_generateohci_root_ctrl_startvm_map_busy_lnbuf_rb_bufs_RB_FIND_bss_end__ext2fs_blkprefwi_alloc_nicmem_ioicsphyattachscsi_activateuhidkqfilterVOP_ISLOCKEDsys_kqueueAES_GMAC_Initieee80211_tree_RB_REMOVE_COLORuao_referencein6_addrscopebuf_getsys___threxitieee80211_ifdetachapm_get_eventbs_notimpl_bs_wm_4in_remove_prefixvfs_getcwd_scandirmaxlockdepthwi_usb_tx_unlockieee80211_free_noderaw_usrreqnblkdevuhidev_detachbs_notimpl_bs_wm_2sr_crypto_hotplugttyinputscancukbd_consopsbiodonefdt_node_property_intszssp_activatedehashkeyicmp6_rip6_inputwi_usb_txfrmsmsc_encapmaxslpext2fs_makeinodepool_requestsys_chflagsatcue_startaue_csr_read_2ufsread_filtopsufs_symlinkm_dup_pkthdrsr_crypto_assembleufs_mkdirvfs_getcwd_getcacheusbd_get_no_altssdmmc_initural_newassocaxen_attach_length_codenamecache_rb_cache_RB_PREV__anddi3phtree_RB_REMOVE_COLORrt_missmsgVOP_BMAPip_dooptionsvn_lockcue_tick_tasktimeout_add_tsrip6_ctlinputscsi_link_shutdowncdce_caSHA384Initwsemul_vt100_handle_csiumass_cbi_adscsbdropsr_meta_native_attachmsgbufphysusbd_desc_iter_nextscoop_discharge_batterytcp_debugusbd_transferinpcb_poolohci_pollohci_hubdnextralocwsmouse_touchsmsc_miibus_writereguvm_addr_fitspaceblf_keysys_setegidbus_space_write_raw_multi_4wdc_wait_for_statusnd6_inusern_matchpledge_protexeccd9660_symlinkautoconf_verbosein6_setpeeraddrunp_externalizesys_munlockalluvm_faultscoop_led_setrandomioctlsoftraid_disk_attachsoreceivepxaudc_connect_intrpool_getuextralocsdmmc_discover_tasksharp_zaurus_C3000scsibus_printlinkudav_csr_read1ieee80211_eapol_key_inputohci_root_intr_startffs_dirprefif_enqueuerip6_outputinflatescsibus_cdin6_get_rand_ifidndflushpxaudc_allocxcompose_tab_cmppxa2x0_lcd_start_dmaieee80211_parse_wmm_paramsrn_insertspec_pollif_rxr_getbpf_wakeupfilt_kqdetachaue_unlock_miiwsmux_getmuxipsec_exp_bytesdosendsyslogconfig_defersys_faccessatgf_mul_bus_dmamem_allocm_tag_initbsearchif_attachm_dup_pktghash_update_miif_deactivatesr_crypto_free_resourcesugl_casys_setrtablelcd_get_brightnesssr_raid_read_capfontlistuvm_map_addr_RB_REMOVE_COLORuvm_anwaitnameibs_notimpl_bs_sr_4uvm_map_setup_entriesext2fs_readdirip6_ctloutputdead_pollpte_l2_l_coherenttqphy_funcswihap_initversion_bus_dmamap_syncuvm_pmr_remove_sizelzs_dummybuf_needvakqueue_initieee80211_wep_delete_keyure_tickaxe_rx_list_initata_dmaerrieee80211_bip_set_keyuvm_pagezeroin6_setsockaddrigmp_leavegroupcom_common_getcaxen_cmdbs_notimpl_bs_rr_8mountlistuserconf_histbufsys_getdentscomsoftwihap_mgmt_inputudav_initconfig_deactivateVOP_REVOKESHA256Finalclallocbiowaitusbf_insert_transferfilt_ufsreadrasops_vcons_cursorunixswuvm_objtree_RB_INSERT_COLORsccstqphy_cawsdisplaymmappmap_updateccpumq_purgepxa2x0_gpio_intr_maskgeneric_bs_sr_1hidkbd_inputprocess_zapsr_raid6_wu_donertable_allocfdinitboothowtoarc4randomnsphy_funcsure_unlock_miitcp_delack_ticksupl_stopttopenata_get_paramsukbd_apple_iso_mungeip6_randomid_initieee80211_tx_ba_timeoutether_ipmulticast_minconfig_rootsearchrip6_sendspaceieee80211_countrycode2nameuao_dropswapenxiosys___getcwdcd9660_specvopsusb_cdwsdisplay_switchtoconsolepmap_enterrtmap_growamphy_funcsundefined_handler_addressRMD160Transformsys_setreuidSHA1Initusbd_ratecheckwi_usb_open_pipesudav_tick_taskuvm_map_findspacewsevent_initl1_sec_tablecomcnattachwdc_xfer_puta4x_bs_w_2sdsizeuao_dropswap_rangesblocksys_pwritevudav_lock_miikqueue_scanure_rtl8152_initieee80211_pmksa_findnet_livelockedusbd_iface_claimedtcp_closeohci_free_stdsd_patternssdmmc_disablescsi_initmsdosfs_advlockdl10019_mediastatusswcr_idkue_attachusbd_free_xferip6id_initidsys_utimensatfalloclxtphy_cdisohashkeydeadproc_mutexml_initpfctlinputcomcnprobephys_mapext2fs_pathconfumass_bbb_methodssoft_intrqdeflateSetDictionaryufs_lockcomintrsys_accessnsphy_statusuvm_swap_iouserconf_initkillpg1url_tx_list_initwsmouse_mux_openarpproxyvputonfreelistwdioctlext2fs_mountrootieee80211_findrateregyearurl_ioctlpage0setrunnableaxen_miibus_statchgwsmouse_motion_syncpxa2x0_pi2c_closeuvm_pmr_getpageswi_set_ssidcue_ioctlzts_accessopsnd6_prefix_onlinkffs_specvopscue_attachpxa2x0_stray_interruptelf32_read_fromosversionhid_is_collectionwsmouse_setnsgphy_statuswi_usb_tx_list_initapm_power_infoin6_pcbaddrisavailfind_pfxlist_reachable_routerip6_pcboptstvtohzieee80211_get_eapol_keyphtree_RB_NFINDratecheckpxa2x0_imaskin_rtchangevfs_syncwaitudav_ifmedia_statusaue_crcieee80211_node_lateattachcansignalieee80211_up_to_acmsdosfs_check_exportlf_setlocknbigpipecue_devswsfont_map_unicharin_controlieee80211_get_addba_resprlphy_funcswsmux_srcopslmaxuvm_pagecopyphtree_RB_NEXTzssp_ic_startsysctl_quadsys_readexec_process_vmcmdskue_tx_list_initpxa2x0_pi2c_setvoltageieee80211_tree_RB_FINDifq_deq_beginmbstatuhidev_intrttyinfousbf_transferusbd_get_device_stringttyinohci_root_ctrl_donegetnulldevispidtakensr_meta_save_callbackbufcache_getcleanbufextent_destroyenc_xform_rijndael128if_group_egress_buildzapm_pollloop_clonerttsetwatergetcieee80211_addba_requestsr_raid6_intrfilt_apmrdetachpledge_killural_update_slotuvm_pseg_lcksr_ioctl_volpmap_enter_pvuvm_mapent_mkfreeunp_disconnectsys_listensys_mountbpf_mtap_etherpgsignalfirstcuhub_detachusbf_set_addressieee80211_ccmp_delete_keysr_failioffs_fsyncwsmux_mux_openwsdisplay_consinetdomainwsfont_findscsi_devid_wwnifq_enqueuememcpywdc_enable_intrkthread_exitscsi_req_detachpriq_deq_begincue_newbufdisk_constructpledge_sockoptvfs_unbusywsdisplay_paramrip_usrreqifq_deq_commitvm_map_upgrade_lnpledge_failpledge_chownspec_writekq_timeoutmaxsdmmc_inquiryin_broadcastfd_getfilehidkbd_set_ledsmsgbufaddrsdioctlutsnameip6_setmoptionsexit2usbf_set_configdosigsuspendaue_resetkue_open_pipesip6_mloopbackext2fs_cgupdateieee80211_send_4way_msg2tcp_update_rcvspacerddumpusbf_set_endpoint_featurecpu_setperfuaddr_rnd_poolufs_lookupufs_bmappxagpio_cdudav_miibus_readregcpufunc_dfarip6_randomflowlabelttpolldegetlogpollkthread_createin_pcbresizesdmmc_mmc_commandwdc_default_read_raw_multi_2axen_rx_list_initlogclosesd_vpd_block_limitsieee80211_kdfgeneric_bs_wr_4pcmcia_submatchinstall_coproc_handlernd6_dad_findohci_rhscudav_detachufs_strategysr_crypto_create_key_diskohci_device_requestkue_watchdogphysical_freeendcopy_statfs_infobounds_check_with_labelarc4_timeoutsr_raid1_assemblesd_ioctl_cacheext2fs_checkpathsocantrcvmoreprocess_poolip6_setpktoptfile_filtopssr_raid6_rwaf2idxbuf_unmapmsdosfs_renamesdmmc_mem_initpipe_wfiltopsure_ctl__lshldi3purge_detachedif_isconnectedpfxrtr_addsrp_initcd_load_unloadipq_poolpxa2x0_rtc_getsecsuaddr_kbootstrap_destroyaxen_encappmap_activatebuf_dealloc_membmtphy_reseticmp_input_ifconfig_make_softcpte_l2_s_prot_krunp_discardcue_csr_write_1ip6_outputwi_read_record_iouhid_caudav_rxeofwsmux_get_layoutswap_syscall_lockufs_kqfilterieee80211_newstatescsi_autoconfcheckdirsexecswwsfont_addzapm_batt_minutessr_raid0_createsdmmc_set_relative_addrnsphyter_cdumass_atapi_attachwsemul_vt100_output_csiin6_are_prefix_equalin6_controlpxaudc_bulk_startuvm_pmr_rootupdateleapyearsleep_finish_timeoutsys_sigsuspendcd9660_unmountwsemul_vt100_output_scs96in_pcblookup_localswcr_authcomputertmap_dtornamecache_rb_cache_RB_NFINDtrapsignalpxaohci_enablerushjobpmap_devmap_registerrn_inithead0wd_flushcachend_defrouterblf_decfdcloseexecuvm_map_sel_limitsevcount_attachlimcopybio_doreadwi_do_hostencryptscoop_activatescsi_req_probeuvm_mapent_forkcopytcp_timer_rexmturl_ifmedia_changepcmcia_io_maprt_timer_initsr_crypto_rwuaddr_rnd_createieee80211_next_modeputsaxe_tx_list_initrip6statip6_id_ctxtcp_debxcnpollcd_casdmmc_task_threadsys_truncateesigcodeacphy_servicescsi_xfer_poolscoop_pcic_clear_intrarmv4_tlb_flushIDudav_csr_readohci_add_doneieee80211_tree_RB_NEXTsched_choosecpu_forkohci_add_edwdc_xfer_poolcdce_newbufsoacceptkqueue_pollcdgetdisklabellcdintruhidreadufs_createfdt_get_sizend6_freend6_optionscd9660_seeknd6_llinfo_settimersr_roam_chunkssdmmc_mem_write_blockfreqmsdosfs_unmountpool_gc_tickelf32_load_psectionnamecache_rb_cache_RB_MINMAXtaskq_create_threadarm_pcache_unifiedm_tag_nextohci_intr1msdosfs_writezaurus_udc_detachcue_resetbs_notimpl_bs_w_1exec_script_makecmdszapm_resumeieee80211_reset_erpfilt_pipedetachcd9660_rootentropy_add_ptrrgephy_statusiophyattachzts_readposne_pcmcia_get_enaddrdisk_attach_callbackselrecordffs_validatecomstopaxe_ax88772_initffs1_compat_readrip_outputrrw_exitpxaudc_bulk_methodsext2fs_accessmld6_fasttimeouaddr_rnd_insertkthread_qcdcef_txeofimaxwsmouse_matchsched_barrierohci_free_seduserconf_pdevsr_detachinflate_fastmbpoolclock_secs_to_ymdhmsaes_xts_setkeytcp_canceltimerstqphymatchrip_recvspaceroute_initswap_prioritytc_setrealtimeclockrt_ifa_addlocalwdc_get_xferpxaip_measure_cpuclockuvm_vmspace_poolpxapcic_cdpipe_createwsemul_getcharnd6_sysctlpxa2x0_setperfnd6_rs_output_timersyn_cache_putdoopenatvn_openif_clone_createifq_purgebufq_fifo_requeuesr_boot_assemblycdce_tx_list_initSHA384Finaluao_detachcpufunc_controlmallocamap_pp_adjrefauth_hash_hmac_sha2_384_192in_pcbrtentrysbunlockknote_dequeuesr_discipline_initwi_cmd_usbpte_l1_s_prot_kw__udivsi3tcp_outflagskqueue_statcdce_ioctlcd9660_rrip_analyzeohci_hash_find_tdexphymatchbuf_fix_mappingbio_unregistersys_preadvuserretsys_recvmsgpipe_statHMAC_MD5_Finalif_refvn_writesr_hotplug_unregistermtdphy_servicehidkbd_hookup_bellVOP_LINKpcmcia_megahertz_xjem1144_func0icmp_inputumass_cdvcountieee80211_get_sa_queryuvm_vsunlock_devicerd_root_sizein6_delmultistathzenc_xform_cast5route_ctloutputpxagpio_dispatchsched_idlebio_warnwdc_ata_bio_intrwskbd_cnattachvirtual_enduhidev_get_reportpxa2x0_gpio_intr_disestablishbuckstring_initdetrunccopyoutpfindbufq_peekcomconsaddrip_ctloutputif_ifp_dtoruhidev_set_report_asyncwsevent_readgpio_controller_get_pinufs_dirbadcd9660_readdirvfs_unmountallrgephy_loopwsdisplaypollsys_renameatohci_allocxwsmouse_motioncopyrightsdattachsched_peg_curprocwdc_default_lba48_write_regtcp_timer_keepusbd_devinfo_vpsbsyncwsemul_vt100_cnattachtcp_mss_updatefree_pagesfdt_find_phandle_recurserw_enter_readvunmapbufgpio_sense_pins_c3000uvm_map_pageable_wireroute_outputrti_deletefreepidsys_geteuidpxa2x0_gpio_set_functionsdmmc_mem_single_read_blockrasops_masks_initapm_attachzaurus_main_batteryicmpmaskreplin6_pcblookup_listenmsdosfs_mknodttkqfluship6_defmcasthlimsys_munmapsdmmc_io_write_multi_1axen_stopkp_nonepxa2x0_lcd_initializefilt_solistenvsnprintfpxammc_intrpte_l2_s_prot_urwsmouse_mt_convertwsemuldisplaydevprintgpio_controller_config_pinarplookupuvm_map_pageablechainallocwsmouse_mtstatesw_reg_startpmap_copy_page_xscalewsmouse_compat_convertsr_ioctl_deleteraidifmedia_baudrateusbd_setup_default_xferzssp_attachuvm_pagelookupsoshutdownuserconf_hist_cmduserconf_listproc_cansugidcd9660_rrip_getsymnamewsemul_vt100_scrolldownwsdisplay_getc_dummyip_mloopbackbpf_iflistKQREFwdc_downgrade_modeip6intrqaxe_newbufnd6_rs_inputscsi_activate_bussoabortif_ih_unrefusbf_clear_endpoint_haltcast_encryptunp_inocanonpathtaskq_threadhidkbd_attach_wskbdlogkqfilterip6_init2uprintfsensordev_installsysctl_ifnamesmainbus_caif_rxr_initcoredump_elf32softdep_flushworklistsys_issetugidinitclockssdmmc_decode_cidcd9660_mmapif_detachaue_watchdogwsmuxopenwdc_ata_bio_startnd6_cache_lladdrcatqsession_poolugl_txeofunp_connectuvm_pagermapinif_detached_startpool_serialugl_ioctlxscale_cache_flushD_SEscsi_probe_lunaue_ioctlirq_entryvfs_mountedoncputypefc_lookup__bss_start__usbf_alloc_xferif_downndqbtaskq_sleepVOP_GETATTRieee80211_fix_ratea4x_bs_wm_1ip6_mtudisc_timeoutieee80211_node2reqwi_usb_matchelf32_check_headergf_logeephy_cdinphy_cdttytstampural_set_txantennaieee80211_node_allocieee80211_crypto_detachpmap_unwirepool_lockuvm_pageunwirerti_fillHMAC_SHA256_Inithw_seriallcd_pxaip_caieee80211_mcs2mediawsdisplay_resume_deviceauth_hash_hmac_md5_96autoconf_attdetapm_thread_createOF_peerufs_chmodbufq_nscan_resortsys_o58_killcdattachuserconf_devicepledge_syscallsm_resethdrsys_sigaltstacksdmmc_cisptrsoisdisconnectingdevice_mainbusBlowfish_initstatesched_steal_procwi_media_changenull_decryptrttimer_queue_headarm_pdcache_sizedp8390_enableexphy_cartredirectnsgphy_casoftintr_inituvm_pmr_pnaddrttymodemwsdisplay_defaultscreensmtx_enteraxe_devskqueue_poolvntblinitbuf_rb_bufs_RB_INSERTcpuset_intersectioncd9660write_filtopsAES_GMAC_Setkeysleep_queue_initax88190_mii_bitbang_opspmap_preferin6_ifattach_linklocalsys_setresgidsr_crypto_encryptsdmmc_mem_read_block_subruvm_pmr_freepagesieee80211_input_bamsdosfs_sync_vnodesplassert_failarm_picache_wayspriq_freetty_initaxe_ioctlwsdisplay_clearoncloseuvm_km_freesys_killuserconf_numberperflevelcomconsiohure_resetpmap_set_pcb_pagediruvm_pmr_addr_RB_NFINDrt_setmetricssys_getegidusbf_config_descriptoruvm_objtree_RB_FINDsw_reg_iodone_internalrasops_vcons_copycolsumass_init_insystemfrag6_deletefraghdruaddr_destroydirchkexphy_resetipip_outputpipecloseVOP_REMOVEconsinitsdmmc_scsi_minphysurlphy_statusext2fs_dirremoveuvm_vnp_uncachesysctl__stringure_iffffs_clusteracctconfig_detachmtdphyattachifaof_ifpforaddrcryptop_poolsensordev_listsr_checksum_printuhub_port_connectminidatacleanrt_timer_queue_destroysr_meta_probezkbd_syncieee80211_input_ba_gap_timeoutwi_cdsd_cduvm_pseg_geticmp_mtudiscipport_hifirstautoieee80211_tkip_delete_keysys_fstatlcd_show_screenufs_itimesenc_xform_3desrgephyattachuserconf_enablepte_l2_s_prot_uwext2fs_vinitumass_bbb_resetffs_alloccgbuf_object_storesmsc_wait_for_bitsgeneric_bs_w_1sa6_anysys_getprioritysysctl_diskinitsr_concat_discipline_inituvm_km_valloccdcef_watchdogieee80211_send_mgmtcue_getmacscsi_xsh_delieee80211_add_wme_infoscsi_plug_probesys_unmountsr_meta_native_probewsdisplay_activatebootdvapmkqfilterelf32_probesin6ifa_ifpwithaddruvm_pagezero_threadvgonelcrypto_taskqsofreend6_dad_timeruaddr_rnd_destroyinphyattachduid_formatcpuset_unioncomsiraddruuid_dec_beeephy_matchpmap_removebpf_mtap_afusbf_free_xferhidkbd_parse_descicmp6_fasttimouvm_pmr_addr_RB_INSERText2fs_removemtx_initif_clone_destroywdccommandcdcef_ioctlwi_pcmcia_wakeupvmcmd_randomizepxaintc_attachbpf_setfuserconf_historyuvm_page_unbusytk_noutusbpalockext2fs_mountpmap_collectBlowfish_expand0stateukbd_enableuvm_map_addr_RB_PREVwdc_xfer_getgeneric_bs_rr_4cpu_sysctlcd9660_deftstampzlibCompileFlagsip_randomidaue_tx_list_initsdmmc_io_function_disableieee80211_recv_disassocnosuidcoredumpukphyattachrasops_load_fontcddumppxa2x0_lcd_alloc_screenastusbd_claim_ifacetcp_disconnectuvmspace_execwi_usb_detachwsmux_createpxaohci_attachsys_mmapbootnd6_is_addr_neighborblf_ecb_encryptwsemul_vt100_output_normalunp_rightshostnamedisk_closepartwsdisplay_emulbellieee80211_ba_delupl_outputext2fs_bmapuvmexpenc_xform_blfbufq_donesr_crypto_dev_rwsensordev_getufs_diremptySipHashreinsertfinishdupsleep_setup_timeoutuao_grow_hashukphy_serviceqsphy_resetsmsc_stopdeflate_decompresspool_destroylogwakeupdl10019_mii_readreghidkbd_attachip_dosourceroutesoread_filtopsieee80211_media2ratedmapoolsrasops_show_screenbdevsw_lookupperfpolicydisk_changewsemul_vt100_resetopsdmmc_create_threadamap_lookupsifq_initcache_revlookupfdt_parent_nodebpfread_filtopssoinituhidev_get_report_asyncuvm_mapent_isjoinableuvmzeroin46_addrVOP_MKNODpxa2x0_update_intr_masksnd6_ifdetachin6_ifaddrroute_protopxa2x0_lcd_geometrysync_vopshw_uuidnd6_isneighborext2fs_truncatecd_play_tracksscsi_do_mode_senseuvm_pmr_allocpmrip6_maxfragpacketsax88190_media_finiprefetch_abort_handleruvm_km_threadsr_checksumscsi_probe_buslminm_leadingspaceconfig_mountrootsys_fpathconfscoop_battery_temp_adcwsmuxpollarpt_pruneohci_device_bulk_methodskp_zerosoconnect2pledge_syscallknote_poolcnopenscsi_test_unit_readyural_set_bssidnmbclustural_get_rfsominconndma_freepoly1305_initsoftraid_cdpcmcia_matchbpf_d_unrefuvm_vnp_syncusbf_end_configusbf_add_configwsmux_set_displayieee80211_get_disassocarpt_downrdgetdisklabelarm_pdcache_line_sizebpf_tapnthreadsuvm_pmr_addr_RB_NEXTnumnegmii_phy_autouvm_pmr_addr_RB_FINDuvm_mapent_free_removewsfont_rotatefdt_find_phandlemsdosfs_initohci_device_ctrl_startrtmap_limitwi_write_record_ioext2fs_writelf_clearlockpxaudc_writegeneric_armv4_bs_wr_2uvmpd_scan_inactiveurl_memip_srcrouteuhidioctlpte_l1_s_cache_masksys_setregidpcmcia_cdusbd_device2interface_handleurl_csr_read_1cpuset_infosusbd_dopollvinvalbufmii_bitbang_writeregmainbus_attachsys_ftruncateaes_ctr_cryptm_splitsoftintr_disestablishentropylockbufcache_getdirtybufurl_stopzts_irqtcp_timer_inittuagg_unlockedpool_multi_freend6_maxnudhinttcp6_inputsosetoptkp_dirtytcp_mssrt_sendmsgifa_addcache_purgeudav_stop_taskusb_detach_roothubbpf_mcopyax88190_mediachangepcmcia_3cxem556_func0comconsrateauth_hash_hmac_sha1_96pcmcia_intr_disestablishfork1vfs_hang_addrlistbuf_realloc_pagescue_tickdead_writeufs_dirrewriteinsmntquettreadtk_canccext2fs_blkfreeudp_outputfind_last_setsoftraid0pxaintc_matchsys_chmodprelist_removeuvm_objtree_RB_NFINDuao_shrink_arrayffs_vgetaxe_encapsr_bootuuidip6_getpmtu__umoddi3bcstatsin_pcblhasharm_dcache_alignvm_map_downgrade_lnip6_log_intervalnull_encryptdevice_mpathsched_idle_cpusugl_newbufscsi_activate_lunwsemul_vt100_nextlineuvm_atopgmaxprocesssyn_cache_timervt100_initchartableslcd_paramOF_childieee80211_auth_opensolisten_filtopsprocess_kernel_argsin6_update_ifa__wdcerrorSHA384Updatecdce_detachpxa2x0_intr_disestablishrt_msg2suser_ucredcom_is_consolemem_noext2fs_buf_allocdp8390_startbufbackpagesuaddr_kernel_functionspmap_free_l2_bucketRMD160Update_intrevarprequestkernel_maprrw_enterwi_init_iodumpdevwsmouseioctlcd9660_lockusbd_ref_incruvm_mapent_forkzeroieee80211_mgt_subtype_namegf_powuvm_pmr_splitvfs_mount_foreach_vnodekqueue_kqfiltertimeout_add_usecsr_raid5_set_chunk_statewi_mgmt_xmituhid_do_ioctlzeroin6_addrstrncasecmptimer_filtopsohci_device_bulk_starttcp_mss_advSHA512Update_intzts_cdcurrent_spl_levelnd6_optionwin2unixfnmax_hdrffs_readifq_enqueue_trym_freepool_allocator_multi_niphtree_RB_FINDpxaudc_ctrl_startne_pcmcia_dl10019_get_enaddraes_key_wrapurlphy_attachieee80211_get_assoc_reqsr_meta_attachsr_meta_native_bootprobescsi_inqmatchfdesc_poolpool_page_allocsr_switchm_tag_delete_chainfilt_pipewritecd9660_pollugl_detachbadaddr_read_4Chacha20_Poly1305_Setkeybzeromii_bitbang_syncumass_scsi_probearmv4_drain_writebufswapdrum_addufs_closedefrouter_delreqfixjobcsdmmc_matchuvm_pmr_size_RB_REMOVEusbf_set_endpoint_haltscsi_devidin6_addmultirn_newpairbioszts_enable__udivdi3sys_obreaksdmmc_intr_enablepxapcic_attach_cardpxa2x0_gpio_set_intr_levelblf_setkeyusbd_set_config_norgephy_cdieee80211_pmksa_addlastddateuvmfault_unlockallsr_meta_getdevnamem_inithdrpmap_curmaxkvaddruvm_pmemrange_addr_RB_NFINDuuid_dec_lein6mask0bpf_validateusbd_get_string_descvaccessuao_set_swslotsys___thrsigdivertsys_getdtablecountmbinitsr_errortcp_secret_ctxabortwskbd_default_bell_datascsi_readsafe_cmdieee80211_set_link_stateamap_allocVOP_LOCKbuf_rb_bufs_RB_INSERT_COLORMD5Finalwskbd_matchaxe_rxeofcd9660_vget_internalwi_intrvgetrd_attachkd_nowaitpxa27x_cpu_speed_91wsmouseopenwinChksumbufq_requeuefreeclusterchainmld6_initswapmapscsi_get_linkdisk_initpxapcic_intr_establishSHA256Updateohci_bus_methodsohci_hash_rem_itdrip6_ctloutputdisk_readlabelaue_sendusbd_getnewaddrrasops_erasecols_rotatednd6_na_outputext2fs_fhtovpsr_validate_stripsizeumass_cbi_transferext2fs_createunp_deferredwi_sync_mediapte_l2_l_prot_maskuvm_map_teardownpipe_pollpool_reclaim_allnsphy_cabmtphyattachsysctl_dopooluhub_matchuvm_mapent_clonetcp_respondsys_readvcrypto_getreqamap_cow_nowroundrobinusbd_get_hub_descriptorsa11x0_intr_establishbadaddr_readuvm_map_createissignalwdprintsr_attachfilt_uhidrdetachin6_selectrouteieee80211_recv_rsn_group_msg1rtmap_initcdevvpscsi_pending_start_setsoftintrmsdosfs_kqfilterfdt_find_nodeigmp_joingroupuiomoveohci_device_isoc_donewi_usb_wridrespmsdosfs_startlf_alloccpu_idle_leavewi_intr_ackscsi_iopool_getbpf_reset_dnd6_dad_stopdiskmapioctlhid_start_parsescoop_pcic_socket_setupinflateSyncPointuvm_waitskip_node_namefilt_apmreadnexecsmclpoolszts_avgposieee80211_regdomain2namepmap_referencesys_bindax88190_mii_statchgsdmmc_done_xsloioctlrw_exit_writebs_notimpl_bs_wr_8ieee80211_eapol_key_micrt_ifa_addusb_abort_taskspmap_bootstrapbs_notimpl_bs_wr_2blf_cbc_encryptsys_mqueryarm_picache_line_sizekmeminit_nkmempagesspeedtablesusbd_new_devicewi_pcmcia_detachuvm_pmr_size_RB_REMOVE_COLORscsi_iopool_initscsi_io_putunp_gc_taskure_devsuvm_pmemrange_findfillinusemaprecvitbmtphy_funcsusbf_get_descriptorscoop_suspendfilt_sowriteuvm_kernacccnpollcsys_linklcd_blankuvm_addr_initlog_opensr_rebuild_initfilt_randomdetachuvm_pmr_size_cmpfragtbl124userconf_totdevxscale_cache_flushIDieee80211_plcp2ratert_ifmsgrandomread_filtopsrealitexpireipstatunix2dostimegpio_controllersdounlinkatscsibus_caurl_newbufusbd_delay_mscrfreecnputcuhid_do_writeip6_lasthdrrefcnt_finalizedl10022_mii_bitbang_opsohci_device_isoc_abortuhub_uhub_catcp_reaperpool_sethiwatwi_read_record_usbwsemul_vt100_output_c0c1wdgetdefaultlabelmicrotimeuvm_pmr_addr_cmppipeunlockuvm_pmemrange_addr_RB_MINMAXuvm_swap_getrasops_free_screenext2fs_reloadurlphy_matchbufcache_getcleanbuf_rangeelf32_copyargsisochariophymatchuvm_km_alloc1cdopentcp_usrclosednsphyter_caaue_ifmedia_stsphysmemuvn_flushsr_bio_handlerurl_cdnsgphy_servicesdmmc_del_taskuvmfault_relockgpio_controller_set_pininferiorukbd_attachxscale_cache_purgeD_Eclusterallocsr_raid_syncrt_if_remove_rtdeleteif_input_taskwskbd_attachin_pcbbindumass_cbi_statexscale_cache_flushImtdphy_caudp_notifysdmmc_app_commandendtsleepwihap_check_txstrnlensigactsshareuvm_map_freelist_update_refilluvm_map_addr_RB_NEXTbpfattachugl_openpipesml_purgeitimerdecrieee80211_get_delbaether_outputpmap_bootstrap_pv_page_freeamap_chunk_freeinflateGetHeaderbpfilter_lookupm_copym0sdmmc_io_detachaxe_miibus_readregpxapcic_detach_cardvm_physmemiso_shipdirrdwriternd_timeoutieee80211_setup_htopieee80211_parse_edca_paramspipe_ioctlfilt_timerexpireural_set_chanwskbd_enablepmap_devmap_find_vacd9660_mountrootusbf_devinfo_allocbpf_allocbufsaxen_tx_list_initset_stackptrmsgbufmappedohci_device_setintrpxapcic_attachcomprobe1cdsizeumass_lookupsmsc_attachwsmouse_mux_closewakeupuao_growgetnanotimewdc_pcmcia_disk_device_interface_callbacka4x_bs_wm_2pxaudc_ctrl_transfertcprexmtthreshkprintf_mutexusbf_alloc_bufferieee80211_ht_negotiatert_getifawi_get_fid_ioenosysrtlabel_name2idhidkbd_is_consoleuvm_vnodeopsvfsconfusbd_detachVOP_OPENcompwroffwsdisplay_console_inittedbuckstringusbd_fill_deviceinfoscsi_interpret_sensesqphy_cdext2fs_flushfilesunp_headdes_ecb3_encryptieee80211_send_eapol_keymallocarraycomconsattachedlxtphyattachwi_usb_txeof_frmufs_readlinkrdopenin6_ifadddoscheckpathsyslogfpcbmap_tr_stored_blocknd6_option_initbufq_quiesceext2fs_setsizein6_init_prefix_ltimesnchstatscd9660_fhtovpmsgbufpfdt_parent_node_recursesys_setgiduserconf_common_attrfilt_ufswritezts_activatert6_flushpxapcic_io_freepledge_recvfdgeneric_bs_r_4pxaudc_epN_intrmmrwieee80211_media2mcsffs_bufatoffwi_usb_rridrespfilt_msdosfsreaddohooksgf_invieee80211_rssadapt_choosenprocessespool_p_freeif_detached_ioctllocnamppsegswi_usb_caure_miibus_writereguserconf_showconfig_suspend_allip_mtudisc_timeout_qsr_raid5_assemblesr_scsi_cmdaddress_exception_entryffs_fhtovpitimer_mtxgetvnodefilt_ufsvnodecrypto_get_driveridin6_pcbhashspeed_to_freqpool_setlowatkmembaseswi_entryrip6_inituvm_aiobuf_poolisofncmppcmcia_card_detachseltrue_filtopssys_sigprocmasksysctl_mqfilt_pipereadpxa2x0_intr_establishenc_xform_aes_gmacsoreserveconsoleusb_activatepxaost_attachscsi_report_lunsufs_quotactldosymlinkatuvm_map_uaddraroundin6_pcbnotifyif_ih_insertusbd_clear_endpoint_toggleexplore_pendingstrrchrgetdevvpm_clgetdefrouter_selectamap_unrefext2fs_statfsbpf_mtap_hdrcrdupamap_wiperangecuio_copybackisodirinocfrootswsmousepollchrtoblkscsiprintuserconf_pdevnamminphysukbd_matchurl_ticksys_fchownatztsavgloadedether_addmultitimeout_mutexieee80211_recv_actioncdce_cdffs_vptofhvfs_isbusyifunitirqstackbawritetputcharwskbd_detachpmap_postinitffs_fragacctpxa2x0_lcd_resumeffs1_ballocsys_fchowninflateInit_SHA384Update_intvwaitforiopxagpio_camii_phy_ticksdmmc_io_function_enablecd_read_subchanneluao_shrink_flushflsextendfilelortrequestwsdisplay_resumeicmp6_inputwsemul_vt100_outputbuf_valistuserconf_addsdmmc_io_write_4ohci_device_intr_methodswi_func_iocreatedefilt_randomreadieee80211_michael_mic_failuresbreleaseuvm_wxabortin6_selectifmsdosfs_islockedmax_linkhdrumass_attachwsdisplayioctluvm_unmap_detach_intrsafewdc_xfer_iopooludav_resetget_stackptrsysctl_rtablemsdosfs_reclaimsr_rebuild_percentwdc_free_queuesqphy_serviceuserconf_hist_eocsys_readlinkatuvm_objtree_RB_REMOVEext2fs_getattrrtlabel_id2nameusbf_setup_default_xfersbdroprecordinitconsbufpxaip_searchwdsizenamecache_rb_cache_RB_REMOVEsdmmc_io_scanacphy_statusip6_sysctlsuserusbf_devinfo_setupdiskconfural_tx_datavn_syncer_add_to_worklistusbd_get_interface_descriptorgeneric_bs_rm_1pxaudc_activatetk_ninsysfilt_opssdmmc_io_function_readyclusterfreefilt_randomwritesr_warnsr_raid_intrieee80211_alloc_node_helperrootdevm_tag_firstpxa2x0_cpu_resumecdmatchpmap_map_entryusbd_get_config_descriptorpfxrtr_deldumpsysicmptstampreplrip6_sysctlext2fs_fsyncsys_fsyncwi_usb_stopuserconf_add_readsr_crypto_writeusbd_reset_portifconfcpu_apmwarnamap_wipeoutuser_configcast_setkeytcp_outputnsphyattach_bus_dmamem_mmapwsdisplay_emul_attachsdmmc_mem_read_blockupdate_ledsext2fs_updatert_ifa_dellocalpxa2x0_memcfgtcp_timer_2mslne2000_writememaue_openpipesffs_reload_vnodebuf_putmsdosfs_setattrVOP_RMDIRsr_ioctl_installbootif_addgroupieee80211_setmodeuhid_matchpool_allocator_freefilt_proceopnotsuppsdmmc_enablephtree_RB_INSERT_COLORrandomcloserootvpaxe_miibus_writereguvm_pmemrange_addr_RB_NEXTpxagpio_intrlowieee80211_eapol_key_decryptpcmcia_intr_establishrt_plentosauserconf_maxlocnamespool_reclaiminitdisklabelure_tick_taskusb_quirksbpf_insn_gcbpf_sysctlvflushieee80211_bip_encapcddetachpmap_clear_modifytcpctl_varsarptimerbufq_dequeuetcp_reass_limitm_copymruaddsys___set_tcbrdstrategybcopy_pageip6_freepcboptsif_netisrif_upcoredump_notes_elf32timeout_add_nsecuvmfault_lookupif_idxmap_insertm_extfreene2000_ring_copysdmmc_set_bus_powerrgephy_resetupl_intrural_matchdeflateBoundVOP_BWRITEbufq_fifo_peekrt_timer_queue_createwddonemsdosfs_ioctlupl_matchno_constraintmsdosfs_dehashsys_opensr_crypto_change_maskkeywdc_alloc_queuergephy_funcsusbd_match_devicerasops_pmaskinet6domainural_enable_tsf_sync_bus_dmamem_alloc_rangeether_crc32_be_updatepgdeletepxapcic_intr_stringsdmmc_io_initusbf_do_requestwskbd_do_ioctl_scdead_vopsifq_q_leaveieee80211_media_changeuaddr_hint_createraw_attachural_set_rxantennahidkbd_cngetcscsi_ioc_cmdmax1111_adc_value_avgastpendingifnewlladdrether_ip6multicast_maxpipe_pooluao_initudav_iffsdmmc_needs_discoverifa_ifwithroutescoopattachspec_kqfiltertcp_notifyieee80211_match_bsscd9660_tstamp_conv7ural_free_tx_listffs_dinode1_poolieee80211_set_keyieee80211_bip_delete_keyrtflushclonegetblksr_raid_turdl10019_stop_cardxscale_cache_flushD_rngmaxsmapwdc_ata_bioip6_mcast_pmtusoconnectural_initrasops_use_fontwskbd_repeatroute_arp_conflictuvm_map_fix_spacenobuffers__lshrdi3data_abort_handler_addressin6_delayed_cksumusbd_errstrSHA256Update_intsr_scsi_ioctltcp_identtcp_rst_ppslimrtrequestifinitsd_cmd_rw10cd_load_tocOF_parentunpst_recvspaceuvm_map_mqueryget_ifidsr_infoscsi_io_getne_pcmcia_attachkue_initxscale_cache_purgeIDuvm_map_kmem_growraw_inputcd9660_reclaimkue_ioctlfilt_logrdetachtimeout_add_btnd6_ifattachunpdg_recvspacedofaccessatpipe_closecd9660_inactivesoftdep_mountmsdosfs_rmdirmsdosfs_fsynccfdatadeflateInit_ffswi_usb_tx_lockufs_checkpathSipHash_Finalcdcef_rxeofpmap_pte_init_xscalepfxlist_onlink_checkdiskmapreadm_tag_findinittodradler32blf_encvputaue_iffpte_l1_s_cache_mode_ptvector_page_setprotcd9660_setattrusbd_get_configpool_allocator_multiwsmouse_id_to_slotuaddr_kbootstrapufs_quota_init_rtallocallocpidkqread_filtopsusbd_setup_pipexscale_setttbaue_csr_read_1pcmcia_check_cis_quirksxscale_cache_cleanIDbuf_acquiredolinkatbioopscpu_classesbpf_setdlttcp_flush_queuepool_setiplmsdosfs_statfsbuf_adjcntlboltpipe_inituvm_wait_plausbd_open_pipe_intrusbd_request_asyncaes_gcm_reinitsyncerprocpcmcia_card_gettypepxa2x0_clkman_iohufs_ihashinszcfreein_setpeeraddrinphymatchpxa2x0_a4x_bs_tagwindow_inflatewsdisplay_delscreenpool_multi_alloc_niether_ifdetachsr_meta_native_readuhidev_get_report_descuserconf_histcursdmmc_mem_write_block_subrmsdosfs_inactivepanicstrrasops_wronly_copycolswsdisplay_kbdinputupl_newbufumass_scsi_cbscsi_delayext2fs_sync_vnodeif_startunpdg_sendspacesession0viscpywsmouse_do_ioctlrasops_wronly_eraserowsChacha20_Poly1305_Finalhw_ver__umodsi3copyincomparamural_stopudav_sendcd9660_defattrohci_device_bulk_closebs_notimpl_bs_sm_8uao_swhash_elt_poolufs_ihashgetne2000_read_hdrdovchflagssigacts0scoop_mmc_attachfindblkmajormsdosfsvnode_filtopssdmmc_mem_decode_scrrasops_vcons_mapcharpte_l2_l_prot_urntohlsorflushiophy_funcsusbf_create_threadlcd_matchuvm_mapent_tryjointtioctlvprintfslpquesr_raid1_wu_doneohci_root_ctrl_methodsttycharssyncdelayuvm_vslock_devicewi_usb_infofrmaxen_ioctluvm_pagealloc_multisdmmc_io_read_2hidkbd_enableffs_mountwsmux_mux_closechacha20_setkeyif_ifp_gcicmp6errppslimbadaddr_read_2rt_plen2maskmsdosfs_vopsdp8390_mediachangeconfig_process_deferred_childrenbufq_waitohci_ifcdwsdisplaywriteieee80211_add_htcapssdmmc_decode_csdxscale_cache_purgeID_Ebs_notimpl_bs_sm_2ifq_q_entermsdosfs_rootmii_bitbang_sendbitstqphyattachbpf_getdltlistm_tag_getuvm_shareuvm_map_freelist_updateohci_root_intr_abortrt_labelscrypto_unregisterHMAC_SHA1_Finalupl_watchdogsuid_clearttwritedma_alloc_initifq_dequeuebuf_rb_bufs_RB_NFINDbuflowpagesrebootswapdev_vpdp8390_resetpool_gc_taskpxa2x0_bs_mapaes_xts_cryptieee80211_deliver_datadead_readkv_execusbf_reallocpxapcic_socket_disableufs_pathconffile_poolohci_timeouture_newbufunputcendpcmcia_verboseVOP_CREATEcpuset_firstSHA512Updatecdce_stoppledge_nameirasops_copycharnd6_recalc_reachtm_intervalin_ifinitohci_device_ctrl_closewi_pcmcia_activatein_pcbhashlookupsys_mknodatapmread_filtopskp_dmaural_writehid_get_data_subVOP_ABORTOPrasops_vcons_eraserowsdofchownatsr_wu_done_callbackfilt_wseventreadsys_acceptnsphyter_statuspxa2x0_pi2c_writeuvm_map_entry_kmem_poolieee80211_wep_decryptrtable_lookupuvm_pagerealloc_multiwi_inquireuaddr_bestfit_pooltcp_rst_ppslim_countieee80211_recv_assoc_respieee80211_parse_rsn_bodyukbd_detachaes_key_wrap_set_keyif_clone_listtc_windupsys_futimessdgetdisklabelwi_do_hostdecryptinternal_commandumass_scsi_detachuvm_map_boundaryin_losingaxen_rxeofVOP_SYMLINKgeteblkusbd_set_interfacewsscreen_detachscsibusmatchinflateBackInit_vn_ioctlwi_usb_ctl_lockufsspec_readieee80211_input_ba_seqaxe_cdpipespacehid_get_udatafiqvectorget_last_resort_ifidohci_alloc_stdip6_sendredirectscast_decryptukphy_caitimerfixpxa2x0_apm_attach_subip_stripoptionsieee80211_add_xratesusbf_errstrnd6_timer_chugl_rxeofne_pcmcia_ax88190_set_iobaseuvm_pseg_releasecpu_resetudav_ticktcp_ctlinputether_multiaddrstart_cleanerffs_blkfreewsmouse_buttonsexit1ohci_detachwsmouse_add_muxihashkeybdevvpifa_ifwithdstaddruvmspace_dusedudav_ifmedia_changein6_nigroupscsi_mode_sense_big_pagesys_mkfifoatpool_get_doneuihashpxaudc_read_epNrijndaelEncryptscsi_ioh_deltcp_keepintvlifq_priq_opscdwriteufswrite_filtopsttybgconfig_searchzts_samplesphtree_RB_PREVusbd_printscoop_set_backlightuvm_km_valloc_prefer_waitsyn_cache_poolffs_allocaue_tick_taskeephy_funcsinphy_funcsrgephymatchbswap32ipsec_exp_first_usecdcef_cdrlphy_servicenet_livelocksplimit_poolip6_defhlimumass_setup_ctrl_transferunp_connect2usbd_set_pollingpxa27x_frequency_changern_walktreesys_chownuvm_pagewireukbd_apple_iso_mba_mungerasops_putchar_rotatedin6_joingroupsys_munlockinflateBackuvm_anfreert_ifa_deldofilereadvipip_sysctlbs_notimpl_bs_sr_1vn_statfileieee80211_iterate_nodesrw_exit_readwi_intr_enabletablefulluhub_exploreupl_txeoftcp_maxidlescoopmatchvfs_getcwd_commonset_cpufuncscttyioctlsys_lstatscoop_gpio_pin_ctlieee80211_recv_wpa_group_msg1ieee80211_recv_addba_respohci_timeout_taskohci_hash_add_tdieee80211_tkip_set_keyiso_uiodircttykqfiltercttyopenpmap_link_l2ptinet6ctlerrmappool_runqueuedisknameslenicmp6_redirect_diagdisknamessched_queued_cpusumass_quirksdumploRMD160Updatemsdosfs_mountacphy_funcsmq_dequeuenullcnpollcuvm_km_inituvm_objinitbzero_pageffs_sbupdatechillbufsudp_sysctlsys_openatax88190_mii_bitbang_readbs_notimpl_bs_wm_1vmmapbsyusb_add_taskurl_int_miibus_readreguserconf_histlenbufcache_initnkmempages_minukbd_accessopspxapcic_io_allocusbcloseudav_matchpxauart_matchvector_pagekq_ntimeoutssys_sched_yieldvmspace0scsi_decode_sensettywaitwsmousedevprintuvm_map_setupwdc_default_vtbluao_grow_arrayuvm_uarea_alloclcd_set_brightnessetextifa_ifwithnetmemchrohci_device_ctrl_doneqsphy_statussrp_swap_lockedsqphyattachpte_l2_s_cache_maskcomp_algo_lzsieee80211_recv_barrn_link_dupedkeysysctl_cptime2sdmmc_capxa2x0_bs_unmapscsi_mode_sense_pageboot_argspipelockvt100_selectattributeumass_scsi_setuppxammc_clock_startproc_poolaue_intrudp6_inputsys_writeural_set_txpreamblesharp_zaurus_C3000_blgeneric_armv4_bs_rr_2sb_maxusbd_fill_iface_datacd_set_pa_immedsr_uuid_print__bss_end__wsdisplay_maxscreenidxip6_insertfraghdrresume_randomnesscnstopihashtblieee80211_set_shortslottimesys_dup2gpt_chk_mbrwsdisplay_switch1wd_get_paramsrtable_init_backendbread_clustersys_readlinkext2fs_size__ashrdi3bs_notimpl_bs_mmapzErrorohci_intrxscale_cache_flushI_SEip6_auto_flowlabelcrc32devid_copylf_splitifafreeVOP_STRATEGYtimeout_add_sectzpxammc_card_intrxscale_cache_syncIOF_nextproprip_sendspacecoredump_writenote_elf32uhidev_writeusb_generic_tasksxscale_cache_cleanID_rngamap_addtcp_freeqif_setgroupattribscom_attach_subrdvd_authSipHash_Updateexphy_serviceumass_scsi_cmdscoop_gpio_pin_writecdreadrasops15_initspec_inactivedp8390_stopwi_func_usbwsmux_do_ioctlsys_sendtoicmperrppslimgeneric_filtopsrefcnt_initknote_dropcue_watchdogin6_selectsrcuvm_mmaplockrd_casdmmc_read_cissoftclock_siwi_usb_threadugl_watchdogsr_ccb_putzkbd_ioctlnd6_rs_output_timeoutalldevsdp8390_rintwddumpicmp_do_errorvmcmd_map_readvnsmsc_initpxammc_exec_commandrandom_startcomconsfrequsbd_get_interface_altindexsigpropvmapbufumass_scsi_switchdehashtblsocketopsscsibus_bioctlpcmcia_activatend6_maxndoptuvm_map_clip_startffs_fragextendtcp_always_keepaliverawcbtablespec_readunp_markacphyattachicmp_mtudisc_timeoutnwsmuxa4x_bs_r_1pmap_zero_page_xscalettyread_filtopsuvm_mapgetinoquotascsi_do_ioctlrtable_existsndinitatdisk_lock_nointrcd_resetscsi_ioh_addext4_ext_find_extentscsi_detach_busudpstatroute_inputsetrootcsr2cd_read_tocural_amrr_updatecdioctlieee80211_defrag_timeoutbufq_switchcue_stopifmedia_addfrag6_queuelxtphy_funcssr_matchusbd_set_config_indexlogopenieee80211_add_rsn_bodyfdt_check_headrn_del_radix_masksr_raid6_initcd_buf_donescsi_devid_pg80rtable_insertbreadntcp_hdrszscsi_devid_pg83tcbtablefilt_cd9660detach__xordi3frag6_drainuvm_objtree_RB_REMOVE_COLORdosdiremptyigmp_slowtimoifpromiscrtl80x9_mediachangerasops4_putcharip6_setpktoptsfork_returnsys_getsocknamecd9660_lookupsr_concat_initwi_usb_intrusbd_alloc_bufferinflatePrimemask_rnheadbpf_mbuf_opswsmouse_matchingsw_reg_iodonepte_l2_s_protoufs_rootsdmmc_detachtcp_sysctlVOP_SETATTRsmsc_chip_initsrp_update_lockedwsmouse_btn_syncpmap_kremovesigactsinitsdmmc_io_rw_extendeddomknodatcpu_kcore_hdrexec_elf32_fixupvop_generic_lockwsmouse_mtframecomconsiotuvmfault_anongetconsttywdc_pcmcia_caural_bbp_readpxammc_host_resetsr_ioctl_diskext2fs_dirrewritevn_closefile__ucmpdi2umass_discoip_mtudiscvfs_free_netcredmld6_start_listeningcpu_mainbus_cakue_matchpmap_kenter_papidhashtblaue_matchuvm_mapent_forksharedm_pullupenterpgrpwdc_pcmcia_lookupxscale_tlb_flushID_SEcrypto_freesessionwsemul_vt100_output_string_escwsdisplay_kbdholdscrpxa2x0_rtc_getalarmcnbellm_copydatabpf_mbuf_copybufq_nscan_requeueuvmfault_initcd_setchanieee80211_get_probe_reqpool_p_removemtx_leavefilt_signalsigactsfreewdc_default_write_raw_multi_4ttymallocupl_attachrasops_copyrows_rotatedicmp6_notify_errorieee80211_recv_probe_respwsdisplaykqfilterbs_notimpl_bs_sm_4kue_setmultizapm_acintrmmioctlumass_matchsched_choosesendsigsdmmc_print_cisohci_device_ctrl_methodsbpf_ifnameohci_cdural_ioctlsmsc_iffvfs_busytimecounterfilt_ufsdetachbufq_initlf_getlocksr_raid6_xorpsolistenwskbd_compose_valuein6_ioctlspec_getattrip_ecn_ingressmsdosfs_bmaprip_ctloutputffs_vtblif_getgroupieee80211_parse_rsnether_rtrequestpool_debuguserconf_morekqueue_ioctlmax_processessys_wait4rip6_recvspaceieee80211_bar_tidfs_sysctlukbd_cnattachpxammc_card_detectpxaost_matchboot_filepte_l1_s_prot_uwfilt_sordetachknote_activatepsignalwsdisplay_console_confieee80211_regdomain_compare_cnconfig_pending_incrusb_task_threadamap_pp_establishauth_hash_gmac_aes_192uvm_pmr_nextszuvm_anon_initffs_reclaimbmtphy_causb_free_deviceusb_explorebufq_nscan_queuexscale_cpufuncsif_link_state_changelcd_max_brightnesspmap_virtual_spaceieee80211_add_wpaieee80211_eapol_key_check_micpage0_endieee80211_add_capinfobpfpolluvm_pmr_nfindszupdatepriohci_activatebmtphy_servicesched_kthreads_createuhid_cdwskbd_cnbellbintimevt100_decmodewi_seekfilt_soreadpmap_remove_allrtable_addmq_delistzeropageipsec_def_encrtable_deleteffs_nodealloccgsoftintr_establishpxaudc_detachuvm_pmr_removeip4_input6pdevinit__iordi3nsphytermatchwsmouse_touch_updateuvm_pmr_findnextsegmentinetctlerrmapresetpriorityusbf_device_descriptorenoioctlwi_usb_start_threadaxen_ifmedia_stsrasops_vcons_copyrowsflslsigacts_poolexecsigsconfig_initicmp6_redirect_inputbuf_rb_bufs_RB_REMOVE_COLORrw_enterOF_is_compatibleaue_read_macuvm_addr_destroysr_raid0_inituvm_pmr_size_RB_MINMAXskip_nopsnd6_ra_inputffs1_blkprefOF_getproplenin6addr_loopbackuvm_objtree_RB_MINMAXttypendin6addr_linklocal_allroutersuvm_swap_freepagesqsphymatchnd6_dad_starttimerin_revarpinputstrlcpywskbd_get_backlightusbd_reload_device_descsmsc_read_regaxen_newbufext2fs_advlockknote_fdcloseusbd_get_devcntif_clone_detachpipe_rfiltopsin6_cksumcomcninitstrncmpcsrc_ptevfs_shutdowngetsockieee80211_get_deauthbs_notimpl_bs_c_4upl_startzssp_matchsyn_cache_respondif_creategrouppxa2x0_gpio_set_diruvm_iosbcheckreservepreemptbioattachieee80211_begin_scanpriq_opsunixdomainsmdscsibusattachugl_devsnsgphy_cdulminwihap_data_inputpxa2x0_lcd_free_screenproc0paddrrn_addmaskure_read_memuvm_vnode_poolusb_attachbpf_bufsizeselscanpxa2x0_do_pendingsoo_polluvm_map_uaddr_esig_filtopsknote_processexitohci_device_bulk_transferukbd_cdzkbd_accessopspxaip_scwskbdopenpxa27x_fastbus_run_modettclosurl_rxeofipsec_soft_allocationssleep_setup_bus_dmamem_mapip6_fragmentnet_sysctlcom_cdusbf_devinfo_freewskbd_do_ioctlxscale_cache_cleanD_Euvm_pmr_size_RB_FINDudv_listdead_ioctlaue_initusb_match__wdccommand_startsdmmc_complete_xssysctl_iflistrasops_alloc_mattrvwakeupif_clonerswdcbit_bucketvgonewdc_probe_capspmap_initializedtcp6_ctlinputsched_init_runqueuesusb_allocmemif_linkstatesd_sizeufsspec_closene2000devsnd6_prefix_offlinkuvm_anon_dropswapif_start_lockeddl10019_mii_bitbang_readwi_detachigmp_inputkmemusagezapm_suspendswcr_sesnumlf_getblockautoconf_attdet_mtxtcp_rttdfltcleanerprocieee80211_parse_edca_params_bodysbappendstreamm_tag_copy_chainohci_handoversowrite_filtopssr_chunks_unwindstrncpysdreadsys_pselectupdatefatscue_memata_perrorvfs_getvfssr_alloc_resourcesure_disable_teredoaue_txeofffs_sync_vnodedeflateInit2_sr_raid6_discipline_initproc_stoprrticks_initbio_status_initusbd_set_port_featurebpfilter_createsysctl_lockax88190_mii_writereglockfpoolmq_dechainrasops_copycols_rotatedpledgereq_flagsmextfree_registerieee80211_find_nodecpu_switchtohtonlsched_all_cpusin6_mask2lentcp_dooptionsdos2unixtimesys_sigactionsr_scsi_donewsdisplay_suspend_devicedeupdatusb_fill_di_taskzapm_get_eventSHA256Transformrndlock__negdi2in6_purgeaddrcpu_modelieee80211_input_ba_flusharm_dcache_align_maskcttyreadcd9660_unlockuserconf_cmdsural_taskwsdisplaycloseiophy_statusschedclockbpfioctlpush_componentconfig_attachohci_alloc_sitdcue_rx_list_initzaurus_battery_life_c3000pxa2x0_bs_tagsubstrcmpdl10019_init_cardbmtphy_statususb_syncmemdisk_unbusysoisconnectedurlphydebugsdmmc_ccb_allocfdt_get_memory_addressusb_block_freememVOP_PATHCONFumass_fixup_sonydk_mountrootassertwaitokscsi_minphyssdmmc_delayxscale_cpwaitvattr_nullsys_getsockoptufs_ihashuhidev_attachwsmouse_mt_initure_tx_list_initfrag6_nfragpacketspxapcic_pcmcia_functionsaxen_startsr_raid0_assemblevfs_sysctlcpu_get_controlVOP_READLINKbuf_mem_initumass_cbi_methodspxa2x0_intr_bootstrapnsphyter_funcsmii_submatchrasops_wronly_putcharohci_root_intr_transferwsdisplay_unset_cons_kbdmsdosfs_pathconfoldpidstimeout_wheelpxa2x0_setsoftintrarp_listumass_io_getaverunnablecd9660_getattrttyfreettysleeplcd_cduvm_pausedp8390_initzapm_bcintrunp_disposescsi_inquireufs_getattrBlowfish_encipherieee80211_mhz2ieeevfs_exportpxammc_scoop_capool_wait_gcsr_hotsparepoly1305_updateuvm_km_pgremoveex_region_plfscalesmsc_matchffs_alloccgblkpxaudc_disableip_optcopyvfs_registerscoop_mmc_matchieee80211_proto_attachsys_dupmcllowatmii_printieee80211_setup_ratescd9660vnode_filtopsbpfilterattachproc_stop_totimeout_todoswcr_initcpu_read_cache_configwsemul_vt100_scrollupzkbdsleeptvsr_ioctl_createraidpanicget_pc_str_offsetural_rxeofcue_rxeofL_cksumdataieee80211_channel_initmsdosfs_lockseltruewsdisplay_console_devicemq_enlistscsi_xs_syncsoftdep_initializeunp_shutdownsdmmc_mem_send_scrieee80211_tkip_encryptwi_resetdovutimensdummy_get_timecountext2fs_sysctlgeneric_bs_wm_4kthread_run_deferred_queuearc4_initpxa2x0_gpio_bootstrapwdreadlastdaycheck_execwi_usb_cdtcp_initsdmmc_start_xspcmcia_attachpte_l2_s_cache_mode_ptpool_request_initdeferred_config_queuedp8390_getmcafbuf_rb_bufs_RB_MINMAXipport_lastautowsmux_detach_sccom_raisedtrpxaudc_bus_methodsicsphy_statusip6_pcboptwinSlotCntvn_kqfilterext2fs_syncsched_stolenpte_l2_s_prot_maskudav_ioctlcrypto_registercache_purgevfszaurus_udc_activatepostsiguvm_mmapfilesys_pathconfcue_open_pipespxapcic_mem_allocin_addmultigetmicrotimebs_notimpl_bs_rm_8zssp_cdrasops_reconfigmaxthrsleepumass_clear_endpoint_stallwsmousekqfilterohci_setup_isocaue_newbufscsi_probedevaxe_ax88178_inittcp_templatewsmouse_positionmsdosfs_readohci_initcomopenusbd_setup_xferauth_hash_hmac_sha2_512_256afmapieee80211_tree_RB_MINMAXmtagpoolbcopywsmousecloseurl_tick_taskrtrefbufcache_releasesigcoderetcue_detachusbioctl_bus_dma_inrangekqueue_wakeuprasops_wronly_copyrowscpufunc_auxcontrolip6_unknown_optuaddr_rnd_removetcp_reasssys_getfhext2fs_vgetrt_timer_timercomcnputcKERNEL_BASE_physSHA1Update_intwsemul_vt100_output_scs94cuio_applySipHash_Endscoop_cageneric_bs_rr_1axe_resetlcd_get_backlightdefrouter_addreqin6_clearscopend6_dad_ns_inputuvmpd_tunertisvalidusbd_set_addressne2000_readmemscoop_cdudav_openpipesffs_setblockipsec_expire_acquirekue_stopwsscreen_switchwaiticmp6_mtudisc_cloneinflateResetmemcmpwskbd_init_keymapnamecache_rb_cache_RB_REMOVE_COLORip6_dad_pendingieee80211_rate2plcpmsdosfs_createcd9660_startzkbd_hingepte_l2_l_prot_uwcomstartaes_xts_reinitcfroots_sizetickadjip6_splithdruvm_map_addr_augmenttcp_secret_initieee80211_recv_sa_query_reqsbreserveundefined_initip6_sendvrecycleieee80211_alloc_nodeblf_ecb_decryptcrcopyural_newstatewdcloseundefined_handlerssys_revokeusbf_get_xfer_statusural_free_rx_listsysctl_stringsys_rebootpxammc_host_maxblklenuvm_unmap_kill_entryext2fs_specvopsbufpooldl10019_mii_bitbang_writeure_miibus_statchgproc_finish_waitwdccommandext_dist_code_bus_dmamap_load_buffersigonstackcpu_forkuaddr_kbootstrap_selectwi_write_data_ioscoop_checkdiskttylistwdopenuvm_vslocksigfilldeflateResetuvmfault_update_statscast5_setkeyttyoutputsr_raid5_wu_donekue_caexplicit_bzerousbf_cacd9660_tstamp_conv17wskbd_calxtphy_statustqphy_cdpxa2x0_wakeup_configcopyaddroutif_watchdog_taskpcmcia_scan_cispxa2x0_memctl_iohclockintrcpuset_add_allsystqmpVOP_READufs_ioctlffs_freefilein6ifa_ifpforlinklocallastdtimegetdisksys_setuid_wdc_ata_bio_startstart_updateudav_cdusbd_clear_port_featureusb_abort_task_threadufs_quota_free_blocks2senditsr_crypto_decryptbufq_fifo_destroylcd_bpp16_screensr_raid5_createusbf_add_endpointhidkbd_decodeuvm_setpagesizepxa2x0_lcd_list_fonttcp_xmit_timerrn_add_radix_masksr_raid1_rwin6_recoverscopensphy_serviceaue_tickpxa2x0_gpio_get_bittimeout_add_tvtickmclpool_warnmsgscsi_pending_finishscsi_preventmmclosecd9660_accesssr_wu_getffs_statfsscoop_set_sdmmc_powercpuset_complementrijndael_set_keywdcprobeiophy_cdudp_recvspacea4x_bs_w_1fdt_node_property_intkm_allocfdropsr_block_putgf_initsyn_cache_unreachuserconf_histszsys_getrlimiticmp6_errcountbpf_attachdicmp6_ctloutputieee80211_ba_move_windowstuck_keyscpuset_issetufs_dirremoveaxen_devsrgephy_servicepxagpio_reg_writeChacha20_Poly1305_Updateif_attachsetuppipe_writesr_set_chunk_staterasops_wronly_erasecolsuvm_map_addr_RB_FINDin_pcblookup_listensbappendm_copybackure_write_1wsmouse_input_syncif_idxmap_removepxammc_cdscsi_remove_linkuvm_swap_puticmpbmcastechoHMAC_SHA1_Initbufheadconfig_scanwi_get_nwkeypxa2x0_gpio_clear_bitkp_pageablesr_raid6_addiopmap_copy_page_funcpxa2x0_lcd_attach_subripsrciso_nchstatskue_txeofaxen_lock_miiural_amrr_startnlineswohci_rem_edether_ifattachinflateSync__wdccommand_donesdmmc_function_freeumass_adjust_transfersignal_initnsphyter_servicefill_drlistffs_updatewsmuxclosedp8390_getwsmouse_input_cleanupunix2dosfnspec_advlockmtdphy_cdmax1111_adc_valuefragtblraw_sendspacenullopzaurus_udc_is_hostsdmmc_intr_disableAES_CMAC_SetKeym_purgecomdiagextralocunsleepvop_generic_bmapwdprobescsi_xs_getmtdphy_funcsblf_encryptsched_proc_to_cpu_costohci_alloc_std_chainipintrpool_gc_schedgetnanouptimesdmmc_scsi_detachdes3_encryptmaxdmapural_alloc_rx_listusb_block_allocmemext2fs_symlinkip6_savecontroldevice_registerpxauart_activatebufcache_getanycleanbufsr_raid6_set_chunk_statend6_dad_stoptimertaskq_sys_mpq_to_bpte_l2_l_prot_krOF_getpropmountrootsdmmc_scansyn_cache_resetuhidev_openundefined_entryprocess_read_fpregsip_initreaddeohci_freexural_txtimecd9660_rrip_getnameufs_check_exportsysctl_rdintcd_interpret_sensein_mask2lenural_eeprom_readpxagpio_matchscsi_iopool_destroylodirtypagessr_ioctl_disciplinefindwin95VOP_WRITEsys_nanosleepusbf_free_bufferstart_init_execifq_start_taskifa_update_broadaddrnd6_addr_addifa_ifwithaddrclock_ymdhms_to_secsrootduidif_clone_attachsys_getfsstatohci_abort_xferbpfopencdstrategydeflatePrimegpt_get_fstyperefcnt_relerandomwrite_filtopsnd6_slowtimo_chuvm_km_valloc_alignenc_xform_nullpriq_deq_commitm_extfree_poolip6_pullexthdrcpu_idle_entercomwritebuf_kva_starttuagg_subVOP_RENAMEauth_hash_gmac_aes_128cdclosesys_fchdirsr_crypto_readsdmmc_scsi_cmdgreen_onprocess0niq_enlistpxapcic_mem_freearm_idcache_min_line_sizeieee80211_send_eapol_key_reqrandompidwd_cdurl_initusbf_open_pipe_ivalfilt_ttyrdetachsdmmc_mem_send_op_conduhidwrite_bus_dmamap_destroyvn_pollinet6swrouteswdosdirtemplatemainbus_cdpxa2x0_lcd_cnattachsys_mincorene2000_test_memapm_power_printieee80211_tree_RB_REMOVErasops8_putcharlastsecondswsmousedoopenwi_get_txpowerural_plcp_signaludav_stopusbd_error_strscdcef_caamphymatchscoop_set_headphonepxapcic_intrtcp_maxpersistidleOF_getpropintudav_tx_list_initspec_ioctlzkbd_set_ledsufs_initproc_reparenta4x_bs_r_4uvm_exitfc_bmapcallsffs_initsdmmc_submatchsr_crypto_createpxa2x0_gpio_clear_intrscsi_ioh_setbootsyncuvm_initcdcef_matchaue_attachieee80211_crypto_attachsys_ioctlusbf_clear_endpoint_featureuvm_map_addr_RB_NFINDif_free_sadlsdmmc_attachfilt_bpfrdetachwsdisplay_emul_caarpreplypxa2x0_clkman_configcompress2icmp6_initbs_notimpl_bs_rm_1uvm_mapent_free_insertfilt_ttywritepool_update_curpagehid_end_parsepxa2x0_gpio_intr_unmaskin_setsockaddrsrp_startupbpf_moveinwsemul_vt100_output_esc_spcostypevndbuf_pooluvm_page_physloadaxe_iffreset_entryuvm_pmr_remove_1strangewdcresetwdc_exec_xferip6_insert_jumbooptipintrqtuaggsr_raid5_intrusbf_add_stringusb_frag_freelistpxapcic_intr_disestabliship_slowtimordsizerijndaelKeySetupEncprocess_initializeip6_nexthdrrtdeletemsgpledge_swapctl__bss_startrtable_satoplenkue_rxeofrijndael128_encryptVOP_KQFILTERukphy_funcssys_msyncdeflate_compresswskbdreadsbappendrecordevcount_detachsd_capcmcia_function_disablesoftdep_fsync_mountdevinitmsgbufwsmouse_attachniq_initmemsetcuio_copydatapipe_free_kmempxa2x0_splxufs_getlbnsieee80211_get_actionphysiosr_ccb_donepcmcia_3cxem556_func0_cfe0in6_selecthlimupl_sendwdattachrootonlyportsmii_phy_delete_mediapxauart_attachin6_unlink_ifaicmp_mtudisc_cloneuvm_pmr_insert_sizesodisconnect_spllowersys_setgroupsmainaue_csr_write_2lxtphy971_funcsrasops_add_fontohci_device_bulk_doneether_crc32_le_updateifih_rcmtdphymatchmainbus_legacy_searchmsdosfs_bmaparrayukbd_apple_translatetimespecfixaxen_matchrasops_init_devcmapsr_raid1_set_chunk_stateural_set_basicratesip_flushieee80211_delete_keykue_startdp8390_configrasops_mapcharuvm_unmap_removepmap_alloc_l1amap_wiperange_chunkicmp_errorwsmuxdevsusbf_transfer_completepxagpio_attachbs_notimpl_bs_sm_1upl_rx_list_inituvm_swap_markbaddes_set_keykqueueopssmsc_miibus_statchgvholdzombiefindbufq_fifo_dequeueidgen32rt_if_removesr_minphysscsi_default_getghash_gfmulusbd_no_quirkm_adjsr_wu_donemld6_stop_listeninguao_shrinkpmap_map_chunkextent_alloc_subregion_with_descrppsratecheckkmemlimitbuf_rb_bufs_RB_PREVwsemul_local_translateamap_copybufq_drainphysical_endbio_statusuhidpollieee80211_ieee2mhzmq_initsched_wasidlesr_raid5_initieee80211_dup_bssuaddr_hint_destroylf_findoverlapsr_raid_start_stopmainbus_legacy_foundfilt_msdosfsvnodelf_wakelockkv_anykue_attachhookdumpconfAES_CMAC_Initwi_rxeofwsdisplay_cons_kbd_pollcdead_badopblf_cbc_decryptcalcrusys_unlinkin_scrubhostrt_setgatetcp_ack_on_pushpmap_growkernelext2fs_rmdirufs_chownrtmap_gcdofchmodatsysctl_intupl_tx_list_inituvm_shutdownkqueue_closewsdisplaystoppte_l2_s_cache_modeuvn_initstrlcatsysctl_int_arrbs_notimpl_bs_wm_8uvm_map_set_uaddrcdce_matchsoftintr_dispatchnd6_pooldisk_unlockufs_ihashremtaskq_destroycttywritegpt_chk_parts_bus_dmamap_createSHA256Inittcp_update_sndspacesr_crypto_doneurl_stop_tasksdmatchusb_freememudav_txeofproc0cdce_initufs_renameaxe_caext2gennumbersr_bio_ioctludav_attachuvm_map_entrybyaddrsr_already_assembledusbd_get_hid_descriptorrt_ifannouncemsgsoo_readwdc_scrub_xferscoop_resumeuvm_km_doputpageufs_opencopyout_statfspmap_modify_pvm_catsplxpxa2x0_rtc_setalarmtqphy_statuskp_dma_contigcd9660_isohashwi_write_data_usbumass_scsi_minphysuvm_swap_initpxagpio_intr0tcp_nowaue_miibus_statchgip6_hbhchcheckural_bbp_initunp_gcsys_clock_gettimeip6_hdrnestlimitcpuset_clearxscale_cache_syncI_rngfrag6_initbuf_replacevnodeure_txeofpte_l1_s_prot_kruvm_pmr_size_RB_NFINDure_read_1uvm_mapent_addr_removetimeout_setrdreadcrfromxucred__subdi3srp_get_lockedwsdisplay_resetntohsmsgbuf_putchar_bus_dmamem_freesd_flushcd_setvolext2fs_mkdirohci_openpte_l2_s_coherentext2fs_direntersys_symlinkatmii_pollstatrlphy_cawdgetdisklabelrw_exitkv_pagedupfdopenidgen32_initifmedia_list_addpidhashcdcef_encaprtprefpxaohci_detachxscale_context_switchuvm_totalencdebugugl_sendicmp6_ratelimitsr_raid1_createsys_mkdiratdl10019_mii_bitbang_opssdmmc_io_attachdofstatatstart_inituhub_attachether_fakeaddrsysctl_tc_hardwaresmsc_rxeofscsi_ioc_ata_cmdtcp_mssdfltpriq_enquvm_swap_freedata_abort_handlerusbf_setup_xferbs_notimpl_bs_r_1axe_initsr_block_getuhidev_set_reportin_pcbdetachmsdosfs_vfsopststohzaue_ifmedia_updcd_sizettycheckoutqicmp6_mtudisc_callback_registerne_pcmcia_detachvm_map_unlock_read_lnaue_causb_explore_tasksrnd_event_spacesr_concat_rwpmap_clear_referencert_getmetricswdc_ata_bio_kill_xferin6_ifdetachcn_tabswaplist_insertsmsc_lock_miiip_forwardsensors_taskqextent_createrdclosebpf_freeddisklistin6_lifaddr_ioctlsys_fstatfsurl_txeofkue_devsbs_notimpl_bs_sr_8m_injectip6_mforwardingffs_isfreeblocksrp_gc_finalizeseltrue_kqfilteruvm_map_lookup_entryaxen_cdicsphymatchBlowfish_expandstatebs_notimpl_bs_w_4dead_strategyswi_handleramap_populatewsevent_kqfilterusbf_new_devicespec_fsync__wdcwait_resetcom_pxaip_cadoacceptuvm_map_deallocateicmp_reflectieee80211_parse_wpazkbd_attachbpf_mbuf_ldbscsi_xsh_iohext2fs_reclaimwsmouse_input_initnd6_rs_output_set_timoffs_ballocsys_getgroupssr_raid5_xorieee80211_node_attachsys_linkatuhub_cdwi_start_usbgeneric_bs_wm_1ip6_raw_ctloutputkernel_textufs_startsigstkinitohci_devd__end__nsphy_reseturl_sendcdce_encapnd6_rs_timeout_countufs_bmaparrayfragtbl8uvn_sync_lockrtable_getpcmcia_function_enableaes_ctr_setkeyrasops_vcons_alloc_attrifq_barrierpledge_sendfdurl_resetp2p_rtrequesture_lock_miiusb_needs_exploreswaplist_findufs_quota_alloc_blocks2fc_fileextendsfilt_sigattachwsmouse_cdsdmmc_go_idle_stateVOP_FSYNCffs_sysctlipport_hilastautoarpinit_doneusb_wait_taskdoclockintruvm_anon_pageinspec_closecd9660_closeuvm_map_mkentrypxaost_cauvm_map_addr_RB_REMOVEsys_shutdowncngetczkbd_cdtc_adjfreqrnd_statesm_gethdrconfig_rootfoundcue_cdputcieee80211_phymode_namebufbackoffsysctl_rdstruct__divsi3uhidev_cdwsmousereadsr_raid1_initxscale_minidata_clean_sizeschedcpuurlphy_servicesbappendcontrolukbd_set_ledswsdisplay_screenstatea4x_bs_rm_1softdep_flushfilesipv4_inputm_getclrpool_headax88190_mediastatuswsmuxioctlsr_crypto_read_key_diskapm_matchipforwardingieee80211_get_cts_to_selfohci_device_isoc_transferusbd_open_pipe_ivalicmp6_redirect_timeoutif_rxr_ioctlpxa2x0_wakeup_statussyn_cache_lookupaxen_miibus_readregprtactiveksym_upcaseufs_makeinoderasops_copyrowsscsi_xs_ioip6_process_hopoptsusbd_find_edescwsdisplay_set_cons_kbdfilt_ttyreadsys_getpgidcom_common_putcswaplist_trimcache_lookupaxen_detachrdioctlrijndaelKeySetupDecuvm_objtree_RB_INSERTsysctl_tcurl_detachbs_notimpl_bs_rr_1sdmmc_intr_disestablishumass_scsi_sense_cbsys_pledgedp8390_intrrijndael_encryptrasops_do_cursorwsemul_vt100_handle_dcsieee80211_recv_mgmtaxe_detachwskbd_set_console_displaydumpsizesowwakeupsdmmc_io_read_multi_1ukbd_keydesctabirda_onsr_raid_inquirysmsc_setmacaddressextent_freeuvm_aiodone_daemonaddupc_tasksched_syncusbd_clear_hub_featureext2fs_vopscomclosepcmcia_print_ciseephy_attachsetsigvecurl_iffsys_sendmsguhidopenvn_marktextbpf_mfiltercleancachestrcmpsys_quotactluhidev_matchieee80211_get_hdrlensr_raid_startwutcp_mtudisc_increasesdmmc_card_attachure_startulmaxin6_pcbconnectdehashkue_cduvm_pmemrange_addr_RB_INSERThook_disestablishexphy_funcsbpf_catchpacketffs_isblocksr_concat_createpxaip_cdzaurus_startusbd_find_quirkuvm_swap_allocpagesuvm_aobj_poolsys_adjfreqqsphy_funcsicmp6_reflectsetrunqueueudv_attachsettimecdce_rx_list_inituhub_intrarm_pcache_typertable_initdp8390_detachata_set_modemii_phy_auto_timeoutsyn_cache_getnetisrpxaudc_bulk_transferttyrubieee80211_get_ratevop_generic_islockedpxaudc_bulk_closeuaddr_hint_poolwsemul_vt100_output_stringwsscreen_attachm_pulldownbufcachepercentlcd_screen_listenc_xform_chacha20_poly1305pmap_initufs_rmdirrlphymatchieee80211_next_scanpmap_zero_page_funcarmv4_tlb_flushD_SEminsr_meta_native_writeip6_initconfig_detach_childrenrawcbsmsc_detachukbd_cngetcz_errmsgtcpcb_poolmii_bitbang_readregpxa2x0_cpuspeeduvm_map_addr_RB_INSERTBlowfish_stream2worduhidclosetimeout_add_msecipip_allowsys_polluvm_map_clip_endufs_makedirentryusbd_set_configuvm_mapent_mergeieee80211_recv_addba_reqm_defragrtable_l2setvnode_hold_listlastdosdateudav_unlock_miiscoop_timeoutbuf_rb_bufs_RB_NEXTufs_linksched_choosecpusys_mkfifozcallocure_write_2ural_read_eeprompcmcia_parse_cis_tuplein6_ifinitin6_leavegrouprtlabel_id2sasqphy_casddumpiminnet_tick_tosys_chflagsget_hw_ifidKQRELEdelaysdstartip6_hopopts_inputamap_chunk_getieee80211_media_initselfalsevt100_outputscsi_default_putsr_free_resourceswsemul_vt100_output_esc_percentcom_enable_debugportpage0_datavn_isunderusbd_get_port_statusuvm_pageoutpxa2x0_setiplpffindtypepdevnamesqsyncwi_setmultiuvn_clusterinitprocesscd9660_vptofhwi_attachusb_camii_phy_downraw_inituvmspace_forkknote_enqueuepoly1305_finishudpcksumtcp_sendspaceurl_csr_write_4dl10019_mii_writeregpop_symlinkml_dechainuvm_pmemrange_addr_RB_REMOVE_COLORffs_oldfscompatieee80211_add_rsnrijndael_decryptwdcdetachmaxlocksperuidin6_matchlensys_madviseupl_openpipesscsibusdetachdisk_attachwskbd_displayioctlip6_clearpktoptsncpusarptfreebufadjustcom_detachieee80211_ccmp_encryptaxe_stopural_set_macaddrbs_notimpl_bs_w_2dead_printohcixfereephy_serviceinphy_servicemii_media_tablesr_discipline_freewdstrategyttyprintfip_sendreaperprocsigcodeipip_inputdeflateCopyieee80211_send_group_msg2comttyne2000_detectbuf_undirtysysctl_tstringsr_meta_clearusbd_start_nextxscale_cache_cleanDfilt_ttywdetachamap_swap_offrt_setgwroutesys_sysarchallprocessBlowfish_decipherbio_validateigmp_initmii_phy_add_mediacpu_reset_needs_v4_MMU_disablecache_zapMD5Initcryptodesc_poolbus_space_write_raw_multi_2ffs_vfsopssysctl_mallocwihap_ioctlieee80211_outputlcd_burnerfrag6_slowtimouvm_pmr_insert_addruvm_map_hintwant_reschedpmap_bootstrap_pv_allocatorpxa2x0_gpio_intr_fixupieee80211_ioctlmsdosfs_mkdirkthread_create_deferreduhidevsubmatchrasops8_initcrc32_combinebufq_simple_nscanpxammc_intr_donedevid_freescsibusactivatend6_timercomcnpollcbpf_mbuf_ldwbioopenusbf_stall_pipeqsphy_servicepxaip_attachcd_patterns__cmpdi2ffs_checkrangesr_crypto_create_keyssd_ioctl_inquiryscsi_xsh_adduvm_pmemrange_addr_RB_FINDraw_detachscsi_xsh_runqueuepmap_get_pdeural_read_multiaxen_txeofbs_notimpl_bs_wr_1domainnamelenigmpctl_varsusbd_get_report_descriptorsd_thin_paramsfiledesc_initurl_ifmedia_statuscue_csr_read_1vrelewi_set_pmwsmux_do_displayioctlohci_alloc_sedpxa2x0_lcd_setup_consolescsi_xs_errorcheck_consoleapm_record_eventfdt_get_stramap_freend6_rs_dev_statein6_domifattachwsdisplay_cnputczapm_restartusb_blk_nfreend6_prefix_lookuptc_getfrequencyaxen_ticksync_inactivespec_printusbf_start_nextukbd_apple_mba_mungeext2fs_lookupmsdosfs_openext2fs_linkvop_generic_revokeohci_hash_add_itdnd6_resolveapm_activateieee80211_decapfilt_sigdetachfilt_seltruedetachext2fs_renameipsec_def_authsrp_gc_initusbd_setup_isoc_xferpxa2x0_bs_vaddrttywflushcd9660_rrip_offseturl_startwskbd_default_keyrepeat_datacomcnmodeclosefcomioctlumass_cbi_resetscsi_ioh_deqsoftdep_sync_metadataif_clone_lookupgetmicrouptimemii_tickpxa2x0_bus_dma_tagdisk_openpartip6_dad_countuvm_pager_dropclusterfilt_generic_detachpxa2x0_lcd_mmapip6_getmoptionsif_map_dtorsensor_task_unregisterzssp_ic_sendwdc_ioc_ata_cmdpcmcia_card_deactivatepxaudc_allocmpledge_ioctlwi_pcmcia_matchcd_get_parmszkbd_cngetcpmap_extractin_purgeaddrnd6_ifptomacwsmousedoioctlamap_unaddural_watchdogmsdosfsread_filtopswsmouse_ptr_ctrllcd_cnattachuvm_pmr_insertcd9660_printsr_meta_saveohci_rhsc_enableif_congestionnfilescd9660_islockedin6if_do_dadcue_txeofaue_detachpipe_kqfilterdowait4ext2fs_openpmap_devmap_find_papmap_kenter_cacheusb_insert_transferaxe_matchrasops4_copycolsukbd_keymapdatasr_meta_validatestopprofclockbufq_nscan_destroynullioctlsys_getentropyrasops_getcharpte_l2_l_cache_modearm_dcache_min_line_sizeisohashmclsizesparsediskfilt_wseventdetachwi_set_debugzkbd_onsdmmc_mem_single_write_blockbreadieee80211_node_copynd6_rs_outputamap_lookupipctl_varswsdisplay_suspendpmap_page_removert_timer_remove_allwskbddevprintzkbd_irquhid_intrwdc_output_bytesieee80211_classifyzkbd_modstateaxen_ax88179_initwsdisplay_closescreenieee80211_media_statusproc_stop_sweepiophy_capmap_set_pt_cache_modescsi_xs_exectcp_usrreqmichael_keyieee80211_setbasicratessd_interpret_senseuvm_map_pageable_pgonuvm_addr_invokeudp_usrreqifmedia_initusbf_open_pipertable_l2ext2fs_vfsopsuvm_mapent_freeext2fs_inactivetcp_syn_cache_activedead_bmapif_getgroupmemberssoo_kqfilterml_enqueuecpu_startupusbd_set_hub_depthwsemul_vt100_output_dcs_dollaramap_refwdc_ioctlamphyattachapm_suspendsfdexpandtickscoredump_countsegs_elf32sr_wu_initwdc_ata_presentmsdosfs_closerd_detachpool_do_getext2fs_setattrapm_resumesysctl_clockratevn_rdwrohci_close_pipend6_need_cacheip6intrfdt_node_namesyncer_maskwdc_default_write_raw_multi_2if_ih_removeuvm_pagedeactivateearly_clkmanufs_unlocktcp_ctloutputure_initpxa2x0_turbo_modeukphy_statusnd6_listieee80211_derive_pmkidMD5Updateblktochrifmedia_setscsi_iopool_puttask_setpcmcia_function_initbio_lookuppmap_createuvm_map_extractsr_crypto_meta_opt_handlernd6_prelist_addufs_removebpf_mbuf_ldhsysctl_tc_choiceptsignalboottimecd9660_readlinkwsdisplay_set_console_kbdxscale_cpu_sleepVOP_ADVLOCKaxe_watchdogwskbd_mux_closefrag6_inputcompressBoundpmap_alias_distunpst_sendspacewsemul_vt100_output_escffs_indirtruncsmsc_cdieee80211_add_ratessr_raid5_rebuildpxapcic_mem_mapuvmspace_freetcp_rscalettwakeupext2fs_inode_poolffs_ino_poolmii_phy_statusmsgwsdisplay_internal_ioctlcpufunc_domainsswapdrum_getsdpif_input_queueVOP_PRINTfdshareuipc_setaddrsdmmc_intr_taskugl_tx_list_initicmpv6ctl_varszaurus_udc_matchrasops_vcons_unpack_attrcdstartsdmmc_stimeoutgf_premulfilt_generic_readwriteuserconf_disablevrefusb_detachin_pcbaddrisavailohci_device_isoc_closeurl_int_miibus_writereguhidev_activatevt100_ansimodeAES_CMAC_Finalsr_uuid_formatrasops_lmaskure_write_4sd_cmd_rw16ghash_updateinpcb_pool_initializedsys_nosysat_pollsigfillsizallproccdevswsr_rebuildxscale_cache_flushDne2000_attacharpcachesys_mlockallusbf_config_endpointwskbdcloseuvm_sysctlstatintrgetsndiskmapopen_bus_dmamem_unmapsys_fchflagsnamei_poolpxa2x0_pi2c_readarp_poolsmsc_ifmedia_stszssp_caukphymatchpxa2x0_gpio_get_functionuvm_pager_putpledge_socketdiskmapcloseohci_device_bulk_abortudav_cafdt_translate_memory_addressin_canforwardrasops_unpack_attrieee80211_clean_cachedsmsc_unlock_miipxa2x0_bs_subregionohci_device_intr_abortieee80211_tree_RB_INSERTrasops_copycolswi_pcmcia_attachpmap_destroyip_oursscsi_mode_selectkernel_pt_listuvm_map_freelist_update_clearetherbroadcastaddrieee80211_rssadapt_updatestatscdcef_do_requestpte_l1_s_prot_urvfs_getnewfsiddiskstatslenaue_rxeofudp6_ctlinputitimerroundSHA512Finalaxen_miibus_writeregarm32_vector_inituvm_pmr_size_RB_PREVscsi_print_sensewskbd_update_layoutmmopenffs_inode_freeohci_device_intr_transferwdc_cdamphy_statusukbd_intrrtioctlkue_ctlpxaost_get_timecountscsi_xs_putuaddr_hint_functionsieee80211_tree_RB_INSERT_COLORprofprocswdc_free_xferip6_inputbuf_free_pagessleep_finish_signalicsphy_cdwi_usb_cmdrespsr_crypto_alloc_resourcesgeneric_armv4_bs_rm_2route_srcnet_tickbootduidspeedup_syncerigmp_sendpktif_setlladdrin_ioctlloop_clone_destroywdc_ata_bio_doneifmedia_baudrate_descriptionsv_putcsr_scsi_wu_getsdmmc_add_taskm_getptrukbd_caufsvnode_filtopsscoop_pcic_set_poweruvm_fault_unwireuserconf_common_attr_valsched_noidlesys_getitimerhid_get_datadonicewdcstartcpu_configuresr_rwip6_freemoptionssqphy_funcshidkbd_delayed_decodeieee80211_amrr_chooseusb_create_task_threadsieee80211_end_scancdce_txeofwsdisplay_common_attachne_pcmcia_matchbufhighpageswsfont_rotate_internalpmap_fault_fixupuaddr_poolrn_refinesgeneric_bs_rm_4hmac_opad_buffersockargshidkbd_ioctlwsdisplay_getactivescreenvop_generic_abortopsr_raid6_set_vol_statesetregsupl_rxeofsobindvmcmd_map_zerozkbd_pollpxagpio_intr1ml_enlistvfsinitupl_cacnclosetcp_do_rfc1323ip_fragsin_addhostifq_deq_rollbackwdc_dmawaitmii_phy_setmediakd_trylockhostidwi_alloc_nicmem_usbusbd_free_bufferuvm_pagermapoutsr_raid0_rwif_downallsys_kbindext2fs_vptofhnam2blkrw_statussr_raid6_assemblecoredump_writeseghdrs_elf32rt6_deleterouteip_maxqueuesysctl_ttyieee80211_chan2ieeeuhub_cazssp_initin_socktrimieee80211_recv_delbaext2fs_dinode_poolieee80211_node_cmprtallocsys_mprotectieee80211_std_rateset_11gwi_pcmcia_cadequeue_randomnessuvm_km_kmemalloc_plafilt_cd9660vnodecue_casyncer_maxdelaywsdisplay_getscreendeadprocstart_reaperif_rxr_info_ioctlunicode_to_latin2sys_fcntlvfs_free_addrlistsys_setrlimitsys_sigpendingwsmouse_evq_putloop_clone_creatediskmapwriteure_ifmedia_stsuvm_map_cleanuvm_pmr_get1pageicmp_redirtimeoutttyclosewdrestartzapm_charge_completepxa2x0_lcd_ioctlusbf_freememcomp_algo_deflatemaxvfsconfml_dequeuetimeout_addcpu_cdip6_forwardbufcache_adjustwskbd_set_backlightnumcachepxaudc_write_epNsr_bootkeyural_write_multitcp_syn_use_limituvm_pagecountcpu_initclockscue_sendwskbdioctlmii_downcdcef_attachin_pcbhashbrelseext2fs_unmountpsratiosdminphysohci_device_isoc_methodswi_usb_tx_lock_tryaxe_unlock_miicpuset_delwsdisplay_switch3nd6_rs_output_timouvm_mapent_sharettyoutdevice_lookupwdc_pcmcia_prbpf_sysctl_lockedwi_usb_txeofsr_crypto_preparecdcef_start_timeoutcdminphysschedhzurlphy_carip6_inputtcp_totbackoffvdropuserconf_basesdmmc_mem_sd_initsr_raid5_rwlooutputcue_setmultisoisdisconnectedpxa2x0_bs_barrierxscale_cache_clean_addrif_putrevbitsdvd_read_disckeypmap_clean_pageuvm_aio_aiodonesr_ccb_rwpmap_clearbitieee80211_mgmt_outputcrypto_freereqsyn_cache_rmclrbitsuvn_putigmp_checktimerscsi_add_linkxscale_cache_clean_minidataieee80211_proto_detachpool_gc_pagesmii_phy_statuspcmcia_card_intrcommajordl10019_mii_resetrasops_list_fontcrypto_newsessiongeneric_armv4_bs_r_2pxaic_baseenc_xform_aes_xtssoclosesr_ccb_freescsi_detach_targetinstall_coproc_handler_staticwakeup_nsys_connectbuf_daemoncrsetskpcsdmmc_scsi_attachpxammc_bus_clockpxammc_bus_powerchacha20_reinitieee80211_bip_decapbufq_fifo_createohci_root_ctrl_transferipv6ctl_varsroute6_inputbs_notimpl_bs_w_8cdcef_stopcsr1board_startupsys_socketpaircnreaddounmountuvm_swap_allockthread_create_nowwskbd_pickfreehidkbd_bell_fn_argtcp_ackdrop_ppslim_countusbf_cdarm_picache_sizesr_map_rootttspeedtabkqueue_readOF_getnodebynamecd9660_mountintr_barrieruserconf_maxdevcue_inituvm_pmemrange_addr_RB_INSERT_COLORfork_tfmratelxtphymatchsr_hotplug_registerpv_sizensgphymatchzkbdhalttvuvn_sync_qin_proto_cksum_outwskbd_activatewsdisplay_cons_pollmodewi_media_statusurl_miibus_statchgnd6_purgeaxen_unlock_miitcp_keepidleif_attachheadnextcwi_scan_timeoutuvm_wakeup_plaiszerodevpxaudc_matchOF_getnodebyphandlefdt_next_nodeauth_hash_hmac_ripemd_160_96umass_cageneric_bs_sr_4ifq_destroylf_freesys_fhstatnullmodemohci_hash_find_itdsys___get_tcbieee80211_amrr_node_initraw_recvspacediskerrwi_startcd_cdwsdisplay_screentype_pickwsdisplay_addscreen_printpxaudc_openieee80211_state_namesys_preadne_pcmcia_activatescsi_movewdc_pcmcia_detachkernel_pt_lookupkmem_mapcd9660_check_exportukbd_translateconfig_pending_decrqsphyattachaxe_startieee80211_input_print_tasksoqinsquediskstatscdce_attachudp_inputnchrtoblktblihashrn_search_mifq_congestionresettodrusbd_ref_decrufs_readdirsys_flockpvwi_usb_do_transmit_syncspec_badopmsdosfs_linkbufq_nscan_dequeuebs_notimpl_bs_c_1ohci_root_intr_methodssdmmc_check_cis_quirksicmpctl_varsigmpstatsuspend_randomnessmichael_finalvn_initialize_syncerdpipeselwakeupxscale_controlcd9660_quotactlsr_rebuild_starticmp_sendadjtimedeltacdce_watchdogsmsc_newbufrasops_vcons_erasecolspxagpio_intrNusbf_abort_pipewdc_ata_errieee80211_choose_rsnparamstime_uptimevm_min_kernel_addressuvm_pagealloc_pgcdce_intrsmsc_rx_list_initfilt_uhidreaduvn_wlistuvm_pmemrange_addr_RB_REMOVEsowakeupinsidetcp_autorcvbuf_incbufq_queuepxapcic_create_event_threadpxa2x0_lcd_stop_dmabs_notimpl_bs_r_4prefetch_abort_entrysigactsunsharetimeout_hardclock_updaterdattach_edataupl_detachrijndael128_decryptttkqfilterm_tag_deletecd9660_ihashremsensor_findip_fragmentfilt_timersys_getlogin59sys_statfsSHA1Finalsensordev_deinstallsched_nomigrationsinittimecountersys_sendsyslograwin6pcbtablepmap_protectkprintfdevice_unrefrc4_keysetupscsi_startuvm_pmr_addr_RB_REMOVE_COLORin_cksumvnode_poolzombprocessure_write_memuao_shrink_convertvnode_free_listtcp_savetiusbf_matchuvm_pagereallocapm_battlowsensordev_countuvm_fault_unwire_lockedklist_invalidateuvm_km_createthread_enddes_check_keyrt_senddesyncsogetopthid_report_sizeusbf_endpoint_attributesuvm_unmaprd_matchure_attachusbd_ref_waitsr_crypto_calculate_check_hmac_sha1wsemul_vt100_attachpollscandomaininitvflushbuftime_secondip6_forward_rtwskbd_get_mapentryuvm_pmr_initrt_matchsr_hotspare_rebuild_callbacksbcreatecontrolsys_mlockpxa2x0_maxspeedieee80211_setup_nodebioioctldvd_read_structvdevgonehtonsskip_propsbucketkqueue_writesys_syncfdt_child_nodeieee80211_reset_scancominitaxen_resetenodevsr_raid0_discipline_initffs_mountfsin_delayed_cksumwsemul_vt100_edrtstatttvtimeoutkd_waitokabtstacktimingsafe_bcmpspeclisthbdwritecpu_idle_cycleversion_to_spcVOP_INACTIVEsdmmc_io_read_4zkbd_cawsmux_do_closepte_l1_c_protouvm_mapent_biastcp_syn_cachemainbus_attach_nodernd_event_idxwsemul_vt100_translatehalteephy_cainphy_caure_read_4ieee80211_std_rateset_11aaf2idx_maxkputcharbootargssys_getsidRMD160Initdisk_gonewi_write_record_usbcue_csr_read_2wdc_pcmcia_disk_device_interfacem_trailingspacefileheadrc4_cryptusbd_alloc_xferscoop_mmc_get_ocrpxaudc_ctrl_abortnextvnodeidcttypollsr_meta_initural_startrotatedfontskp_dma_zerosensor_task_ticksys_swapctlpxaohci_matchcpufunc_dfsrpxammc_attachbd_reqpxa2x0_probe_sdramrasops4_initbs_notimpl_bs_rm_2copypktoptsin_selectsrcrn_add_dupedkeymsgscpu_exitzapm_batt_lifeip6_initpktoptsuvn_getwsmux_add_muxunp_attachohci_device_isoc_starttcp_syn_bucket_limitsys_renamesr_raid6_xorqfrag6_nfragsip6_log_timeeephy_statusinphy_statusxscale_cache_purgeDscsi_activate_targetuvm_km_valloc_waitufs_ihashinitunp_defersys_sigreturnlid_suspendsbflushscsi_link_closeipsec_require_pfsswapdevwd_cawsdisplayttykue_sendsr_raid5_openingsaxe_tick_taskvn_readnclrunegheadbwriteleavepgrpqsphy_cdarmv4_tlb_flushDkernel_pt_tablepmap_get_pde_pteuvmpageropsuvm_page_initohci_root_intr_closewsdisplay_common_detachsr_copy_internal_datacast5_decryptsdmmc_io_xchgxscale_setupnamecache_rb_cache_RB_INSERTpool_multi_free_niwsfont_locktcp_timer_funcsipqent_poolure_capxaip_attach_criticalif_attachdomainbpf_d_rcicmp_ratelimitieee80211_rssadapt_raise_ratesr_crypto_decrypt_keyusbf_iface_endpointuvm_km_page_initrttimer_pooladler32_combineieee80211_regdomain2flagadd_entropy_wordsax88190_mii_readregrgephy_load_dspcodepxa2x0_gpio_set_bitsosenduuid_enc_letaskq_initdosetrlimitpxa2x0_pi2c_getvoltageuvm_pmemrange_addr_RB_PREVrn_initpledge_namei_wlpathuvm_objtree_RB_NEXTsr_scsi_probeloopattachdp8390_watchdogural_rxrateieee80211_save_iewdc_input_bytesusb_abort_task_thread_procRMD160Finalscsi_cmd_rw_decodeprocess_read_regschainlengthusb_fill_udc_taskpte_l1_s_prot_masksys_unlinkatural_disable_rf_tunettwakeupwrrn_lookupthrsleep_unlocksr_wu_release_ccbsrtmask_poolsmsc_write_reguserconf_show_attrsys_execvesdmmc_mem_send_cxd_datafdallocwsdisplayreadprfindin_hasmultiscsi_donechkvnlockhw_sysctltc_ticktockphtree_RB_MINMAXpxaudc_freexpmap_alloc_l2_buckettcp_syn_cache_limitnumvnodeszkbd_activatecomreaduvm_pagefreebpf_mem_ldbext2fs_inode_allocswcr_encdecwsdisplay_switch2scoop_check_mcrbufq_fifo_queueif_idxmap_initicmp_do_exthdrreapercoredumpfilt_kqueuemalloc_roundupusbd_strpxaudc_bulk_donepipe_readpxa2x0_bs_freeuvm_map_addr_RB_INSERT_COLORifioctlsys_utimesusbd_do_requestusbf_endpoint_addressrip_initsocreatepriq_allocusbd_find_idescpmap_cache_statemq_enqueueureadcaue_startufs_setattrrijndael128_setkeyieee80211com_headlogprimemhookzapm_batt_voltnd6_rs_initcast5_encryptsys_exitsbtrym_applyaxen_ifmedia_updxscale_maxspeedswcr_processudav_startaxe_lock_miiwdc_exec_commandpxaohci_caudv_lockbufqspxaudc_bulk_abortwdcintrcd_playHMAC_MD5_Updatesys_clock_getressdmmc_set_bus_widthaxe_attachsyn_cache_insertnsgphy_funcsrc4_getbytesswcr_authencttystats_initne_cdnd6_umaxtriesohci_device_intr_donedochflagsatusbf_get_stringpcmcia_intr_stringpte_l2_s_prot_kwnd6_debugip6_maxdynroutesuvm_map_piewindow_deflatein_prefixlen2maskcpu_cpuspeedcpufunc_iddefrtrlist_updateurl_csr_write_1_tr_initSHA1Transformesymusbf_schedsoftintrscoop_mmc_set_powercrypto_invokeieee80211_defragosreleasesdmmc_free_ccbsVOP_RECLAIMscsi_probe_targetsr_raid1_set_vol_stateip6_getpcboptbuf_releasewsmux_evsrc_set_displayHMAC_MD5_Init__modsi3smsc_txeoftcpqe_poolpgrp0url_watchdogbuf_flip_dmauserconf_changepxa2x0_lcd_new_screencrypto_taskq_mpsafeuserconf_helpsr_ioctl_setstateufs_advlockicmp_initarpinqpcmcia_cis_read_1cdst_pteuvm_growinet_ntopvfinddevieee80211_node_cleanupugl_attachrt_msg1apm_handle_eventether_delmultirefcnt_takesave_rtesr_crypto_get_kdffdt_is_compatiblearc4_taskexec_sigcode_mapsys_gettimeofdayipsec_soft_timeoutwdccommandshortwsevent_filtopsieee80211_rate2mediavcleanif_map_gciophy_servicecd_getvolsplassert_ctlsys_getresuidsys_fhopensr_crypto_ioctlzapm_battchkratedos2unixfnscsibussubmatchrtentry_poolbufq_restartzkbd_consopsuvm_km_pgremove_intrsafeext2fs_sbupdateure_rxeofin6_init_address_ltimesdefrtrlist_delsdmmc_mem_set_blocklensys_fchmoduvm_unmap_detachieee80211_recv_authupl_initusb_dev_quirkswskbd_srcopsdopselectuserconf_common_devpxa2x0_irq_handlerstartniq_enqueueusbd_devinfouvm_mapanonip6id_randomidvn_isdisksys_selectscoop_charge_batterydeflateParamsin_pcbpickportbadaddr_read_1vop_generic_lookuppxammc_functionsin6addr_intfacelocal_allnodeslogreaddead_lockieee80211_name2regdomaintcp_issphysical_freestartfc_largedistancemainbus_dma_tagsys_setitimerisofntransurl_attachnd_prefixsmsc_tx_list_initwsemul_vt100_resetvfs_unregistermii_phy_flowstatussmsc_ifmedia_upddisk_mapvt100_setnrcselwakeupffs_reloadifq_serializecnwriteumass_bbb_get_max_lunzkbd_keymapdatain_ouraddrpolloutuipc_usrreqnd6_na_inputrtl80x9_mediastatusvflush_vnodewsmouse_activateaes_key_unwraprip6_usrreqin6mask96coldpxaudc_ctrl_donecdcef_startunp_scansbappendaddrbufqs_mtxbpf_maxbufsizeextract_entropyufs_islockedusb_detach_wakeupffs_unmountne2000_detachffs_vopsdofutimenssys_pwriteisohashtblscoop_pcic_matchwihap_shutdownuvmspace_allocigmp_input_ifrevarpinputbufq_nscan_peeksdmmc_function_alloccd_pausecompresshashinitttstartumass_setup_transferwdwriteipsec_keep_invaliduao_detach_lockedpool_allocator_singlepledge_fcntlieee80211_parse_rsn_akmsdopentcp_tracemii_phy_resetip_getmoptionsdp8390_mediastatusin6mask32__moddi3rasops_doswitchdisk_countohci_confdpmap_page_protectdead_openscsi_detach_lunsr_ioctl_inqkue_setworddodup3userconf_attrwdc_kill_pendingbmtphymatchicmp6_redirect_outputifq_restart_taskroute_cbsys_futimenstaskq_createexphy_cdreadepcpuset_init_cpuscsi_init_inquirylxtphy_resettcp_slowtimoieee80211_std_rateset_11bamphy_cdcd_play_msfpmap_remove_pvtcp_newtcpcbsbchecklowmemswapmountffs_mapsearch_bpf_mtapsys_fhstatfself32_load_filesys_getpeernamepxapcic_io_mapuvm_amap_chunk_poolieee80211_setup_htcapsieee80211_get_txkeyscsi_strvistcp_set_iss_tsmbpfwritedoingcachesys_getrusagescsi_probeapm_threadrasops_initauth_hash_hmac_sha2_256_128aue_reset_pegasus_IIuvm_map_addr_RB_MINMAXbufq_destroywsmouse_mt_updateusbd_get_cdescnd6_prunecomconscflagm_getffs_truncateuhidevprintmii_attachsdmmc_cdttylcloseconsbufppool_allocator_allocwdc_default_read_regchar_typeohci_free_sitdusbctlprintvn_closeudav_csr_writeuhid_do_readrt_timer_queue_countcdcef_initusbd_close_pipeusbd_deactivatewsdisplay_cfg_ioctlffs_writeieee80211_wep_set_keyfilt_sowdetachnd6_initip6_maxfragsm_extref_mtxlimfreedoutimensat__wdccommand_intruvm_km_free_wakeuprootvnodeifmedia_ioctlpxammc_host_ocruserconf_modifyusbf_setup_pipewi_usb_rxeof__one_cmpldi2spoofgptlabelcpufunc_nullopcd9660_ihashgetmii_phy_detachwskbd_add_mux__muldi3uhidev_caurl_lock_miiip_mtudisc_timeoutrandomopenin6addr_linklocal_allnodesamphy_caure_miibus_readregpxaudc_attachusbf_allocmembufinitbootconfigscsi_quirk_patternsuserconf_lineslimit0uvm_md_constraintsif_attach_commonlcd_set_backlightpxa2x0_pi2c_openuniqdosnamesr_raid5_set_vol_stateinflateSetDictionarypfxrtr_lookupext2fs_mknodvttoif_tabwdc_pcmcia_activatebgetvppgrp_poolsr_concat_assemblesmsc_ioctlsd_cmd_rw12pledge_sendituvm_pmr_addr_RB_INSERT_COLORduid_iszeroucred_poolxscale_cache_purgeD_rngcpufunc_ifsrip_insertoptionsdes3_setkeyarp_maxtriespmap_uareacd9660_bmapax88190_mii_bitbang_writeaue_eeprom_getwordukbd_cnbellphtree_RB_INSERTnaptimeufs_dirbadentryusbf_close_piperasops4_erasecolslogioctlicsphy_funcsgeneric_bs_wr_1_bus_dmamap_load_uioetheranyaddr_bpf_filterstrlensensor_task_workinitialvnodesrasops15_putcharure_ocp_reg_writepriq_purgefilt_cd9660writeconfig_suspendzkbd_enablewsfont_initieee80211_parse_rsn_cipherwsdisplayparampool_page_freewdactivatecopystrsched_nmigrationswdc_do_resetsys_pipeural_setup_tx_descusb_detach_waitpxapcic_printpxa27x_run_modearm_pdcache_waysieee80211_encryptarp_rtrequesthw_vendorxscale_setup_minidataext2fs_reload_vnodeelf32_check_brandwi_cor_resetudp_initieee80211_recv_4way_msg3proc_trampolinepxaudc_read_ep0sys_rmdirdp8390_disablefilt_cd9660readcd9660_vfsopscpuset_copycdcef_methodsspec_accesssocantsendmorepxaintc_causb_rem_taskpte_l2_l_cache_maskcdactivateether_inputuvm_vsunlock_splraisequotaoffpxa2x0_read_ccntcoredump_note_elf32fs_posix_sysctlif_slowtimosmsc_tickudbtablewi_setdefwdcattachufs_printfatentrypledge_dropwpathswi_update_statschacha20_cryptAES_CMAC_Updateusbd_printBCDsys_statukbd_apple_mungein_baddynamicieee80211_keyrunlineswpxaost_cdmsdosfs_symlinksys_symlinkicmp6_sysctlpool_p_insertclfreeconfig_found_smuhidread_filtopsusbd_interface2endpoint_descriptorfdreleaseuvm_swapout_threadsural_bbp_writetask_addusbf_add_interfaceknote_attachlcd_activateieee80211_tkip_decryptdp8390_ioctl__assertwsdisplay_emul_matchnd6_dad_ns_outputin6_prefixlen2maskscoop_akin_pulluppcmcia_megahertz_xjem1144_func0_cfe0uvm_pmemrange_use_insertudp6_outputieee80211_prfcn_devvpcom_activatewi_get_debugmaxfilesupl_devsuvm_pagecmpuvm_pageactivatein6_addr2scopeidgf_mapdma_alloc_bus_dmamap_load_rawif_ih_refffs_mountrootrd_cdrrw_statuspxaudc_write_ep0uvm_map_pageable_allsleep_finishipqtaskq_next_workdl10019_media_initpxa2x0_lcd_show_screenrn_fixup_nodesmsdosfs_strategycd9660_vopstimeout_delif_rtrequest_dummyural_media_changewsemul_vt100_elieee80211_chan2modeif_delgroupspec_strategyuvm_pglistfreeusbopenax88190_media_initext2fs_readsoo_statwskbd_cnpollckue_newbufuvm_map_isavailrusage_pooldisk_detachtask_delstrchrsystqscsi_plug_poolrgephy_causbf_host_resetnd6_allocateduvm_pmemrange_use_cmpaes_xts_encryptuvm_pmr_size_RB_INSERT_COLORauth_hash_gmac_aes_256crypto_driverssysctl_int_loweriftovt_tabtcp_backoffsys_chrootieee80211_rssadapt_lower_rateicmp6_redirtimeoutsoisconnectingarc4random_bufwsmouse_set_paramwsdisplay_pollcsr_wu_freeaobj_pagerlo0ifidxzaurus_battery_c3000uvn_iogeneric_armv4_bs_w_2MD5Transformmld6_inputgeneric_armv4_bs_sr_2rgephy_mii_phy_autoieee80211_rx_ba_timeoutbpf_d_listsr_wu_allocsyn_cache_cleanupip_pcboptsfc_purge__data_startpxapcic_mem_unmapfilt_timerattachifmedia_delete_instanceurl_caenc_xform_aes_gcmuvm_mapent_allocudav_miibus_writeregacphymatchicmp6statzssp_write_lz9jg18generic_bs_w_4inflateEndrt_checkgatebufcache_takesr_set_vol_statewsevent_pollsys_profilvmcmd_map_pagedvnugl_stopin6_pcbhashlookupwsdisplay_cdbpf_detachdVOP_UNLOCKpmap_uncache_pagesingle_thread_setsyn_cache_initieee80211_find_txnodecd9660_wchar2charip_ecn_egressether_ipmulticast_maxsr_raid6_createohci_checkrevuvm_init_limitsukphy_cdentropy_input_rotateusbf_softintr_establishin_pcbconnectVOP_POLLVOP_IOCTLbpf_mem_ldhsafepriunicode_to_latin7pxapcic_io_unmapuhidev_ioctlpxaohci_disablewdc_default_read_raw_multi_4ip6_copyexthdruao_swap_offmachinewi_cmd_ioVOP_CLOSEuvm_anallocin_pcbdisconnectzts_sync_ads784xuvm_vnp_terminatewi_usb_rxfrmsdmmc_io_read_1sys_getpiduaddr_rnd_functionsipmultipathunp_dropugl_matchuvm_map_advicetcp_mtudisctimeout_startupcue_matchrn_addroutesdactivatefilt_msdosfsdetachure_ioctlural_detachaxe_ax88772b_nodeidukbd_cnpollcdoreadlinkatdvd_read_manufactundstackconfig_activate_childrenure_read_2pxaip_printip6_check_rh0hdrieee80211_input_printdomkdiratremrunqueuesdmmc_be512_to_bitfield512usb_fill_udf_tasksoo_closetcp_recvspaceuvm_meteruhidev_maxrepiduvm_small_amap_poolpmap_needs_pte_syncgpio_controller_registertcp_ackdrop_ppslimmaxthreadnd6_lookupin_insert_prefixieee80211_cache_sizescsi_iopool_runurl_openpipesukbd_countrylayoutzts_matchsys_getppidsr_raid_request_sensescsi_ioh_pendingmii_anaruaddr_rnd_selectrc4_skipVOP_READDIRdomainssdmmc_select_cardsd_cmd_rw6arm32_dma_range_intersectin4_cksumextent_alloc_subregionneedbufferwsemul_pickieee80211_get_addba_reqin6_ifattachtcp_rst_ppslim_lasticsphy_cawsdisplaystartbs_notimpl_bs_rr_4wsmouse_srcopsSipHash_Initohci_root_intr_doneip6_multipathusbd_get_device_descriptorpxapcic_submatchcd9660_initumass_fixup_yedataipsec_soft_bytesmichael_initnselcollemul_elf32usbd_open_pipeohci_softintrmsdosfs_lookupspec_pathconfhook_establishtcptv_keep_initsys_chdirext2fs_diremptysys_thrkilluserconf_cntext2fs_inode_freepxaip_capcmcia_ccr_writeapm_cdscsi_io_get_donexscale_cache_clean_sizebuf_objectpxaintc_cduao_grow_convertusbd_desc_iter_initsbcompresspmap_free_l1SHA512Lastcdevsw_lookuplogsoftcsys_adjtimerijndael_set_key_enc_onlyohci_device_clear_togglearm_icache_min_line_sizesr_ccb_allocwdstartwsmuxreadamap_splitrefspec_open_clonewskbd_do_opensoftnettqsd_thin_pagesnclruheadscsi_move_doneural_next_scanrasops_alloc_cattruvm_aio_biodonern_initheadusbd_get_descvop_generic_unlockrt_timer_adduvmspace_shareentropy_poolieee80211_print_essidroute_usrreqdeextendspec_vopspxapcic_event_threadieee80211_wep_encryptsr_raid6_openingsieee80211_recv_deauthsched_init_cpurasops_erasecolstcp_dropicmpstatudpctl_varsuvmpd_scanm_prependsys_getrtablesoftraid_casmsc_resetwsemul_vt100_output_scs96_percentinflateInit2_cd9660_pathconfax88190_stop_cardin_pcbrehashsyncer_delaynoresolvpathin_arpinputzts_scalezts_caufs_accessin6_embedscopeif_alloc_sadlphpoolunix2winfnmsleepsdmmc_io_resetwsfont_unlockreassignbufip_freemoptionssr_meta_rwieee80211_release_nodesohasoutofbandbs_notimpl_bs_c_2nd6_dad_duplicated_bus_dmamap_unloadieee80211_free_allnodesmsdosfs_fhtovppte_l1_s_coherentbs_notimpl_bs_wr_4OF_getpropintarraymaxvnodesether_crc32_beinflateBackEndieee80211_add_ssidcpu_reset_address__explicit_bzero_hookpgfindsoftint_pendingtcp_ackdrop_ppslim_lastloadfirmwarerasops_cmapswcr_compdecip4_inputtcp_inputsysctl_dumpentryrtrequest_deletedkcksumwsdisplay_cnattachnd6_gctimerieee80211_ccmp_decrypturl_csr_write_2iptimerip_inputwi_set_txpoweraxe_ifmedia_updwdc_ata_ctrl_intrusbd_get_endpoint_descriptor_tr_tallyudp_ctlinputmii_detachsdmmc_io_send_op_condudav_rx_list_initpool_sethardlimitrasops4_do_cursorip_freefsys_sysctlvfs_lookupwdc_default_write_regrlphy_statuscpu_info_listicmp6_mtudisc_updatesun_nonamekmeminitnsphyterattachnd6_ns_inputdeflateEnddevice_refffs_syncrd_root_imageusbf_task_threaduvm_map_submapsr_hotplug_callbackscnioctlufs_vinitsys___tforksr_ccb_getpool_primesdmmc_mem_scannsgphyattachdevid_allocm_extrefpgrphashtbldoppollifmedia_matchget_crc_tablestatclockwi_read_data_usbdvd_read_physicalrw_enter_writeuserconf_argbufure_cdpxa2x0_lcd_consoleMD5Update_intm_tag_copyinflate_tablepmap_l2ptp_ctorreaddisksectordata_abort_entryhid_get_itemrt_xaddrsmsdosfs_getattrip6_maxifdefroutersm_devgetwritedisklabelin_ifdetachmsdosfs_printkernel_pmap_storewsemul_vt100_opsin6_ifattach_loopbackstartprofclockohci_device_isoc_enternsphymatchupl_ioctlpte_l2_l_prot_kwundefinedinstruction_bouncesys_getresgidprocinitapm_userstandbysmsdosfs_readdirdead_ebadfextent_do_allocnd6_timer_taskpxaudc_enablewddetachsoo_ioctlswap_officmp_redirect_timeoutduid_equalforkstatwi_card_identaue_miibus_writeregnet_ticksdl10019_mii_statchgicsphy_servicenull_setkeywi_send_packetigmp_sysctlin6mask64ohci_rhsc_ableure_encapifq_attachsoftclockieee80211_node_freetc_initupdate_modifierffs1_compat_writeieee80211_amsdu_decapblf_decryptswdevtdisk_lockscoop_pcic_readarc4random_uniformsbwaitufs_reclaimkv_intrsafedorefreshcredsscsi_xsh_set_tr_alignsr_meta_opt_handlersdwriteohci_device_intr_startxscale_minidata_clean_addrlcd_accessopswsmouse_cafilt_logreadsysctl_rdquada4x_bs_w_4uvm_vnp_setsizea4x_bs_rm_2Chacha20_Poly1305_Initvmcmdset_extendural_caaes_key_wrap_set_key_wrap_onlyzapm_batt_stateip6_use_deprecateduserconf_hist_intextent_alloc_regionsys_mknodpmap_proc_iflushext2fs_mountfskill_vmcmdsuhid_attachrasops_vcons_putcharwsmouse_set_modezkbd_matchufs_mknodsbinsertoobOF_finddevicein_lifaddr_ioctlknotelf_advlockpffinddomainsdmmc_ccb_freeeephy_resetwsmux_do_openfreeifq_is_serializeddorenameatwi_ioctlzts_disablelcd_attachffs_hashallocpxa2x0_ccnt_enableswstrategyuserconf_pnumscsibusprintnamecache_rb_cache_RB_NEXTrtl80x9_init_cardwsmuxkqfiltermbstatmtxsys_getpgrpukbd_ioctlusbf_add_config_descwsemul_vt100_console_emuldatasonewconnufs_direnterudav_csr_write1uhid_detachgeneric_armv4_bs_c_2pffindprotoudav_watchdogbold8x16_iso1uvm_pageallocsdmmc_io_enabletcp_saveti6wdctimeoutwsemul_vt100_initHMAC_SHA256_Updatenchrdevfrag6_freefundefinedinstructionuvm_pmr_use_incaue_cdnamecache_rb_cache_RB_INSERT_COLORuvm_map_vmspace_updateqsphy_ca