ELFa( 4DC4 (  yJyJ`::((DCdcdc(_DO! "&@00Q_: 0/dC\@/ XX@0 6QQO @@( @0 <  B00 RևР -L >dc,Eilcmain() returned2i   ),@@(LQ 0/4bT3i - 0LP@po`ga`VZ -LM`P@pP@D0D 00``A:4@ -LM`p@P 0 0 0 000  P@XP 0޷ط@TZзX 0P -LM@P`p? 0X0 S 0N 0I 0D 0?i闷 - L 0$ 0 $ -LM  0@ 0 0T p-LMH$,$HP0`@ 0p p-QLM0@`  `>hpQP* 0 P(U:p p-QLM0@`  `QhpQP* 0PXU:p p-QLM0@`  `LhpQP* 0P\U:p p-QLM0@`  `hpQP* 0 P,U:p -QLM@=0 =D8P8 -(L  -(L _ "- L p-LM@ 㰶P` 0㦶00PY YR` cUpp p-LMP@`V0 pd〶T0H@ 0S' 000H@ 0?' p-LM@` P^?XP 0s UP00Sp000PS 0U 0 0 10P 0UPp -0LS`p 0S 00 J 0@? 0@TTppPPpW pP W5,0PUP12eW%14@0PU0aP0u 0000S 00  000 㴵000 0@12e1@4 TP000Q00Mp: p-LM@`DP!=p -2LM PRx2   Kh0dS`2h0 0SL200l0S 3 2  OB^h 4$` 4p@lP4` 000S3033/`VOڶ31  p4@`0,K  `VOZ`H0S3`VZ00,0K,pK!0(@ *pK+KV 0< P303303# XP3,00,0h0 ``3000P w(b:  :r:( h8 g p-LM4@PU @, `00  , 0!2c140  0!2c1>`,pXP , p-LM@PR`e @Hp p-LM, P0S 0 $p4 `  0DPT0T ,0 0,0 0,0 0P,00,0p -LM8@>@ 00S<"Z -0@S0L00ph 0PP00P=WP`U L:    (: :::rp8,988 0-L@LP8 0( 0( 0h' -0LM@p ٳ00 ` ȳ00 PZpd3 <# R00Wڀ0?3S -1LM`@p3`P0 R0 d0S `Vʃ03,0 00 -`0VLpP@ 0DPT dT0`0 M0V D0PT -PL4p`V 4h,0( 00999, 0  ,00 ,00 DPT,0 0,0?9988888 -#LM08 ,0 P00p0S4 00g 0S@0 ŕ0őSS000@0000&2R& $ ` @0S6`V@DZXH 0@00  00 ?`~0S6^`VZ6 `0S69`VZ0S0 00S000 @0 00   p pR00B"0P0 00    ,  R00 0B$`000 1 ,0S ,70 @0S   60S0 ` 00`$1 cP0 0  0 S   50S0`00`0 HP0 V00@h t0 7Pc40S`@@b0D 00OK ,RP000(|dg8: -08`P@L p0 T P0 0@e0 -08`P@L p0 T P0  0@e0 p-LM`P@3PUOp 0 H|Pq800 h0 8Tg83 <`8:0\89$X83T888,9$888H8 p-LM@8P@`4  00 00S p  0S > S 00p000 d%8`p 0 00  (000C0 \888 -0`10#0LP8pP@/ 00 0000  0 0, 0 004 P`0 0@ 0  @ߪ0$ z 0   ,! " 8 -LM0p ` PW80SL  0 OP=0 @ @00,0K0,0 i Ӱ i( ̰ 0 %P00 0S  0 Ph 4000i= 㨰 -LM0` @2c1RP4p 00 P 00 0 00000  dW 0 p-LM00 @ 0P<000`0@0003  00    0  0 0 0Sph|Z k000000 00 00 -LŒ _ @hp0 P  &H0!@&l 0 0 0p 0 0' M-L0@0 ἐ$8h , 0$̠$$ $@,l 0` 0 0 0'%x 0-_020@P L0@ 0'00@- @ 0S  4000$0 0$0$@@ 0-L@P(8/@T` 0 g p-LM @00P ,0`0,0 @R 0$ 0 00  0 /ph\ g -LM4@0S @440S -L M$X @R0  l0H $@5 h588 - L  -LM @㢨 0S@0 @器 g -LM@㐨 R000 刨hs 0-LP,0@T 0U @Ts0 g -L MPP@`x >  (3Q yQf +>4K2 KP4[S?0? ,  (TL2"#K <K#KP2[p2\# P6K 00 Q0N @,",2S 0X 0S/  1 1 1 1 e1 {p3?h0?X1 0 0 0 /   0 0 0/ 0/ꀖ|dg&<8`8l8x89h8+ ## Ѓ ,9p8j_eNa'(#j) 0 0t/ g 0a 0/ 0/ 0 0/ >  0~8 08x/ 0Pq/ 0j 0be/  0Y 0S/ 0L/  0E 0"?/ 08/2D2@ \`0ô/?X2\?0ô?ś=Qh22 P0ô/?Ŝ2 P?0ô?ś= s2/2@ Q2}>ü?2/ 2R 2R/ / < ?0?3#Q? ; -/8 L#8 $ϐ R2 d X# -/8 L#8 $ϐ R4 h X# -LM?`0 5Rϖ R2 d 0X OR4 h 2Xxrϐ R2 d 0X ?R0 ` (ϖ 0R4 h  X2Xo_  ?R" D ( ϖR@4 h 0XH?$HT@ 0  `1ϖ R4 h :X41ϖ R2 d $1X1Sl0ϖ R4 h 0X0ϖ R4 h 0X ϖR4 h 0X  ϖR4 h 0X#p -40Lϐ 0R ( # -LLME0 P?= R05 Rz _P` ; _1 `0P@ D@0@ P <C4SL S 1h` 0@0 0S 6S l0S`<@0 S#4$0 P@ @DP?= R3Q 1`   &`0SDl0KP6[p5[ 0p0 u^P`} ; `_1t p0 S00pC bp b2 R 6[* R]  RZ $[Q~0 "0. P|p0@X"0S 5[  @20S S 2 RlK Px >a@ D P 8_ 0@50>  D0a a$[Q>K  %8K ! *K  0 0D P 0P@ 5 Ry갤[>0Sڼ6[ / lK0 <0 < P K_8 L/<00 0lK &&888##48\88@-05;505 @0 @0  p-LM`0@ < 5K p魢H0,0P@@២T ph/&8 -LMA0P 00K  "[D10R8 = R 3[pCX#mW(`ϕ   20K#0ϕ R8 p (K#[0 R3K#[101pW-0 008@ L@H0[q= 0   &###" -OL@DtpP ϗ (0  @DMtTeaϗ 8R  #8X OR8  #8X 0_R8  #8Xϗ 8#8 XA ϗR0 ` (0P@DtT8< 0. ?R  (ϗ 0R4 h  X0X  8 .#8 8 p-0L M PR`0 PEu @0@0 0S PE⻧uU?0?#d4`01K02K01K80 K p,Y.p?P#&H8 0-0L PR ?/$@ϕ<</0Txϕ@/0T0hm0# -2L M @RP 2R 2R 200!P 80Plr? R8 p (0 hVu ?R8 p (0 Pe`\0  RL8 p X0? SG 1 R 1R |1R 1R P P 0 00 001R 81R0AS=0,PK2KK# #&!(## # 6S-L@p6 8S `,Pϔ0S8 #8X0ϔS8  #8X|Pt0ϔ R (0  PE␥uU< A, `#\8 p-LM@80PP`0 ( R8 p [Vp# -LMPp60 P a 0? R6 l mV ϕR6 l 0X OR6 l 0X 60mP@ ?R6 l (P0 S ?R6 l ( 0 S#4xV -|1LMp00  @PHQJDaϔ R0 ` (0PEuU4 ?R" D (  ϔR4 h 0X 60Po?PPl0ϔ R6 l 0XP?U< g+ &#x8 -LdM⌐Kd Z108K0p8K05 -BTP @ 00`W ʁD0S P=Tp`@00X 8K0 5<5 d$0 & p-LM 2@RP`0 Oʔ2RH +ʈ2R ? R `ph2 q `T2R L2R>@@ @0  1R 1R 1R111R 1R 111 31RM !ʀ1R t1R l1Rd1`1\1R T1RL1@@1 @ 01 (1$1R" 1R 1R10 0R 0R} R0`y Q0u s*p 0#$D 0v 0   -%*C##8 ## -LTM_@`>\ p?l p  H?T 9 =T> =T 2 = S! =@S d> 8C8??  $> R \=2K03KK>0K ? = R = 2KK"K@ 505 0S = vh= 0 Nm PY  T`<T zT<T# L<TEPE< Rn?! < ,00003KK <"K 0K*P$P< R 52* ,< R7   h;l 0l)  ;  lP ;M@[   0+?A1c 1h h0 h0 2c0*H+0*:T* :T|P  P:T F8:l 0l,:  lP l0  \ ,9l 0l <0@: lPl ?P l )l Pl ^ |,9 \* Yt9\P  \p  \ xI0lPcl\P]5Z 0Ul0sO8\8 Q|8 \! `8R d8R P8R P8R 48R^7? 3 ? / ?+ ?@' ?# lp?=7\ ʴ7\ 77\ 7\7 R@7 R 7 lp7'0P `ml P'l}Pl 6T8 <6T 6T6 T. 0   t6T:  <l &lLP5@ `6 R l P<&l5T 5T0 5T5 5 R"  5l 0l <05 lPl0 S !lp  p!  PZ !p p! PNp0  QP40Sp0@ ]P { @X`K@&@J@T4@EK5K |D%K RKA p勭@ a@Pp  3T 3A3T`P3 RC  3l 0l <03 R 3 lP:l0S > ` h 0d0 0lh0` 0aR0|S:Vv l0` 0Pt0 j | @x   xt 0 4#0@R0S@0t0  %<0 S0 S0 7S 0 nS00t0B20S 02 BB0 C 02 R0x0x ?Px00x0d0| P0h`0` 0l0d | a`d Q |0R*Va k] |`Al q i0l 2` h 0d C3iii iii i i i i i ":h gfff8ii8iB-%Ci i i5i i i i i "Ai86i(i|8171"##&# l , lPl0 SIl0 0RM  R 0R |0 lHl0?=0l0@l T (l+ 61R%  1R|P lD&# $lD  P1RP1 RhAl0 q 0l0 1l0 0l 00!l00S001 R?   ,l l0 2 lPl,2 R 101| )uꓘ 0-M0LM PcR  0 R ?AKA A 8 0  00 c%|0|@x0 Kp ̠0KPT0K R<0< Ca 0"#8&:gfff -LQM? `! 06d 5@7Ч0 3K?3K#K<K ?;'K4K DK$K 0x7x4K04KLKK P7 0%K5K?5KTK $7$'5K K%K\K 6&6K dK&K &K 6&6K 06K&KlK 6&7K 'KK 0tK? @pahvPK@&@@mD6@`@K KK;KK 0@T 5 R) 0S R# UAoK@@@&@@0K0N,K0 0B/ N@u 0CK@M_K&@f@ş5(K`@@>K  2@`Y 04K3K0O H0K D 4K(4 R 5 \\4( K-K00QK3 ?B4PCP 0nK0  P'`!0/  P?`! /d5 @05%<+%G8#,#$$3( K S0BSKR/K00"2(K UK >K 0 2"##00$ 2P 0S P W_KVoK h2 0`0\2(K!0t828"Q1"W_K(KVoK01( KOKN/K00 0NPK&@p@,1@K@ =KMKKg 0\10K8KKK 0,1,!8K 0(K8K 0K?00/K7K'K 0|K?p&  """: 88 # #&#$##*#!-# -LGMA0`S, 0p0 0P ``1 \K 8K 18"0C#K "K4K1p0C8#8#$0$#K@QBK* 5[9 0K 5Kn <L(0 B@R$[\4[Q04KD 0  0000 <  L@ B0Q DPp 0 P0 0C0 0 c0 R 0 R 5[C  0& 7#H8 #Qh\89d88v'N$ -LM?`P(0Bp S? ȁ ȁ ȁ ȁ ȁ ȁ Ё 0H S$( $  000NP @|/P %l0l 㳀pT0 R    p-LM@!0! 1P` 1 R |1  , RU CRT1   R p81 00S ̂ ̂ ̂ ̂ < H T ` 0 8 0 \ 0 t@p0 ^0 V0 t0 h0 \0  R  R40  R? 0 0 #& 0-MLM@P800000|1 R?  & 0`!00SSS @1/K 4!0K(1AKA APA>K0C R00000000 K 0 K, 0AKA APA.K B00C S񟗽X h $ $ $ t $ $ $ $ 000000000&D -ML M?BKI0 I| 000CSu#$ D o0T p0S^XPpڼ8! #  1  P`C P`=04H8( K81BNK0!@@D(0K 1  P`# P`8 0(K 0$!  0  P`   P` 8L0  @ T GP`@ & p-LM?#̀@$( 0 P `  0004 0S`V@PpR 0 SP ppp# #3i -<0(,0L0 &0 0   p-QLMPC  R?`:? ?!:?`000 0P@ V p 0S`+s է 00b=C4`#hx0  1> 0P@8p, 0, ? `p&&88 0-LM?@+P"0 00> Ph0ϔ R  ( P 0,0B=C1? 0000-0&# R-L  0 0C SE Č Č Č Č Č Č  ( 4 @ Č t Č Č Č Č ̌ 0 00 0 0 0 0 00 0 0 00 00 x0 0d 0\ 00 P00@ 00 40&&&&&&&&&&&&&& 0-LM0@PSh갍  4 P Ў ؎ h1 \1! 00,1 @ 1111 @P !1@P0 @ @0 000 000 000 000 | 00t0d0`0 @ T 0@P@0@ @P&&&&&&&&&&&&&&& p-LMP\` 0@S0\0S p  d B 0000 0-P@0@@L ᧽00000 0-LMP0!0 }0@ 0K@{0 K0 K@t00@i00@0 0S 0|dg8 0-8MLP$@it0 R 0s? X0  @0p  R0Z0x0 20h I#L 8 -8Ll(PᶏL@:`p"3`0  /  + '밠 * 8 -8Ll(PᶏL@:`p"`0     밠 (8 -LM8mp$`;s/000ݍy@T t8#@0SPU@0H?i黍@T h@ 2@TZ D8:d8 -LM]㚍$P@T # 1  00p , W00$ 0 !0*0!00 @@Z00W00S@ 1 @T 1  of!00 1( 8`  1R010000 0 !0*0!00 @@`* 8`  101! R009` 88 p-LM0@]  $PR0000 0` !*!0S00@@@P2 ph0 Ca:gfff p-LMC0IDPm@Du$`D20u? @$ R00000   R 0 0 0 @P10C1p -LM0@D! 0R 5 0 0R 1S/, P` 15  , , c03, 0`1fP! !1R"/1  0P@ 001S1%ᄡ0 ㈡1 &p1 016E 0 0EP 1<1888ʚ; -LMX8`@H5M, $@p (5Q  5Q] 35Q p,0 S ,`K Pp㕈>PP !+K3;K#+K3 ;K:00K|p |p PpPK PpkPP 1 z 8 1PpĀK ŹPpBPPp !D3R pô~+[P!| 3Qk a:3QvpPU@ 0|S:?0 K|  KH KD>0 &K6K3 4K3U K#4V0K3f K4K:00 f0Ke K:0 f0[h K0  f0K:0 f0[h K0  f0K:0 f0[h K0  f0KK| ιPpO0|@00PUH  |0R*Cs?K 帹pIPp K /Pps =[ 0 K Pp10 囇PU@! 0S:`K ㉶3 0{ $ 0@+0T:x t0 0Rt0x  $@kT<0T, 0 0000 T@0 R "000 0pp0qz԰:h: -LP `ez0pvP $  $ @$Iz@ 0Thg -LMP`p6z}N $0 @T c9P80 T00 0 }N $0 @T AP|@ my $0@@T + 0T 0Thg N -LMP `p@y 0T`@0DD @T0 T 0T 0T @0T0 T $iy -0LMpQ` 0K 00PP S0@  T x0x@PU dPd0 0Q S0@ 0 044 0괎:tgbxgb `g p-LMp`l0lP P0P@HH D0 0S0X$0@ptg:dgpg :|g,8 -LM⌠@p` 0PU 0 3@@0@ <040@, ,0`pdg܎:;gtg::pg: 0 tgdg0 0 tgdg(0 R 0 Rtg: 0-@L x04 00P0 T0hx -0删S@0 4p 00  LT64 Qh  $  0@ T  0T  0T 0Td~ R* R  0 T R RG$  ( H P `0^ 0 S0 00 0 T  $0@  T@0  T0@ L0T<ğ<$00 S Q0Q4 r !T <  sPl 8S080m50$04 40plh`Q00000<4Q 00 0@ 00 x0 002  R g0 00  $0`  T  $Z0P  T  $`0 @ TP@ZTU0  00  T  $0 0R0  T!0  T  $P  0T  0T $ 0  $ P P0 00  0P00 0S0 x}0 @0 0 phtgH8b b;gX8 D h8|888888888hg,9P8:lg'X8t8 -LM0`4PY 0S@00 T 0T 0T 0T 0T 0T0S0'0 Tpp0 T}N $0 -@T }d|p}N $0 @T |0S\ pT  $0PPpT W8 0-L@PQ 8S40  0P 0-8PS@L  L4QKN0PP: p-L Mh@V PK 0 P ,0"  000(^ `08 200pp80 -L MX`U(pK 0P@)vP(,0 0@00(PU 0HZvvH 080$00g u p-LMP@u`e 80Hphu -LM4 < @ 4!P< , 80 4p8  0<0CR76, 0 90>0P`*@G S : R#: , Jc0 ᾬ@`p`B0 Xp0C$ 0P8 R <0 ,4 0 ឬP@ 0P0NPP`  0 0B@$B -LMxPW$`K 0P@)Tup$ ,0#  0@0(0(?^ H?u>uH 0p85040 0-u p-LMP@"u`8 0Hphu p-LMPh• lp2  h2l ,` B\0 @`0 DT8V 0\2p098988 -LMh`plp2 p h2l , K T81SM h–lp2 p h2l ,hRlp2@ p h–@0l \@h–lp2 p h2l ,@cT\\hBlp2 p h–l 1\UDshBlp2 p h–l 1\ 8 -LMp 0@@T $0Z 0@@T &0Z>o ($8 0PP t2 |,B[03P P 090P P 090PP 0@900D?0P! 0T90"$@0>T 0ڔ@2|"@Th—lp2  h2l ,h—Plp2  h2l4 ,h—lp2  h2lH ,0 h—lp2  h2lL , \4 ,P ~dhBlp2  h— ,0l\dhBlp2  h—l 0\@ yh—lp2  h2l ,@ Ttx P@1@M>THEBh—lp2  t2 hB,0 0l \h—lp2  hB$0l \h—lp2  hB$0l( \hRlp2  h—l 4\hBlp2  h2l ,PhB, _Plp2 P h—0l \hBlp2  h2l8 , I$I00<#N>C 0ChR0l , Ȅlp2   h—4 l 0\2hbA$lp2  h—Ql0@ \hBlp2  h—0 :lH \hBlp2  h—P 8l\hBlp2  h—lH 00\hBlp2  h—l40L \00#k@ `eh—lp2 ` h2lH ,@ T P 1PT!0040TXPXo0L8 h—lp2 ` hB3l1 \hBlp2  h—l ,0\p@TJQ@TPEZP:48@%I$0:!:P !0 2  -LM HTe | H0S 8$T| i@ 8H SH0$(  0-LMhR@ lp2  h”l 0\0 -LMPpqUU U mqteh—0P00lp2 P h2l ,PHT hBlp2 P h—0l \200C0h—Plp2 P h2l ,h—Tlp2 P h2l4 , X4$h—0`00lp2 ` t2hB x—,0 0l \h—lp2 ` hB$0l \h—lp2 ` $hB0l( \T8SP(R hB`lp2 ` h—@0 l\hBlp2 `倀 h—0l \hBlp2 ` h2l8 ,XHl"00N>C 0ChR0l lp2, ` H h—0l4 \hBlp2 ` X(!h—l36@ \hBlp2 ` h2lH ,hBlp2 ` h—l:H \hBlp2 ` h—P 8l\ hBlp2 ` h—0H l\2  0P(0C0X(T(h—lp2` h2l ,Ah—lp2 ` T(hB$00l \+=%I$P 40 R(0 R0 R(b= -PLMP |"RpW 0``00v VhB lp2  h•a0l \3` T2X"0 T2X"QHB,@T2V0CT2hB lp2  h•l 0\303 (eB@`dhB lp2  h•l 0\`\80\8P`\(0\80  h lp2  h2 l,|"`bh lp2   h2l ,`R |"pMH8d888 0- LMQP hB@lp2 h•l @0\0#hB@ # lp2  h•l 0-@L[o(PM0hPo -QpL@P`08S 0 R`,8S  0$ $Rp0S`@` TP$p@p8 -LMT2p0T2o0H0,08,8 oT $PU 0SSoX@Y 4P$U  R00R\ Y "0ST20CT20083 `4 @0 0b@0 L @0 倠0 `#> 00Z 3Z 0L0n`n0S R000R0 A60S!0\@P- R 00c0C20000#2wun`on$0S` 4 00hB lp2  h—0l \Z0 00Qn`KnJ@Z$0S  -LM`@(0 S4p8PP 0$01l00<@ ,0 00 00C 00$@202LP0080004 -LMlhBP p2`   h2lP ,V5 <0 @ ȕ10C S1 !@ T 0 0 m7Tph• lp2  h2 l,?> 0D <@0 Tp -LM`0Vp0P 0 QhBlp2 h2 l,3 `VZ00h10S  -LMh@ lp2  h2 l,3 h -L$MP%% 0 0 < pD8`,P, @ &P@ $4D@08 8 <2 00 $0880, T4  ,K4 <0P,0P @, k4040<0<@   T140<0,  0 0 4 0 22$p<P!,\H10L`0,0,0, ,0 , 02,0, $pl08 08hBlp2`  h˜0l \0S 0 R lP@g` |X0 P0 ,!x ,(0=!:Mb0 0  Q-L 0S S 0SQ 0 0 =8-0#1? $ˀR 4    R 0 0 0 !1?0 P 0SP-(0,#1? &̀R, 6 0 0, R000000 !1?0 P (0S,P0@-@D 0 hPR 0@0x p0t0@1,! 0-L@$lP0hl -L Mp0,"`P0U@, > ,00P Ro PH Y4[ P0 ; 80 0$,S03( 00 0*   0S0000Y |!!!(!0!<00  P k@k00S  X 000o000k, 0r00  o@ 9P 80(S"ˠ ʠ0S80 S0000 |:ď:::L:d: -LM04p@Pwk`Zmk0 0004i7 -LM@P0pl14 RO80 TXH1 R<Jk`PCk090 &:k0 ` 40 +k*kL0$ `R 090|ok0 #>XS @ $0S Z00k`P3i8,8 p-QLM@`PpT 00 @DRT0  0 @DRTʃ0p -LM@P 0h -L\9R P9RL9 RR 4909R8 $9R 9R 9RU 8U!0IPPS񟗳"!"! ! ! ! ! !"! ! ! ! ! ! ! !#!X#!#!#! $!hB lp2  h—l 0\0ISh— lp2  h2l , ~hB lp2  h—l 0hB lp2  h—l 08 0 SU`0V@ C00BK 0( <25(  `40@ ^000P@@0 <D0*Q@8p0!@ 0)P`$ @ 0A,(0"A 0 P `4@  D 00pre(04 0,08`090oge0  oY|80 0P  -LMP@0Le0pSS 004`090LP40S :e"6ep0( 90 i*e P40S $ei8 - 0p`L<0@@peP4e e 0-0L@P80h -LM`  @]1P0,0 s 10SБa LqS]8P@Q  0@@Qx1  !!P?Q ^@:0 @: S@:  @:S@:@:@Q@T0^   0 S@*RP@:@:@ @T^@ | 0@@Q0,0 ,@@11 ,0P m8|:8 -L4M!0T ,0 0ZX0 V S Xp8\ \l1 ,0S \,WP 㵙X0@:@:@:@ T0PAt0 JX0p WL`K 0X:PK\P+0P {P!  P0 @R: `Xp@ t \ r R\ $0SP]X |dg,8D |:<8 -R`!(!("LM!r@P 0\ a @ h8 -LMpKP`@ƒU7 0' @KLK x@ pP D |@ @ t` ^\P0@ p00p0, c}@G0;@P e]00 p83i88 p-0LM PR@$  0`@T 0 0S\ @JTL0^@PpW\TN8 -h!LM07 0-L@lbPP($0  0h^bR8 -3L|Mt p W@x  3t 3  婗P| (0) *4+8<S$,0$Ġ$H 0 @ 0PČ`Ȍ< L !4!!̠""H"\@0P  @ 0 0| !" 4#`8< | Pl2t \ @  !" 4#`8<T\P:)0( *$+01d(1 0 @ n\P.Őx >(0) *4+8<@T^: !"#` 48<@ $$`1t $, | X$X\x` `0 48@<T: Qt0S|〗p@KHㄐt 0`0 l %|&P$@'<t | 0P !"#`0x. H\0X05x 0T 8|:<888 -L M  㱖82 0R00 $2!!p, 4 z 2娀`V X0S\ @jVY 0 0   ,P0\X004 8 L`1$(T\H1U 0   OP000 4\0 \ (0) *4+8<S1S0\0 !0 @"# DHL0AdAP\.я0 48<SdX ďP0 㾏040  %~i|:marcCRAM H8 -L04 8 L1$(T\0U w,0 S ,0 4 8<S  _\@K `0"` P H  P( |dg|:marcCRAMt88888 -LwM0 ,0 ! p] 020$04  0 20$0 yKX PP 0wP@-K0 ExP@  0wP@Y  gPp  `P  1 `|2.K2S `VQ ˕W ƕ2 ,0S ,02$04 yK lXPY0 {wP@ Y  0EP @04 8 Ld1$(T\ 1 hw41U .K 0  1P 0  0 @)r1 9@!_0!Y~1pT#Y  0%w!<Fv|dgedAX$8P8marcCRAM l8888 -9LM)@ 0T ,0 | x  0SQ @Tx0@S@ @ py Sx  0S H)0S0  54 $0%6&7@$4' (8X,<r0` ` b \ @ )P $^ ( PP  5 406748 <0100 23$(0, ! 0"#4@8<0 P0U 0`  0S`$PUV$0$0$ @ P ǟ 0S@ PT00 000Zx0s  P|0    P|@  \ ~ `$`V` \ tK(d0s 0h0  CR | 00P@S0ڌP XQ $%&@' |LPKq| 0 `ɠ凡A E|0 P,q` 0 P4@`$8\ (LV@ P :0S*0`9 ! 0@PČ4 Ȍ8 4X@ 0R |P `a|fK04@1 6K` p tK |  $ R kPU $`P 4t@㾓T㸓VPxX S@㭓T0Yx0  㣓0S 㝓C,0 S ,釡ꀀX=  P9 H3h X00S'0S0 Pp I 0|L K0LK :0`98<=0:0>`?Č; Ȍ>L\00@P@@@@PPPP`9=8<0:@>P 4;?8 ,"\!4!!̠""H)0*+-.@/P(, 98:= <0;> 4? 8 `[,!!4!Ƞ"D""X 1035@0`26P7[LK4 8 |H H0D@0X0YZ[| <0S@:L@04,0  ݇00%S/ S S S1P Y=S  S 0P S005S (S *SS ʈSS0 x0l0 dp XTpX W{<$%P8DHL<880 -LM4P@pv0`T8 0T 00Sጏ`0T`z0T 0Tl0T d0T8  B%Bݽ?'B&B((B "BP!Bp -PpL`@X0S  P 0!"4# 8<`@TZ L   L000 -LM p1XZ\$ Q<P `\ @ P( `P$K4 0 0 p0 l0" ( 9=8<>`:P ?;L <$K41A 540674 8<0 ! 0"#4 8 405647 8p0@ , ;?$( ́ X8 4 00K0 K 0K`Vp&A@ _P $b)c`T0:S00 -LM p`@ P1X ^PU! R<P PU @ P pWX ( $K41P0  ! 0"4#8<X05 77 :405 6478K2S$ .KdZ X D5PY 2S  0mOڋO/K0@@ lK@O0 K<K >1K  z:_a  t&$&p ,r " $ r!&̠p",`r (  " b |K>0 (0S|K?0!"pW0123456p @ p\!\1H00L!X+ <d41,!,1@  P S00@JP .KD@Ћ<0S@:<  @:S@:@L00L0 "  0lNL|dgH8h88edA8D 8888X88 -2LM ! 0"4# 8 PU*2 !X0S`PZ D} 0p ZPaT1@Q 8 R 0 S@R@Q1Q 8 R 0 S@R@Q `:PČ$?@;(Ȍ*L\@ )<)*H t <\[d@ LK*Dd[l@ KK:Ll[t@ )(JKt[ XF0K 0X ` h p DKCKAKIKB0KHpKGPKEKx cx**h*D TK } 0< =>`$?@(Q:P0Q0KT0KS0KR0K@0̠  N0KMKP@KO@K=H089@:P;ČȌ>`!!@ $?:(; |Ul,0S41  11  1!1  88 4X0dp0p @K0@P`p,HdD 0P@p@ @8 :;p $@(?`,Čp@Ȍ`PA hq́!  Q pO< Klq 1 ! Q  -K~KK`1P`K`/O<1 L P K%K.K.KnK30p @ P0< |1 3pA 吁 ;? $( ́ X  KKNK`Vp& p``p &c` 8hqla p 1h W= K-K p! Qw qtW p`h呆0ᗓ#9) Pl!Pl hP UOKKcy`y4;a 1 ()8, 2 1(̠d), a ! (!)d0 b . b#4 1 ,02"(! 9p d)(r b $" lw ;)|    ( r 0 K^ @ !0 0 K^ K P,K R I 0 0 $> 0 0Sl #03 h)< LK0pA 吁 ;?$( ́ X  KKNK`Vp& όQ mK< @R Kpp K H'?c` !AtQ0Q0T a  M82h R2]K@0pa RʋtqQh0 00000000 0! "4# 8 ^ *1h X0Sh l1hP~hW=|h1l p h{P 0hl p apqVTilalQl1ap\% K$1tASTPQ |dg88 88<8H8 8T8t88 p-LM`@U  0 |0 t0 U] pLPᅎP0@S @/P P@J@p48!0 U R@-X RS\08 R,!!!!,!0@04 @ 00@04 @ 00@04 @00@04 @0 0 0 0 0 0 < 0-0  Y= 0 0 |0| x0xt0  Ȯ!x!!(!!!HLА!!ؓ!P!Dp!<!8!  M-LZ 0:\0 pǏ 0^00_0\0]0 `@]0\^_ ČȌ̌Ġl 0#,!4"!Ƞ< "\!L"d"x` ?P90:;@=`>p80] \^_ ~0 8 0-d0L@P]0\^_  ~! 0"#48 < 0 0-PPL@0 +0SP <0 \]0^_  pPP00 -PLM@0 B0 -L M@`p2G0 1XPU UV #Gd0d 1p 0H`X`<040`0$ P^iG8 A! 0-0L M @!0 "#0P 00K1PS 0 X R1P0100SU \ L00<0 p 00|0 p 0s88 -LTM4 0#80 @0K<@ "P8#0K0! ]\"$^嘀_P#@Č(Ȍ̌,0O`KPK { d`0Kd v`@K @K PKP@@P `K PK}d O<P KP0K`$@ :PU`/RQ`P<@4 @0h@ pǏ008XD l 1X\p Pp} $;tD"28 |0DP@PHPh 1P < 404 0<@8 046080D!8l@08  :L08 1* p00p04 pW80 @   4 ` K@0Pp K@ Kh@t0@Qh@ x P400@ KP K`XW`P4@0004@00SPKYE@4P4] E8 0 p D8@!3iP8 -L M`PpE, 80 Y ,00,0$00 0S$0:( RC1, ( 0S V @0SQ` xDD1 R,ouE,1 Rʦ@ RD D0W=0D0 @ D0 4 R @PD W=0 D04 D0@0D 040,0<@t d @4(00(00q0  ,0  p88 8 0 0 0 0 0 <0  0 0 Y= 0 0 0 |0|x0 0 04!p! !L!!!HА!L!ؓ!P!Dp!<!8Ը!  M-L0Xph 0`]P0& %490@0%%̠&&H?:;=>@8P<`08-, ! 0"#48 <0 0-PPL@0 b0SPPP00 -PLM@0 0 -L M@`pwD1 XPU- U D0FSV V40`V VV8 A! 0-1L M @!0 "#1P 00K1PS X1 X RD1P0100S S 0S$0S,0S4 U ꬻ!L!!!`8< 880 0-PPL@0 0SP <0 \]0^_  pPP00 -PLM@0 +0 -L M@`pA0 XPU- U !H!!P!!!P!V V A0 1p 0t``0 `0X`P0  0 8 8i@VV8 A! 0-1L M @!0 "#l1P 00K1PS 81 X R<1P010 R NR 0S$0SR,U |!!!!!!\ \ |0 p 0p9\00\\\\\ 0 p 0#!888 -LM0X'80 @0K<@ PP4P 78`,7pKpǏ  ! 0"\4]#8^Č_<Ȍ̌0C@P `Kp`K0t P 0 p p@0PK<T40  P< @40 p)pK K48$P84 m8888 -P@`Lp}>80  ,00,0P0$00 Q$!:(0SY W0(0,0|2@0S U) @0STL G  0   (2 R mB>2 R0 0ᒟ~W v@ @RD0W=D 0 D0@ D0 4P (0S@ @RD W=0 D04D0D @004V40  t 800 008 0P 0,0 0 0 03-t 0,0P0P0jPD cd(00(00q0  80R $qp8088T88 8 p-LM`@8P8P 8P R0000 0 R8P0 P80 $0P4@Tp>88 -L M0K ` pP@H W@ 00K0 !00@08080|0|  80806808 t0'08 HPPpDP@P< 4 08  :L0 18  p00p00嘀000@00000  =Pp!3i -PULp`@0d@TT@ D 0AZS@R.TPU8 :9,9BL|0 L0#|0 \rr0Ò 00 0 0SZ 0 0 0 0 < 0 0 0 0 Y= 0 |0| x0x t0t p0 4!x!!!!!!HА!L!ؓ!P!Dp!<$!8Ը!  M-LMR0P@  0* 0s- P JP00 00 0 0s   &0& &('Ġ''L;?@9: =>8`000K j0K 0@0K4PpU Y D R P 4@0  t;DP@U QHDng;@pfLq<00s<@0PK 048 0@x<p PK0@P`p,HdT 0P@pP K2S* .K|Z l4P nW nQ $4 ,0S , 0P2n 6n J1:K W> 03@ 540674 8<#̠#$#0 pppp(p)p*p+p,p-p.p/p0p1p2p3p4p5p6p7pK ( 8gH0H JXpYpZp[p ma  m0c 0 r0R 0 C0M 0 A0p"0 @ @ @@@@@@@@@ @ @@@p Vg0407PKQ 00@!@"@#@1P2P3P5P6P8@9@:@;@<@=@>@?@!1Hg 0!Xb m |1 p1P!@pP  mNm401 1 ,1@J1,K R\  P .KX m 0O1\.KL|dgedA8l8D 8888X 88h8 -LqM 3@K 0P, 0pPPyKW0P` 0eOP-K 0OP >K2S  hP00 S @B,0 S 4,剤 0NOD1  lP`b  0PY 0P 405 6478<s  KV >mh lPp6 Z1. :@0\ 7f(0) *4+8<S6S! 0"#48< 1cQ@\.f0 48<SN4 ft 0N0rDn 4i,|dgedA888l88D 88h8H8 -L8M@0Pp(0 @(Ÿ  0@Ÿ0 @O=P0P UPiPeP (0 S (庣LK$e 0RL0 M R<DDH0  9=8<:P>` ;? <L#/1S@P3O >0 @0 ߣPP`U(O- 0Ps `@@OM@70 0PsA0s0s< |dg8$808! P-Lp9 0 P3 O- 0`s& O]@P@OM@0 0`sA0s-:SH;S0sl! -L_Mdq0\$0 P`E \ $0 S ,$P 0SgK mgPP 1S@K agPP 1ScK UgP 4P|0 @p d\@d.>e`0S   RgP |dgL8 p-LM 0P ` H0@<04P5P\P`(`5p`! p-LMP(0S4`ph 0,0y5@4s5 -L M!p(KP@PZ K P0@ K0PD @1@!80| Kt0$ D $0@0$ H 0 8 0808 0680  p0pP p80<@8-8 ! 0"#48 < 0S0300 0-PPL@0 O0SP <0 \]0^_  pPP00 -PLM@0 f0 -L M@`pV30 XPU- U !\!!d!!!d!V V >30 1p 0t``0 `0X`P0  0 8 si3VV8 A! -1L M `!0 "#1@ \08K1@TS@ t1 @X RM1T018 R 0ER 0S,0SR"P !!!!!!\ \ 0 0p u0\\\\\@l婿T``Lp0LX @❿T0 p 0M88888 -LM4 0.<0 @0K@@ PP8P <`=吐KpǏ  ! 0"\4]#8^Č_<Ȍ̌0C@P `K†K0 @@0K$pK Po `@  $+4ᰀ H L0 14 8 PK`P0@`K4``` PpK 뀠KKPKP@ @  P0 造K`p@ :Q 0KPK R@QPKP`KpK Q`KPKK @K GpK`@0PU` P``pK` KpK0 p0KhPX`U lp\ W` K@0`0X@S dP\`U` K@04@P0 Ʉ0 刀 P`KpK 묀 8B"@$$PK†K  <`KB" @$$ K`P`P0p@0@pKY` pi9< 1X0S :0CSd0PoU@0P l SH \S@ p`Kp0ORQ@p0   `*P<)<9`K00 G L`K0@Tp~`P\@K U4p m d@Uf ˠ PK0`0`WPQ0OY`PXKP@KKPK 0pX K0 `ᜀPPKp p 18@Y 4`0`< `W 00@4 @D 04 0 0S S P4n08Y ` VXVS}`Kp@t0v@寽tP\@0 吐K 0 00 D0 堀K_ `鰐[@4d` P@PK PDP4l@PPpKp`0@TpD`Pd U9 lU2 \ U+ t@U$  I@D@@ PKˠ @PK0`40``PypPoY*X'p VX0VhV`VS`0K"T\@`K00 @_ˠ 頀K @鰐4d@?P9 K 0@Tp;`Pd0 U/ l U( \U! 3PK@@ˠ @PK0`40``P pPoYʺXX VhV`@VSꠐK鰠K \4 P <Pp <P` \@pPP @0 F吐K 頠KPK4\ @`pPK 4l @`PK PK @04d0pP0谠@@K \8 PxK@`@K l8 lPe@`ppKd8 uXPTh T`VXp@K68<P8 <0788888g888 -LM 0  0W-@0 @D08@T @T -L MP@0,0 `.0 80{㤐,0V0,0 PP dp0$00 Q$":(0S^ Z0(0,02@0S U* @0ST,0 ᗻ  0   X2 R0o.@2 R0 0Z @ @RD0W=D 0 D0@ D0 4P (0S@ @RD W=0D0 4D0D0@ 4]P4^40 ! ,t 8D800 008 1P 0,0 0 0 0~ x ,t "0,0P20P0cPD 0WPD Ph (00(00q0  <0F, $嵹p8088T88 8 p-LM`@8P8P 8P R0000 0 8P0 P80 $0P4@Tp傹88 -L M0K ` pYP@\ W\  0|!00@08080| |000K 808068080t 7800<0$1HPPpDP@P 4 08  :L0 1 p00p0 0堠 ᘐ S sP  bP   00 0008 @00000ePpD"3iB| 0 0# 0L|@-B0 |A 0  " L|gHH 0  0"00Q <0gg 1 0cgg-1 0 gg -p`@qLW   jbP82T3 ,2T 00S0 e`@ 0e/lZ\a01T 1T0S 0j0S e/c0S00L1T/ @1T00 0"  10S0S  0  âP0T 0%4400 0 ;|0S0S0S S mz mY0S 0 0ymdgr @sd edArdAr hdk~gd" -LM`@ePpY<(00p04S80,0d080 4p00 , 07><4wtO&(0("4400$ 0 0 i{88WEV" 0-D0P @L 0aP 0000P0: -LM0s@S* 00 0000 - qL`PU  0 P6PU ,00D0,0Ht0 P:80 U*@O*80<;8080 `\ @1@!0 P [PH00dH0 P /\:8 -LMa1@T  P$ /0T0(0T*0T  0 S 0pK 0A^P@^PlP  sTL0T @0T<040T ,0|dg'B$B %B#B B8&B( B(B "BP!Bp 0- L@P3_P0  0S@ P0 0: 0-T0L PR 0U@ T 0T000@_: 0-D0L@PT P @T00:(00S S0S: -0L  p-LMPK@` 10C T#J0QZ0V0T00S p -0LMSK"*K 0SB$:  -T LM@HT00  (0R  ::$g8 00 : -Lp`P7@T@ h R(( `@ pp00 88: -l`L@PTp P 0S `@T$hѵ0T0 h:8 p-T0LM@PT` P 0S @Tpp: -LM@h 0-pPL0S`0@T P@T00020#J:: 0-XPL0S H0@T P@T000 .:: p-LMP60@`TL  (`0#pJp8 -LM@ h- -LMx@0Slh0d.@T BLP0 @@ !0 N,@T:(8<889X8h$,9 -LM@$h 0-rL@P@ 0hP P0 ,  0PQ 0Q:0: -L P00@-SP@  0P PR  0S0P 0P 0 -LM@Q孴 0Sh8 -LM$0p@$0 P`y Pq P $0S $嬔T` PK PW PS  @T P 0@ \  0K0  D1D! <1 R41(1 !^ P! W @KKKP00  00`` L P E 00 0ZK1P9 PKdx tp 0,0 `K |dg8p84g$g$g:$g$g|8888 fQ2(h$ fQ/h$]h$ fQ(h$ p-@`LM @fRPPT  (@Tpgh$ 0fQgh$& 0fQ~$gh$$& fQ/h$ fQ0h$ fQ(h$0 R 娳gp98y Ꮿh$Q0 a3ih$Ih$ h$0 :: -0LP4M 0X 0T@K@Jtt0 Rh@c P`00Tj7 LL00 R 0X  ]$g$g$g$g$g:,948:: P-LK_ 0Ptp:$g -LhMTa0lK 0 3P@<B lp: P, O ThK01@ TX0T 0 P0L 0 H0D 0 hK@ <K0@  0S 'hKP@dPK  P  T@P P8 , P|dg<8p9L8X8l88 - L -LI -I L -L H -LH -L X -`LQ 0R 0 PS00U@ h< p P 000T@"0@S 0U* ga0 -LMh$ -LM@, p  z `P4` 0S !g1(S! 0#!!0 V000 8` <` <P0SI <0000S`30  4 8<0(0 Q8 <0 ZY  !Y *040S R:  0 p ,0 d <000}P0 `P 0 11` R0040  88888888$8P8 - ` 3p11#XLP@0XS (P@P 3X0011 8 -LpPPP T*0 S@T: P p@-PP\`@ *0S \:T p0Q:0cS*S @V V 0#2 0S "" T @ 0#2 0#2 @ p-RLM@`P uP000U00p -L MP_P T*`0 S ` 000CS9"9"9"9"+00 <0 @ @T:`*0&0/0lc 0-L@\Px $t@ 0h_ : -L4M8#0Z,0 PL LJ0P0 L p@ TP`A HKP I0D1S3;";";";";";";";";";";";";";";";";";";";";";";";";";"<"4<";";";"\<"h<";";"t<";";"<";";"<"<";"=";";"8=";"T="pP@TZZ!0, PR ,ǐPᙰ : 0@^S||P . `Ppp     0 i  R 0BP ^SS    l  0D i <680PC|dg$gd8p89|888888h$8$g 0-L(MdQ0\0 T1P10 a0CS>">">">">">">">">">">">">">">">">">">">"?">">"$?">"0?" & 0S 0 0A^S  4K0 @@TPL4K0@|dg:h$,989|888p:88 -LM @ 尯hh$8R- R 0S0 \R000Sa@\ 0-LMP* P@KP偯0@vP KqP00 zP s0 0  0%0 K]PheP TPPPP 8<PP (P 88|884g 9x88: -L@PT`p@Dt @ PP TP@Dt0P$g$g -LM@ P2 P0( P) P0" P0 P0 P P P  P p`} P 40, P 5g$g$g$g8$g4g8 -LM@P P hPP  dgP 00c0\8 -LMp KP0@ PS@6$`KzP. T $0   $PU! T T @X 0 0@ PS@ P } 00 X  X $P P(88 p-L M`KPp]0@S@ PKPT T K 0 K 0C0 J0@S@@008 p-L M`KPp20@S@ PKPh `RT002320 0@S@00 888 -,0LM @Rh</X(b 00Cs0 -@L`0 SpP 00L S0 @0V0 0S0 S@P 0 a0CSa0RS-P@忭a@0a S_R@ zTh鳭l77P8T8 -L4M0 sS, `@HKTK  y a0@S0a SR0S 0S0S\ + a AL00lL0 V L0SZ00V00S 0S + a0BS aB0SVQ000 Qj1 SV@xq fO0PS`LK0 PBTU@P !0001 ,0S ,P&pX T KT@  T0cP T K0T0  0X PU0:S000 S 0a0CS0000S _0a0B`F|00C ZSQ|dg$g$gX8ؕ:l8F" 0-@QLPJ @TZ0 0-@QLPJ @TZ0 Q-LPp`@00eT : 0c00e000 00eT:p00e0|4g4g p-LM<@<`04Pc0c000p|4g4g4g 0@-L~SlN"4N"0T"N"N"O"0T"T"0T"dO"DO"0T"dO"P"0T"Q"0T"4S"0T"|S"S"0T"S"0T"0T"0T"0T"0T"0T"0T"0T"0T"0T"0T"0T"0T"0T"0T"0T"0T"0T"0T"0T"0T"0T"0T"0T"0T"0T"0T"0T"0T"0T"0T"0T"0T"0T"0T"0T"0T"0T"0T"0T"0T"0T"0T"0T"0T"0T"0T"0T"0T"0T"0T"0T"0T"0T"0T"0T"0T"0T"0T"0T"0T"0T"0T"0T"0T"0T"0T"0T"0T"0T"0T"0T"0T"0T"0T"0T"0T"0T"0T"0T"0T"0T"0T"0T"0T"0T"0T"0T"0T"0T"0T"0T"0T"0T"0T"0T"0T"0T"0T"0T"0T"0T"0T"T"F&0S 00C0|V|f 0R 0 0CS0@6D&0Q3*V 0@R*0 0 0S0@:E5 Q* 005%0S*cUE 0Rtet# Qle deR00 PuP0 0 S0pP0  0 0 0dؤ^% 0S  0弄Rt00Q^ 0S 0^h4 0S00$T(d0 S D0 R 00Q300 S0QB ăs0 G0Qp3#0Qpcp dcd00 R 0 H P0 R 3 0c-Rs0b0CS5005@G200 050 ̂%@G"S 00CS0050005 0S RK0 dR 0 0DbR <p00 R 0  P0 R0a 0R С p A1Q`1 bp!hA0 0R:0RR0B B  0S 0S Qa 0R0R S  0R0R S0 Q 0@^S}P0Q0Q0A Q 0 00b 0c0c0 0QWu|4g4g4g:::$g:$gx8x4g -P@L@PpP`P0P @D@PPP# P  000c4g4gx4g|4g -8@LMxP00  0@5g5g4g0 005g4g5g8 04S00 0 0S405ᬕ:4g5g0ᬕ:0ᰕ: -$ L0S 00 鰕: -L 000鰕:: -L!0@]S@t T !0@]S@00D SA Da0DSR\T_T3\TS( @SA @a0@SR@0@\T 3@U[@t TS_P Q:P00\P0S0p P@$=0?Sb@Y"Y"Y"Y"Y"Y"Y"Y"Y"Y"Y"Y"Y"Y"Y"Y"Y"Y"Y"Y"Y"Y"Y"Y"Y"Y"Y"Y"Y"Y"Y"Y"Y"Y"HY"PY"XY"`Y"hY"Y"Y"pY"xY"Y"8Y"Y"Y"Y"Y"Y"Y"Y"Y"Y"Y"Y"Y"Y"Y"Y"Y"Y"Y"Z"    .P@ -&:<P@  >P@0T,1pP, a00/TU# 9T0pD UA DA Da0DSR `TWpD@T7pD0s" @00DR Sa0D_TS7ToPOPP tPTP P xPXPP@(0P4g4g5g|888̕:5g8 -LM||`P0Ulp@ S0T UPe PUP0U00 P꼕::: 0-@PLP 0Sn cP  P h 00C0\@P n 0SU00h!0 qPP8:8 0-H1L0@S4!0CQF!0D]S& T T T T 00h= 00000P@R00, 0 0 0n p@x0 0 S 0CRL000  (00  yĕ:::::ȕ:0ᴕ: 0 0 lQ ȕ::,9 -LMS@ \00S SL L0L L0P 0^0?l 0& 0̕:88 8(80888 p-LMP@PLU` phا8`է0 ,$0̧Pplc@8d8$98 -L4M4q44A0 T, 3*LKH`KPKTKP K 0L   哧 Lx T @Q 0P \ L0\ ~P\ 0pu0T:`0H<0 ,0S D,則 f(`b|dgb88:8,9`2i88 -PL`%HpP@ 00CS 0} @TR@0Sq Sf SZ 0S 0S 00 4 S 1!0S 2!8S  1Q- 2!8S( 1 RT T U h1Q 2\!8S UP!000@1@,1@@DT$@DT+  00CS0 00CS0ڸ0 RΦʦ00  0 00Sv h00S 0So P00S 0Sh Hpf5g5g5g5g8 :,95g8ԕ:Е: -LMp0@SSHP S 0S iX 0  Pi/ T`0 Q00 28 6S Q 0005g5g 0S00l5gP0pQr  8 80, ,0 05g5g5g$g5g5g5gD0<08 pQ(0 05g5g5g$g5g5g-L0H D0pQ, ,0 05g5g5g$g5g5g5g 80cR   (0 0 05g5g$g5g5g p-LMHP@  D T h0\ `` T` T0V D0\ P^00pP W0Е:ԕ: 0-@@L08PS0S0a00]00ԕ:Е: - 0L@TT xP\ lp`bXd0 4P 0S<00h鐥p h鉥,Ei:(:5g888 0-\L@P 2S P(^0P2 00ؕ:8 p-LM`P`@2S@T<phA걾PT0"2 000pؕ:8 -LM@ K;40S0:00A0 R0   lc p-LM`@PᄾP  0S  pxP   -LM@ P0K  0 -0 SLP` :S0 `0SZ @ p2bS@TP t0`0`p0@2S @T:0T0 P0$f(Pؕ:5g08 -LMP`@V 0FS \o霤P o闤]p0S  S\PL8P8 -L M0PS` :S0 `0SY @0P , 0`K p R2S@TP` xW0`p0@2S @T:0T0 P0(궽Pؕ:X8k"08 -0LM pR K >TP@`2S@PT P Wp 0:ؕ: -0L Mt`, p0 @–R\ ,0K@T00 ,0 S1051P55gؕ: -PLPM`\p 0K@  0SV 0005g -L1L`MD0 PP(0 `pl KpKt KpP 1l R*t0S@hK 0@@ (0S (彃l RW xK| K0P x| P@hK0@@ 4:|dg8:p:l8x88 0-LM(P@ 0@?05g-00 C5g -L\ 5g - 0L0S 5g -L\   5g -L\5g -LM$@T5g -L\ 5g -0L0S5g -LAP MK!P 0Q)0SH0@0!0 R0 RGx3PxʢtȢlŢd X0L庢HH0 @崢`2i5g88$g(bg8 8,9h$985g5g8 p-LM`P FpP@0T:tPt@0T*dP 0 @T:@p0P 0 @T:8:<:bb4g -LM@KP -LM KPK -0 SL 0  -L \   00 -L M6PhKP . P(@KP &P,888R0 0 0  -T LM@HT 00  (0R ꐗ::;g8 0 0ᐗ: P-PL` @T pP 0S @TP@ 0P0`0 000 $m鸡0S8::88 -p`L@PTp P 0S0W: ` @Th铡 00hꔗ:8 0-LMl@0S`0h遡XPU @P@D ,, @o PU0锗:8 889(8 -LM@zh 0-LMPKOP@@pj h0 0-pPL0S`00S @.0 . 0 @T0000鈗::0 ሗ: -0LM@`TPp P 0.S 0U:R0>0>0Up1 @TW 0@锗:: -lL4M 0hR,0 0PP0 ` LRH bR` (`LKHKp 0S! t@P   0 p彠0L  p峠L sPP0S h0h fP<,0 S D,往8F`lR|dg<8h$L8T8$g$g\8l8 -LMQ@` @h00CS|"|"|"|"|"P}"l}"t}"p 0jh-LHD@1 R4 0 Ú<3 \$s  Py50<U!<30?ӏ1 ("P  Q !B0R0?`p0 pc 0"0T 0p 1 0 0#0T&8#0&lT #0T 0p 0"0Tl 00("QT 0 80k  R{5;5RNR8 -L MR袐`@  0@ 0"B0 T0  @ # $1 )Ru  0@ 0"0 T @ 0 1!|Ö0H#c\DQ , K D+[0[^0'0c "*$1/0a0` 0 A S0AĀ \!p0^:ڏ0^* L("(@+ [ 00C0Q0և#0C0 T0)S{ 0 H0P@ L, Kjf8 -L MlrP袘8`@  0@_ 0"0 T  0@ # $  0# T40  #$ 0 #T#  0T  3 RT F 0P@ 3S7 H  0  0"0 T 0  # $(# $,# $0# $0P@ # $, ~ # $ ,P, 0P@ ,0@  !00C0| B0R0?0à 0  0"0T 0 1 0 0#0T0# 80T0!< #T  0  0"0Th ?(P0"P"# $ 0@NR -PL@p d1T`: -P1T 8 0d`4V 5@`6P`505 0S '$8S0T 0T/0lj%A0@S S  ^P`5@05mi i 5i 6i( -(LM"(@_pW8 D`P0@\  iewP@0  -5L,p`0 <5 00 R0 R`RU@ P5<5 C0S ^g 0  U@P5 <500 R -(L"hPp80% V0`P@ V1T$ UP! PÚ\   0 0e8#h fPP@  0c0 000C b b(0"X; [1 [ -LM@rbD3<#00D3PU<# $D3PU< n8 -LMRr` $ $ $`@ $@D@ -LM8#x@3@TP 0b  0pD @@lH$H@ @dHDHÕ$x@ -LMQ@Pr`  \0 P `t@T -LMl3@S3S0l30S L8 -LMl3@S 3S0l3 0-@L3S8PQie(X0 -L  p-LM9@@?0”PP"0`T2#$$0 0”"0Tp#00” #$@ 06 -9/P@0B``L"0T•"0T2#$ ?00S S•0#T2 #$ 0•@0 #TB"0T•"0T -LP0 T2 $2@ @$@T# T p• 0_Th h0gd`@ 0@gThgT T$p0@#ppx"":#G-AzMB 0 0Cjj0V` f3Ά⼀ f bʠ srʠ 0 P * @* !0# 0# 0#0#0#p'4 1J1# 00 z0Ѝ0>g7 -!LM 0,0  m0SV KM R xK*Ml!`0 R1CT!0#0 00b0 <KK!N8 [<0[ 7 [1[ 6 [9@[ 5 [0[ - [2[0# 3p[ "  @$" ;[:[.[/[娐 4`[" <0K0,.P"<K 80K;K:K9@K7K6K5PKL8d 0R 00 KX:8<K780 ,0S ,=v|dg$>g<>g0>gh8 -@3LM0c BPPvß#03QB" QQ2 2 p0 P@ 0K j 00 ,*A4 00cabP`^n\lP P ,88S  \4  40@040 4 @ 4  40@040 4  4 40!040 0 0bC2S0c0S4 P1Q40SG pp0l R0+A"R Q> P4 L 00  p:#04 0qcp=<0 8p @? ?C4``@0 @0 P``p8@0S<0 0S x 0t0*qH@0D s   4 ;gPbg:Pbg:g$g g::Pbg cg 0-LPKQ 0,g$g g ga0 -LMTpPP?H` KD '@0 L $>g<gbg<gbg<g|gcg 0-1Ls@PP sHPD0 080808<00(0@0H^gcg:0>g$>gЗ: -LM@TP 0S00  Q0 0 0S00h$>gcg< 0 0P -LM@TP 0S00  Q0 0 0S00h$>gH^g - hh&4Lp5 0S  ;0PS &40CSX0  ~; S:#8#H TP 08#H$X0Scg -LM`P&(@1t1pUS 9d1U& X1U p(!DP p;1pT1UDP,.4DP0 ?R#p0p0U :00SDPL@D 00S080 0 R@R R $>g0>gR $T \0   0 0<0Spp 0pp83@0P00K P00@P00`0 /0  0P 48<@hP0O, 4`1Sl 0 0 R[040 4 G4 4PL0PG9#6!,4 RT"H"T"""T"T"8"T",-,x(,X1` @_R 80S80080,1 ,00,P@ ,0 ,0!,00,,,@ @KI 0a4K/# %,dC5X08AT70P!p W+ A 00@K/@1P@0 P@0 0S &,>0P0 dF,00dY ,(PS,"<80PTdgt8t:Pdgg8888 0000p   0- @ P L@ P00 4 0 0 D0s 0s 0s(0s00s0s0 s 400CSH""""H"""0s -L M0 @40 !@ -LDM d 吀p0x@0 (P 9:#:0)0 0 0 8 h`  @ 0h@ H0 h@ h0d40 S 0D@0 L0$0 d@400,`0Kl PP KX0 @0l@X0K8KH \ D < 00 4 ,P `@ T @ PlH0h;c@h, -LLMP4 0 0 S8 400H0 0S80 0< 04 0h`\0 X H<00 @4p< 0L X LP 0bV01QD @0 OTS@ \0@0 QA 0 L0,@K@P\,L H0@@0cS@1U)D0P4 xE<D 0SP 408 h0R ,U40ST`HX 0R, 80080R  K+`P T ` T<0@_   X0S8 h0S T @`  PT 0<` 0Q1`P0 ̃T,K P0L0dPP+PfE -PL0@ Qp`:@#R D3S`D3@#0CD30  DP?< p-<1LM@\`0=S`L RB?   BR R3 P0S&0S V0/0000 ?2΄ !B00/$p?` `! P2 BPNP  -LLM4  000 8  < <@40@PH@ e*4`$0 Sx$x40SL P @P0TP <3ʯTPX H@(3`p`8`@ Kh0@0 R*HP`K`` ``K`0@P 0P0K08>Pp0P0P`UD<H`0 @/0@`S:(3D S:Y<`1S% Y4 R YD3L@0c04PP` `0P XT 4<3 0l* Pe*|2 Ut< @0\@ TnDŸ 0!0Ug0_t0/<`1S@ _,ߚ\0 0S# < `1 S000 l *0K!tA*0[0^ l0 4 Pp ^PU \e*!l!P2@0P8 Y 400 00U \F*80!l!1@Ye0P 400 0 0 , 0 0 0>.0 N^@PT \*l81 @e00  0000  \*!l!0@0P8Y 4 00,00S0c,00, a08 c@$#%#&# p-L$M@P0`   K 0`P0Sp -LsMf q, D  ! 1 儀 |p KXPPȁ ́ @40S P10Pş,0 S |,]!0 0 gPPP0$ a00 GPP`@K 40PPP5[S Pq00 X 1&C[ B%D 0@jPP#[ P q2Spq qWy  00CL1aR ! DijK10. $ioK! 10>0>0S0b1 @2R>222>3031 50pq  p000 #O0 'P0000$``p`Ƞp!k?K pPt $0l 1jK!0Q! !  .a bq00C D1aS#[pWq @ 20CS2| #0 #0 #0 #0 #0 #Q3 aq0 pb@nK mK >KPpH^5: 0^*  b 00b!$11 0#[1 a`Va >!0p1 &!$k?Kp` }P|q P$0&_0>0jK1 a  c. . i?K!`#[ a |dgP8G8 -L4M 0PL @ 0 )K3SpH P GP10C8S1@ RBB b$D  @D0@'P01 1"`WD@0SW0 S*tp @0 P"`V @1S 3 41@04  0 h3@.P HC`0S 0K)K 0@ `1SPP)0[@402`VD@G 8 < 00CS9#h#h#h###P R0 H0T4  H0 0b40 40K 8K0>01! 1s8 40 !1 4!Q80%000 0a00b 155 1%W huD#0 L HQW P $SH0SH@ xg :`8: -LLM@Q@D1U d0 ` 8d0K00"pW #tPp@ `K #t0`0 0<X0 \ 0P0 T 0H0 L :D0 @ 080 04p < 00 0$p (p ,0 pxg0S -L MBpBP ,0 "` 0@P@"@2V*0S @T:@W O#L# 0 PP: "p  0P@0 S 0R , tP -"LtMp"0K, `SPP0 K PPv`@K4   O%K(p4K[ 0D K RKYPKXPKHP @P q(1! 0(1,D0 001@  D0 100 (10(1 00(1O 04qY ` P ?0S ?200 01$ `w,HKk8:xg8 p-LM@P0c0? DAd`A  0P?`p p-LMPU`% *@0 PR@ U: @0\0 ?00@p -LM0PUp*` @0 0000 P00X0#02SP` -LM PR@0:#:S(0:#:S#j&jV Pp $@ Ȍ qΌP00 ``fP@0  -LMp. .\@0  `P`$@ @7P@0`P 0  00P 0R  $ . .  -LM@. .\ 0P p`@@ ȌqΌ$  p-1!LM1!0@ 00>0>0^`P 1.*!n!00`G/ 0B!0b0!P PPP0^*!n!00` 10G?  B0 P0PPp&# -4別LDM0%QW3ouaWD뛢;!뇎y T` 00 ``  pp0`S0 0 0$ß 80 < R0< @0 @ 0S00 0#0D`0H  !0 ',0  !@383 415 ( | P Pp P0@'0 p/2 (00f 00PU0"2P@@0@A QC@Q0@0pǏPK P2PK@DbFPFPp00 0ֹ `P@`*1@@@_1$ > 0@!;!A@+FGTl*S28(0S P0Sb@ᄠ3H@K 8!P11PU aT0 P P`P0S @0  G0S7W800S P? s3i47p9fgPhgggdg"h:8`N$0i$\dghhgdg :hg4 ihghgfg6i3iȍ:|dgxdg0#8g8:8dc8gpg8HhggA/88 8,3#(8483#<8L8 3#T8`8C/8lg:fgl8fgx8llP $09$00 P@ p 0l Y0 @ 0 0 0 @HZ 00H@@Zt DD1 ~PP~X1X vPdvl1l nPxn1 fPf1 ^P^WPKHP K@"`@$y1@@61@H!0EFC P K -@ LHM0, X 00 TK0P0 T ( NP0 S$ yswsDc888 -L0S@ R000  00C0=d@4K$<@K@㶒K0 㸒K,0 S( p,@0 <,0Sʩjgig8 -L M0P{P@@ R;,0p`0,0,0K$p4KqKp`#02K"K 090 00 0  nP,0( 0C,0,%>PprK0 900-  (("` -LMŸ@0p \`P 7 R `0R Pl U. U  00S# 0s 0P  00 0101 1s 0Wp1 21   P1 1  0Q P 10 1 1s 0 W 0pV ` 1s 1 2 1 V1 211 21 3i p-LMP@` T0 @ TpK -PL(p`@0T :0@T  0-@MLDPD 0<P a, (@0P@a0D:8jg8xkg -4 L014 s$ 08000ᄪ:40$ 0S00 Q0 0 0S0040$ Q  0-L@>PP( 0 0R  0P P14P 01  00 0  10 A0 000  03i(04  1S0 1 Q0 0 0S00 p-LM,P"@000R R 0Spd,Kf 1:0$2K1,` 2K$P  8P000(0!0 (0p -L M( 0 0@ 0(  1K 0 D0ϠAl2l1!Bb!!  <CMb p- L M0`S K 0 0 0ϠAl2l1!Bb!!  1P 01 >0@ CC<@0pȪ:Ī:MbP^# -LM<@^D 00C0Ī: P0 0 p-L MK` KP@T0 p0  000x`@0$  00S0@P(00(0 ,00C,0(0,0;jgh: -L$M`8 P 0S ,00,0P^P$< B @ P !!@4 PP?4p P" @0 :0GPUp  0<S< ' 90 P (  0 0 B 0 4@ W 0l !S <Q8 P 0 4K 408P0,0( 0C,0,Y;0@K x PP@ -LM0pS,p @`PsJ ,3Y 0S8P < !4!0QU 8C(0Q PU 0v v UB 0,0 0 0$0 80` P (00(0*   (0  (0W  #, (0` R0(0   (00(0 _PP( W`4p8 ,0( 0C,00p,0 0 p p00eP,   ,: 0,0  80  0Vq1RnU rmPp ,0 0 ,0 00R]*40QUY 0V PUR!0S ̪:xkg -LlM Q$P  S% 4 P,/A#bl p p@K \0 0  % @Pip T4RL$002c2c30 xK; t0p$x0P 0p 0 =9@ =C  0p 0pS`XQ#0#00F0\8YAp0Sl0S x@K:xp0\0 p KK| 0cPl=9 A = | |0 2R"002c2c30 v Z0  h0  !! v l t0Sy #Y ` 0X\0  h0K0`0K0 @hK R 0 0 00  0T m (   ( 00C0X` R\0\0 00` \0 @1G 0`01 ' 0 (0 0(0 00C0ZH" "   Yp ` 00 0 @(  ( 00C0800 E p80 P(00(0  B  X, Z ⌐ p l MbQ:?B8 -LM0 @$P`A@p 0 S gx000 p-LMP$`p08O*0 H0p -LM0, X$p4 1@`T 0WP`/ U@0X8Q q < 1@`T 0WP` U@80X:le^,0$80H[^P4,00,08  4 L^Pjgxkg -LM0@  t h hw 80 0-@LTP 80 P (00(0 @T0 p-LM@`TP 80 K@Tp 4  -8 L0pS`( 00Q@LT I 0 P!40`4P 0@4P40Q000p(0 8\ 0< #4# 0Q80 @&8< 0-80P@Q08#4#04 < 0!0LS0  Q0 0 0S00(080 R40h]40,  , 4 xkg 0-@L Pu00  0@(00(0   e0h 0-@L P\ R 0 0 00  0 (  ( 00C00hJP(0 0 (0!P -L$M`"0$0( PP@4pW@ W @4h$]0 0 P@P0$0!0@;00 0 P@1 I 0 0P@ B 0 @p 0,KP@/, 0@0b 001 Y$$q0S  p*0TYT$1 !S@#@3R 0! $0S: 0S* @T  0 4`\P41< (1TP#2@0T00S Dxg:: -LM0D H" L P0  !0 0 !D"LK0? p1 1 Q Q Q 匡 0˟l1 h! n?K `1 \! >K/K KT1 l < dQ 0P 8P XQ HP Pp`:H0P @ D0PS R   R00? 0SD? H00H0 D"`Vp H0#K`P2 Pd7 42 Pp?K` 0"R? 4"@ P42p@ ?WpWK+H0*0Q$8PL" 0p` 9P'e?l 0  !0 0 ! [0@ H0 D"0`T2 V 7  42 7Pp?K`0"R T" T" 4"P42p@P2Pd DX0 @R T"0<  P"0100b0P 0S42 p !P0 Fh0$P 0d0K>0#60`00\ 0. "&0 P0>0#60X  T00Pp~42OKcT2( 2 K P2<$Po = PPi ' 4|1S0# 42 >42  0> Pp pp @!0!!0 0)0 !!0 w QZ 0  !0 0 !2 0  !0 0 !0  0 000 v%P'rtZL"p 0Cz C<,0S KPD< H2 K( <P800 1?l 41S L R < S <H0 7  @0S@0[70D0S40  !0 0 !K < l?  0  !0 0 ! |@=0 0000 0 0  0\`j VPL 0 !0 ',0  ! L@2  0 202 0`  20082 0S/KK 82 4 VPpH;̧ KPpD 0Q @ Pp#H@"@00@082帀8"0082@"82$ 8(00(08",00C,08(0,`VźK4< 8t@\![0Q8P ,YL"p 0!P'S;Y< 8N0Q 0Q0Q0!!0 0'0 !!0!!0 0 0 !!L3xbD00C Xdgh:bxg:N: -LMp$K4 ,@P  `@u PT4(  01 B10R,0 P@( ,K `Q'00K@8,P4( 0,0 B0RP,0 ( 4K  FP@"`V@J,K ;Q'00K@,P0 ,0`V0P,0 Z  %@P  -LM80H@pN@nW`NP0` `@ ,<@.$@0@O p` @@ P@ K댐@ָ(K0 @0t !0 pp Pp 4, ,00, 0 @彸 : -L  -LM80@S$ !$ b] R 0000 0 0 DWP0  !!0 0*0  !!0 0 1!); &; #;8 P0Sw   < 0R50@0@0@0 Q 0 0 0S0 0 0@XP U @`2Pp00 ?WP00 "[S? PH P0  PH0Ctt0 C00LPLP00 1X0S 41L0ST!000厢@\p20!!0 0+0 !! 2P |0S P00008xxPfP T  0  !!0 0 0  !!L/2C(,84ggxdg4 i8 0-@P@L80< S<00@ @@P0h2:: p-LM@T < R@0@0@0 00+050,0S RL,L1P` 0`\0@T :: 8 -LM0S8!P0`0c00 X@T p0 P@T^ 00"/P @ q 80S 81a R _ ,0S 5\= \   0!!0 0%0 !!8 Q1 K0     0!!0 0*0 !!8 Q S/0 K400 800Q  Q PH PS? K  P ,0Sx8 p-LM\0PS@ q `V 0!!0 0+0 !! \ ,Qph 1l0l  $R$ #l S? PH phL0-SXL0P QP 0,0RT0T0T0 X RP X0TXLTxdg -LM@P VP<  R 0 0 0 PPT0T0T 0 P$ 00CS0 `V 00C00 00CS0 HNV0 0,EV$**4gg:`gg -LM00@ h韀U -LM8@ $0 @@@S# -LM 0 A -LM  t  \ \  @@    )- 0  0\$  0-@LP@T  00 @@  00 0`g - L$M`p0  = S 0\X X8@0T0 @Q00SQ $$6P#CZ00T   t0S: p0S* 0#0C07 07P,  T0P00,p5\^EE, ]|< 70 70 0 !0 0 0  !!4 0 !0 0 0  !!@TT0  (0 0 000Px sn 0 b0 00081 Q 00 0  !0 0 ! 8 0  !0 0 !@L` 0  !0 0 !l 0 X0l  41H0S0, @S@#T@0 P@倿  l6  g6< $ 0 0000  00  <QDDDp@$0S 67cA Pğ0 R800 0 C8 P 1<0S !<0@0 0Q80 X0!P@ D P0T0X0RT0PD0XPH000D  D H DP L L80R\0<Q 00000 80 0800 :@ ~/2 5 ,00'0P*Cv 8Cl"80Q00000000 RP80S 004\ 00 P8 00 #0 !,00 ƒ67c@W* J0 C H0 0000  0 0 0000  # 0 0 000  _(@<O>0I%0 [::mc:D8:g`N$0i$g13#4#@lg0^ÃVPŃ. B&, !0, 00 GP@+ 0 0cC61 U` ,0Ų0 0 e R0 e Q @0000(10T00S # 0$0g(:888g:lglg8 - @0 0cC61 `BL!bQ`p T 0 S0``00`m 0&a lglg8g:@-TT0P@SH0ɠ ?#/0B!S 0R !R %5:: :@b -LMp|`00 Kl !@6$ K@LPP @ 4$@0@c0::mc:lg,glg -L0à  0Pb  1P1 -0L8 -LM0@ ;Ph? -<0LM   @)0Sh,3i -LM0@ CPhp -LM @ Ph`0S00 00 -0L88!M11p *`@0 PP0S )@ @ 0@ 8PK0R<0 " 0(< P(Y @0 #6)P (73i p-LM@P`@V0D  Ppph) -0L, (0  RS 83i48 -0L  0 SX8 -0LSSl8 -LM00 3`0 P0Q&Q< , 40 0 80@80080 0L`<0404 80 Sl 08 a R` 00t 0D @ 8@$;D P 0S8D0 D DpR00P4 P80;<80<,080@ H 80080_P4 o80  <ZD A 0l   0 l\Z 0S 800S80 80<70Q@80 80 80580(.0P '80  805800$ '80SPJ3i|88 0-LX$P tM@P000$g!Ce -LM0@ShBNd$gD0S8D0 p-L MQ/A`"1) ``@tA?#)h1 @PQ?# D1@)00!S 0SRP A  0U@@L 0@@L 0H@@ L 0P@@L 0@@K 00@@K| x0@`Kp:ggggXggg\gX8D:l8gt8`g84g8tg8g8 g8g p-0LM 0 !@PT` 0S @T) @T 0S @TP0S00`pT )mpTg\g -LM@ 00S 0R8P 80SLP<0 40 P 80 S<Pᨆgg<0 40 P 0 SPXgg -LM@p`PP4 81P' V &M#M  8D RH0H0H0 80S 8Q0SD0 D0H00@H0qV LLHL8P P LV LVP3 0  81 0  !0 0 ! `|00! R00!p00q 0 1081 000 ggXgg -LMD @RH0H0H0 80S 081 -LM 0@ `R x0S0x0 R000 00CS0 htL rL gg -L0P8LQ@p ` 0S X@T 8Q 0S P@T500CSW00000CS0 R00000CS0 -LM@T  50S D@T@R JGD@T -LM5 `NP,@Kp0 @:08 0> 0 0 @$ t @ l2Lp p@000P<Q07988"!8 8(8QD8|8 -LM0 Sn0Lr0 R 0R  R RmPPx 2nP@h _aPU T 50LPS 18 T *oQ0nS& aS @0*T00S1@T@1$l UQwSx0S4! P((08!5U8`P000x R 0S΄ 0 (Q 0 QwP 0d 0 Q| QxQtQpmQ8g3i8g898888888$8D8L8\8h8p8x888888848080L800800 0-LQ@P 80Q P 881 R 0008 0-LQ@P 80Q fP 881  Q 0 0P 8000080000007000 000 0-0L0\0P   0@\!:tP@0 -LM@IptI818 PR `V0  0XJ$UJ8800 gg -PLU`@@\ITp7 80T4 P@ P@-J881  Q @00  @ 0 R U8P 80U 0hP 81  Q8@鴆g -L0P` Q@p pT  `X  WV  -LMP0u@` 0U] u 0U 0 U 0U HPKv 0V 0 V 0V 7P:w 0W 0 W 0W &P)u U 0a0 Pv 0V 9`w 0Wp0  !0 0 !v 0 Vw 0W -L0P`Q  @p FpT  >`X  7WV  -LMP0u@N 0UK u 0U 0 U 0U P9v 0V 0 V 0V P(w 0W 0 W 0W Pu Pv `wp0  !0 0 !v 0 Vw 0W 0-LMP0|@  0\   K0~P U00 0 U 0-LMP0|@  0\   K0~P U00 0 U p-LM0@P`0S 5 T 0T 0T P'0T P T 0a0@@0@  !0 0 !p R0Sp p-LM0P@` 0S 0U 0U P 0P  !0 0 !p p-LM0`P@0S + T 0T 0T P0T P @@0@  !0 0 !p R0Sp p-LM0P@` 0S 0U 0U OP t0P  !0 0 !p -0Lp`@/PPUQ!P P0!!0 0,0 !! 0 R*0SR:0 00S 000 NP -LsF00tg 00CS0IGtg 0-0LSP P @r000 0-L@P Pc000 0R0 81  0-LP@P0 08 G?P00  0"R   0-L0QP)@3 Q 0P P0@ )T 0D000~Q^0 000P 0 0S P 0T@P8 P ( 0DT@PcP"g -LM0SP`p7 S P@ T  >+@S0S0 000@T 0 0S @TW pP8 @T   D@Tp Pꬆg p-LM0P0@^ `V 0 0^ V0 p\0T@ T@@ TP 0$0 @#@.0" p-LM0(@KP `P0  p0 -QL MPJ`, 0 p R  0R0S  0R qP-`@0Sڐ0V 0JSH#######\10S0S0P 0RZ   Q0 PQ0ba>0>0$ 00ab0P`0LP0 /@000C0 0, p0:8:: :\ 0 ^ -L$M@ , 0 40 X0 @@0KN@K@0 0 @0@0 ,@4 00R000 001@K\1  0OH PKL 0S@#-Q QPn`3% 腒. pဒ0@R/ ၒ"M2 0S @##mSPU`!q p0奎 @K3' b ],@  ^4X 8< @K@KP à ]C@TPa`~ pà &9@K( 44@@K 5@Big: 0-LP| 0\ @ IH 0h0 0H@0@- @P0P=9@ =C 0 0P=9@ =C0 0 S  0 \00Z0?B p-L Mp`@PT 0X LC@ X0 0 pPvB00mcg8D: 00CS0GDg p-LMP`@ T0QX0T@ ZH@XAphd,# -LM8@L ,0,P000 Hmc8#8 -LMxq ` P`N050堀@0  !0 0 !+GX1S"1T1SP0T1S /0!! 0  !!# Ƽ0P50*ῼX!R <Q@0@0@0X!RX1S3ig 0-LPM@KQ0 0aS0  `=9 = B 0 0 p0Q=9A =C0 X1 S<0X!<0@0V?XA@0{H0509%H3i?B8 -LM>L0.0 L0T 0@0 T1 >T1gg@-0L > BL !AR00 0X0 0  T RT1 4T1T!R @g 0-PL0H@T1hSP@ H@T L 0500TKbL@3i3i -LM$`K cPpQ \@T @P TR00W0SQ0#03R00S pP8gg -LM00Pp ,`K 0 @!P10Q& P P@ v R00W0Sp0P@Sh0h0 0P R0S(  0 @ĉggg3iggԉg -LM$pK`PP @TaAL@T 00 @T#P00U0SPU 0,` 0@g̉g0 0 -`Lp0SP@> 08@0 d<$vt0P`0L P0B$ RE 0S$0  0 @a꼉ggH:D:@:L: p-0LMP @x0.050`P0  !0 0 !_ @00@0(phǺ3i! -@LM0@mcg 0 , !  !0 , !  !mc  -LMt0@0C/=20T P 0@0C/=20T`01`:g@-`@00C=20\ 1 ! !00C/=20\`:@-`@00C=20\ 1 !  !00C/=20\`:@-`@00C=20\ 1 ! !00C/=20\`: 0-PL@ 0S  000@0000h\0^  00lS R00@P:T: p-LMP @T0`SX 0 R0Z<00@4<0 R00T00T0phŹX R44 44^ Q4 ^<000 <0@40P<0< 0bS -LM@ 㜹T T00CQ000 0 S0  0S00h鄹P:T: 0-PL @|T0X0CQT00X0 0 S0  0S004 <00CQ 0h],0 P 0SPT: 0-L@PP XP 40S P0<0S -LpP` (@ T $0 `!*0# -LM@ "$0S :S0$0$ Rh0( $0S0$0$D8 8 -LM@ 0 , ?% 0P}0$0G"L# -LM$0S@ 0$0$0 S 0$0h"0$0hh0@-P@Q4 P2 SC 00 / ^(################################0  Q 0S 000  Q  Q 0 S S 08!8 0S -L M88 !0@, (Q 0@|=鴊g$#D:\8g 0-LP l>(Q/@0@10g(0(0( @10@1 0-(0L@!PR @(@0( @10CS@10(0&?g -L M@PD^`(P T T,pKX* !, 0 $ (0 1 $  1$00$0 1$00$0 1$0@0$0 T  0000 0PP VP 0 $00$0 $0 0$0  -0P` AL r(@廷01 0!000X8<0F 0110010@110010 1 100 1011001Q t1! Q0  !  !X10110 1mm101 R100, 0  !0 0 !80S 0 0S 0  !0 0 !0  !0 0  !0 X:D- 1B#20R00S1 11 RX: -@L(`P# pPN] @101 ! \1010!!!0 !!! !1S0(1$ 0  !0 0 !PQPX: p-LM1@0P ȶ0`S S `㾶p0!8< !S08<1 1010 -LM(@!1!0108<1 J05P d8 0-LM(@P1(10(1Q#P0 K P0 (1101 (!00 S 101  !0$1 (! 0 1 K 0 $! (1 0 PP 0-LM(@P1(10(1Q"P0 PK P0 (1101 (!0 S1%΄"0#1%( 3( P -@0 QL`p& RPP @ 0>PT $r 0 R0 b0h -LMPS`p' <1@T 80,S@TX00T^\ 0P V R8 @T 80SD@T0  ^0P V 500CSCPꬆg P-Lp`P$ $` 2P @T U 00 V  V 00V U U U D@TP@ U 00 V V 00V U U Uhk -PLM@ P h p-PLM`P @T U00 00  D@TpB -LM0A P` (@p1 8q04,am(0  <  < !p4 !101!  1V 01 0!1 0101X: -L MP0p 4 dR0 G Cu C03 a0 1Q10 10 000  0  ! 3 ! 0  !  !.!0 %0  !@0!!!0 !!!0Q m, 50SN HS ,c4QLo0   (200Q00S#&100Q00S 0!!!0 !!!S/p .02S200Ň"0!!!0 !!!S@1  0   W Z& 0!!0 0%0 !!00S4  00S x0S0500!!!0 !!!Yx0S ~ {Z~ 50S{l00  0 0S00Ň( 81 Rl #X:g" -LM0`!30#P13\ Yp0@à@0!!!0 !!!!0` 0` !> S> (0!1S S  t@0`0  !   !80S  81 RS?Z8Z c aSZ %Z0`  P 0@!à 0!!!0 !!! 7 5 X:l8 0-50Lp0 , !0 0, !@@$!0 "0  !  Wh"!X0@P `0S  000 0@@0괊gig 0-0L@T P00@T00!!0 0"0 !!L 00 #L ꬆg -|1LMP @0r`(@0 !! ! !1,!,0 0R00 41040 8140 00 ,0S5 㙲1011  !1 1V 01 0!10101{ 0<  < , Q081,10141404000,0 0 o3iX: 0-0LP@ , !0 0, !DD 0001 0h(0,QPPNX: -LM⬢0 ,0 00 @p$`刂 006:D R @0S,0 S 0,PPK΄"0"2?!P 0p 00 K0- 0P p 0 t l@ PP `K 0PP40S P )0 @}U0S06 0SứK0  @0"00U/@y A?K4!KA a q 0P)PPL 0 h 8 0Sd 0S$` o|dg988D8N:P8 -L\M,0 @, $P` d@ XKpW(\@ ,1dKD0 0!<@ @ 0680  4 0 Ơ0 c^ 0 ,0 S d,K@^  `6[`P `@)|dgx8 -LMP@  @ `pp @TT L 8W<00. @=0@888 - L N -LM@P`pT0EP@S$$$$$$$$$$$$$$$$$$$$$$p $ 1 014 10 3i4 1S0 1 Q0 0 0S00 0S 00 0 P -QLMp`0S @PU 0 0C W0SUP!P P 0 e00 0@epe0 SP D0  0S F <3i 0-LM0PS- 0SC)@ 0R0 0S S 0 B0 0@0@ 00 K` P 00 P0-LP@T*@T:cP 0S* !0S:0D00;8 -L@`p PHP0 Vp P  00 00S0@ R0000 0 p-LMP @T @Tpp@T ` R0000 0 V@T~ 0- L@PP( 0 S600 : $0R0000 0 Z : -PL eUp ``@T @ThS(`@T @T : -LDM0`SP\` p 0B S|!XKP@MX00C SjP$$$$$$$$$$T0尡 S PH\ MP@.X t1\ H  a R2: 0㭠P@'\`0 \KA0TK 0 @Q XT  Q  @ ᓠ \K LP@d`\XT-HDGP@v4$:4 i.&%$̗1<|"& -LGM℩\, P`p @U 0B;S;$t$$t$t$t$t$t$t$t$t$t$t$t$t$t$t$t$t$t$t$t$t$t$t$$t$t$t$t$$t$t$t$t$$t$$t$t$t$$t$t$t$t$t$$$$$$$t$$$t$$t$$,0 S D,V0BHS񟗢$$$$ $,$4$<$P$$,$d$x$$$4$$$$$$$$,$4$4$@$H$P$X$`$x$$$$$$$$$D$$$$$$$ $$P$h$4$$$$$$$ $$,$4$4$<$T$p$$$$$$$,$$7 66 6Ɵ 0ƟƟ 7꜖0 0K PPW 0S0\80Spm0|gƟ0 L@MP00W00SP5 E0MK 4 41P0D ? : 5\5X5 +<ş0 L@P00W00SP 4 0s 0n4ağoğmğk4 ̠ğc 0Y 0T0 S<0U KOKF 9PP04Q 4R  02L 0@C3S 1 01Qڤ3 3 `3 zl#0L 0WbD#@#<#3^ 3R  0ZL 07BNK 08 PPv81 CRS&kŸŸŸL 0@ ^`"\"X"T2 Ϡ#@Ÿ-NL 0v HL 0AL 0 :  05 0gPPfL 0)"L 0lL 0 LA@ 0`CPP0AUS`Q 1 1`!0 L 0@  |dg888-8g: :Ћgg̋gga Hhg̊gg8X:\::$#3 #Qx0V/@0 R P  =500CSj 0Sg > 0n1 ͊0r1 ^0voO 0zO 0~O ̊0/OD  O 0H@ O !$0O (0O ,0O 00O 40O 80O D<0O @0O HD0O HP00 TL0D!0S,0 =9C =C0 ,0 , 00$" 2?L0S80p081 0S80t000% 81 R l00x0S00|0|0P @5 0BSR$0 0@ K8K4@K !10|00 IE"3N61!2?B -QLTMPQ0DSP U 500CS00   $| 0 00 >80K`0 `0Kp=aX0 P0K\ |` XKH D T @ <` =PpT  40 T T,4pl lp 0 8l`x x tP 1  0AVd p 0ySw*dKt Ppt xh0K`0 @PP0K|0@p pXK``Kp00─`x`00 @@3ig 0- 0RQLP@Q t0 < 彟0  !0 0 !0  5 @00@0 3i!Q0|[3i -p LM00K0|+ 0  !!0 0+0  !!#3i 0-0Q@LP) 0  !0 0 !!R 00 10 P x0S0 50 0QxP03i 0-0 SL@P P !R 00 10 bP  ( @ 00003i 0-@L x0PS 50S 0  !0 0 !0h x0S20 ?Q 00000 x g -LMp `ߞ 2?@TV x0PS  UV@oȞU000x0 0`F 5 R0S 050圐?0 a gg2i -L~  0mc -LM 040,0 @ p0 c`0E"0 $@ R:0S*000, R 40R鴮: -LMp(K K P`5 (42@ ʚ; -LMp(K K P`5 (42@ @B 0-LPL0@ R:0S*000 0000mc -LMp(K K P`5 (42@ ʚ; -LMp(K K P`5 (42@ @B@-TpHP` 40 ^5 420@ 40^ʚ;:@-TpHP` 40 ^5 420@ 40^@B:0-, 4,00Q0 40Q0ᴮ:0-, 4$00Q0 40Q0ᴮ: p-LM `0@ r 1QQ0 U 0 0@ RP0R 0S 0R A@p00 0$a*^*:::008T8 0 0ᴮ: -L,M@K 0[Op`! (0K@00S@ ,04 S4K00S0B40  0@80 aS :<0S*000 KpP7`4604  0 00ܓ#0@ RT46Q@@P 0<`@H DP ( K@Bʚ;mcHhgmc|8 -LMP84 40 80 4PD D@D2p 0g^ Dp @@@ ` 0@ pp% "0 0S:0S*0004pK0 K0@, R:00S*40040 0  $04 @cT@T P@DD RTD4 $ 0pKQ_`5 42(0400K,0^`4542!000^O0$  BE!;!ᣎqpW!᧮ᇑY ! Q P)o `!nQPU`  D p8@D@@p @$08@ O8@04 40  @Bʚ;::mc:Į: -L,M, LK@P`p B  0P@ ,0 S , HBP h0@T  ?BPP @T 0@|dg:8: -L4Mp@0T,0 P ؀` @ `T %@0TP0 LpK 0   ( B @`T 0 P@$0 ,0S ,鼮:|dg9898$$ 00S000mcmc -X0LML0}/P@/88@A3b000 :Mbmc:@-QM@ 00CS ]$]$]$]$p 0 Ѝ@U-@Ѝ 0H Ѝ@ 0 Ѝ@ 0 Ѝ@[mcmc@-0 MR0000 0 `Rc =9 A = /02|@0 $ 0@Ѝ @0R 0r000 =9C =CS0 g:xP0- 4 0$000Q  00$000Ḯ: -L M@ p0pR K\0 R 0HRb 'ek 0R~8Ћg8 Q-L Q Q900 2b!! 0-LM@K PP0  00 0-LM@PKP  0P0SP 0-LM0PSX@ S0 D0  0QK 0 00FPʚ;: p-L,M `KP P@ p H1(@K 0@a(0 $ PE0S?P00 p@0@#T@S8K4 ,08c00Pc0 A00 , 0 ,0  ,0 c00Pcd0 A@ 0@ < <0 @0@KS0@0 <0  P@0KpMbmc8ʚ; 0-LM0PK S@ 0@S  0 P: -LM@JPP$P0S0S K|00h"c1 1(K( $0 P K PK P:g p-L M0@SP0SpP @K P{P `KtP ZP 0-@LQP(0S0S =9C =CS x0S0 =9 =S B P( P #Pg?B -LM0PS@9 0`S ,@KŒ  4pK#,@K$ R Q 4R $  0 `cQ$  =9 B =$ 0 00Q -L M0PSp`@T 4K JP6\RTN ,`KP4@KP 0S#PR<K,0S(0S ᖳc( 80, <0P=9@ =C, ( , (0  ㎘ `Œ0S S   00$K $0 JP?B -LMP`^0S@$pK0  0=BR L0 0f0$ S ,K ( 0,cP=9l A =( (0 , , 00@Q   0R?B (0RP0Pɚ;L0Q R 40RQ R 00R0 ?B:0S R 00R0:0- R \b =9 = L 0 0 aS 00S 00S0S 0 000 aQ 0=)0C -0 p-LM@ KP  0 `0nRC(0 ( =$ (0 $ S` ^P 0K ` p $0S -LM@(KP`1$00`( S a,0 =90 = B0 ,0 U QP 00S K0000UQ000000!0 Q00gg00  0-PL@.0  0|0  0 c0cR 0 0 PP$0h-00 PPȮ: igg -\0LpP0 `B@0/R hq:: -l `0d L"c11pL0/R hq:: -LMpp0Wh @d06T`@|0/R irq@B::@-40 1 R ^s: p-?CLMH `?h R phCq: -(0LM @h0: -40LM @2ah: -LM@<L00 0 00000hZȮ: 0-L7  01 0P Q Q0!01 P01   N`1`"0 0R  0!01 P 0 0 0@420&0K 0R  0!01 P0 0 0@8 <1 0R  0!01 P01   @@T@0Ȯ: igggg -LMq峖0SA ܁a 0 00cSZSO S1"001 000 0bS9 Sl1"001 0000cS$ S<1"00! 0 00cS  S1"00! 0So鈖S0&0"< Ѓ!S0&!<0 Ѓ!S0&р 0!< 0Ѓ1S`0&\ 0!< 0Ѓ10 P00$0@\:gȮ:g igg -LM@PT 0倐0c/a"|,K0K } ~0H0\0  b,G$0!@Tg ig$8(8 p-H0LM<!8!40`0P@@TPp ig@8P8gg -LMP@T0@ < 0000 0Ԯ: gw$خ::w$$g -P0LM D@R80(0 hzԮ:ܮ:خ:: g -LMH@0DSL40$00 Ԯ: gخ:ܮ:: -L MaPQY P= P9X0 fP@0S ,Q0S" PU qQ0SPQ00 P 0htp K00, 0'P@U4 440$-Ԯ::$g gܮ:خ:::w$ p-`` M@LT0 LP@?    0 @0ph(g|8:z$ -LML@L D0D 0S000h::p:D~$8 -@Lp` $LP@U0 0Ȕ00@0}$ -LMP@Ẕ0 0R0 `p40 p0S”h8 -LM@P@`pAP 0   (g p-PLMXUP`  @u000 @ 剔ph: p-LM`@_P0Uphu HH0 PP0 0U0  G D~$p:8 -LM`@8pPU `0 P00CS0 @C0S0p8 p-LM`PP @ AT (g -LM@P Pg 3i -L8 -@@LM 0,0, /C!b0 h/mc$:gfffg@-0@ < 0S 0 0!! 0 !!L0S000 0!! 0 gg2i -p1LMh!`0VダX1, `P1@T D50 0CS0 00 t Q5t0 @TG,o dVtPp0p  p l0t 0p0^lN 1R50S \0.Z@ 0#1"S  00igiigg:g! p- LM0 P1R@0ll00BP0 0CS0 kWP 00CS0lphi 0-P0L @@0.0P50 @00@0'0h3i! 0- l0RL PT0 >5 @% D00D00h3i!9 -LMq$PK`$ Pf 0 b0aS$ 0=9 B =$ 0 $0d!Q=9A =C 00 P/0S0S @0S&0S" 0  !  !lV050 000L0 0 0R 0R 0@ 0S3i?B4 i2i -LM50@Sꀅ$$$$$$$$U0500S0 S > <0S 00000  S? R  B0 , !  !,93ig2iT l00 0S0#4 P,0 <0S0 "!3ig2i 0-PL l0@0$S$0#l001S 0 Շ Ň0h!-000 00 00@ :ggg -LM0@S`p>0S,0S00S7  0PS0U 0S PPp0Si0h 0T0S <4{p01:\9x9#999 -QLMp0 4 ( ,  0  Q0$ ` V P0S 0 S 0B8S$P0S`V0 R ,Q $0S PP06,`2@08JC8 1!Q4K 08SVg:99 Q-Lp 0  Q0`V @0S 0 S 0B8S$@0S`VP08JC8 1 !Q 08SZ00g -LMP04 Ȱ0( 0 `00 ,0 $0 Jdp 0C81A  B(R08S,06P4Kꤍ:d: -@Pp L/`V 0 h$W  0: p-LM @`PU 0 phup9 -PLMp 0 QP @@\P` Q0S00F 0@@00 POW5  AZ  0P @0S S $@0SP b 0R0 S0 0R, 0 S00g9g9 -LM0p@/P`N dPPG 0 S0 (0 @00= 0P!P2$p@ \T00Sʃ0S0 9Pp T p0 !R0,0o!ᵽ0T|_ 2S00S \0 !R Q 949l9t99999 -LM @`P0pS[ 0S-RP WdA0S S2 $@0S R 0,10  0P d 0Q ] U1S RR 7000070S Q0 0Q B 0 R00$P  d:g99 0- 0L 0PS-(@ 0 0(0P (@ 0- 0L 0PS-(@ 00(0P (@ 0-$0@SPL @ BP4  0@ P0 0h'{09gd9 -xpL@`T 0P$ R U@U00000 g 000g0  B Qg p-LM`` @0P R $0S0  P pP0 g p-LM 0 `P0@S$ pYp9 -@LTP`p $0S @TV$L$X$X$(pW V V0 @TT $0SX 0 @TT$99 -QLM@0Q 0AT (00@T,00,0,00CS,0@-, R, ,HH0^"*,0S ,H H0S:,0S,,,t@H0^:x 0Rt t0R,P,0S, t@H H0R:^:x 0Rt t0R,P82P *0P ":A-(0 S<3(057<@@0 A?A<080S7 08  0P0Z;@@0 < <0@P@`Pp0@@P8`0:00TP{ptPp7" -LM, \0K  < 4( <"4H')Q 鄀<4<("4(<S("48<#8S@ 2Z *0R,:\(@,8@

G?QxQN.00 p@XDWA^> \L ;\# $\ 0  \ 0@@@ xPU)` 00S PK0 00 ` 0O00\ \PK0`pU K00 \  0LS\ \0  0  0S 0 S  0Ys s K0 @PK0x@0KTtP00S0000tp,0S0?0,0t80S00, 8x`V00U -L$M80PS,  (0S KKT re 1R0S PZJ .,@@(208 40 R00 Dڸ`帀0p 0@Q6R40 4@ 8@ 0H0 0@@K H0@K@@ 0H@ 0@RQ 0S0@ R 0  0Z (O,e/1e/+WEV -L,MD, ?0L 8@; "4TL@ 唐Poj tp0p 0 S ? 4 `0@K8@0 p(# 40@PKP0K@@K$P@K00pT @ KT @@K"P!!P`VU@40  @ K@0@# @0K"`PQ`@,p0Hp V4D0(8L 0 @@0`pF00X,L %0[0H80 ;80< 0 -LM`L 88#0| 40 , 0 a@̡ F80!1  0,0  t@D  R TUş d D  B?+$0O@ 0 W5 U44 20 @8 P0 Y0,0  8 0MY,@P0 Y0 p` ?Y@0@ X D (0R 0 $L7$t9(:|9999990  0 ggg -LM@ 㩇 00 09 0- 0L@"  e0SP0 Pp00 d 0\ @0P00H0 U@ 06gg gg9 -0LM0S@a \R 0P00  0 40 BR   gggg9 0-P@LA$0X0S$0 0hU -LM@ P,$00Cs$0D 0KX,00 0aXS40  `=98 = B8 40 `408 0`Q=9A =C`` 000K Z U@H(0` p@0ʏ  80K*|80P@ ?B89s -LjMⴁ崡 0(0 `e"0p#((0"4400$ 0 Kr~PMP!@0 }PP0 $> o/K00PP0 10 uPP%hJK"0@@ " G/K2 S0 S 0 (0S h(SX00H ( 8$4"cc|dg3iX9edA9"9@-9H.9989 -LMP@ DM@0@T 0S( @T?=T9gh9,9 -QLMP`p/ 0 SaBQ00`R00S0p@PET 0S  @T+P00SP 02$04 40gt9 -$6LMƟ^P0&,0 0%000p `' `KW 0S  ؄PrV*@r̄p+PM 0W0T00ST0 S*R PK0 QP 0S Z 4P$  㟄Pr*@rᓄ*P 0Z0T00S 0S[ ((0"4400$04 ă\ $$$$D0 0Z00Z00S 0Se W 0S_ 0S L3 ,0S ,T0Tß30a :dS!((0"4q!$#@9 0" S!$ "^`@v`( B0V00p  "88 #$0a0""p  "88 #$0a0""xtPB[P XS z v 0KP4 0S \f@DPK 0oP   \*s*@a^XP0s PP^ @$88@#DPK0a,!$BN*0K ZP- <PP`  "4  0$ 020$0 ā X@L0 'Xd&dc|dgtdg99p99`99 999cccccc99D$ 909@9,9P99h8X9 -LMp00`K  0 )P00[ S 00C S•0Sd @0S P)P1 @1S 0 S  /|dgpc9@ 0S 0 S1Spc-  0mc g8 -LM`@pPP   pP0D 000 0  0@(:mc R0 00  0 mc -LM`Pp ^H QDP?1@ T 0S2 @T0NS 4$T$$$ 0 -T 㜂0虂0 PT 0 tT 0S 0\mc g@@ R4 000 S00 mcmc -L MD@@^ 0 (Pr=00mc@g9 -,0LM@T @Tmch$ -L Mp@W, 0 4  XPI ,PD`0U 0(@$p ,p  0@S0 0PE@U @p, 00 00X004 00 00  eP@ 0004  0S000@0oX  ɷ )  >P` 0-@LTP  @T000@fT R000   00h鞷 -SL`P@p0 0+ 00S00C 0pQ  0S W 00CQ 00@@h)W 0R 0000 0Q 0 R  B 0S00@@P -LMp Q P@`B: 0VPF \0 P 0R *Q   000 0P  P 0Rpb0@2:R:P*0Ppd`@ R000  # 9 -L4M@`p`P, @jP@ ` P 00C0@ @P T4 : P< Q$  @0@0  c  Ba  @0BSH05 :P @ B Q0 : QHS0#03 LR0S4 L0d0f s  )<R0#03^0S< 8@ 0P L<0 0QP8@0P  000 0P' ,#,0 S0@4 L , 9 -L @`PBpF PI \*PB R?T+ 0T! T U *0DQ 00 pp0000D 0W W U*00 U R000 FPp o  B 99 -0L@`p! PPp0U W P  P R000 WP009@g -LM @$ 00  00 R 0  000hH>0 0 0S0 0  h,@g$ 0-PLM@P T 0H@T  $@T0 989`9t9 Q0-L@0PA 0R x0 0 PR0 R P P0000 0S0SS RR ga0gg-0x0 R0  0^0\\00 0RP00 ga0 R00g0 gg -D1L P@p~ 0R`) ~000\ 0 AQ 0 `\ @1@!T P` 0Q 0Q`0S@0T``` P` 0R H~ D~# gg9 - L@P8~A@`p 00( Sp )~ gg 0-1LsDP@   0,0, 800<0~00@ ~ g,: g -LM@ ~H 0S00  Q0 0 0S00h}g<0 A P -l0LM `@R0 D 00(000 =0gg g p-0LMQ@. 0Q 0Q p0 p` }0 $PB}U0 PP0Q x0Q \ 0 0 000S$  00000}ff@wt@g g~fvtp@-@^P 0S 00p`0^; S 0S1 0S  0`\00S0  0Q   ^ 0S 0S0\@ 0^@@ @@@``0 R 0S 0S 0\`00 S0  0Q  0S0\@ 0^@@ @@p@-@`PR 0SN0RK \ `  RG  R 0S 0S 0S PP 0S 0R`S00PS0  0^    0R00S00S0  0Q R00p0`S00 S0  0Q  R@  R 0S7 R 0S R 0S0\`S00PS0  0^ 0R00S00S0  0Q 0`S00 S0  0Q - LRPp ^p@W@Tp 0SppZ  0`S `0Sp@W@Tp 0Spp \@R` 0S`` 0R``T 00S 0-PPL $@$0 cRb0,0R00SP ^0 0  \50,0\00-P $$0 cRb0,0R00SP,0\00@-@P $$0 cRb0,0R00SP,0\000S 0S0SQ  0PR 0P  R 0P 0S 0S0SQ  0PR 0P  R 0P P0 Q0P p-LM 0@S0`0C0@ H0P0bH0 R000 l  V 0S00PP`<0 0C <0 ph-$8l0t0g -LM P@U`p P:0 0S} WpV`@080l$`0x d0P  <04h(pXPHL000T0 R 0$`/">CVD* VB*l00l0 0PBP᧱`,墱`ୱ0@0`᧱0xQx p0|[{$^ <0S 0  0 000@0 0w B00Pt00` 0 @z QPp>0>0Q! ! ^Q`0`0!!QPZ\D0D D0D 00 L,,g0g<:9D:gg$8$T$$9 pz -LM@Q  Q R0 00  0 <: -l0, L 00g -L@Pz+`zV! 0S | PV000zz`  $ ᯨ\9 -0L M`$0 L P0R PUp6$ KP@  PUT  T0$ 0R0  z[mzT  h d0 h  pA000@T^ R0000 0 H L0 B0H L0 R00C0 R000  R 0PP0 00 S  R000  R 0P0P0iH 00R:6"0S h  d0h  0S0OP dp99 0-0LS@P y y0000 0-QL0MP@e l00\ X0  P] 0 0S0PPP 00C 0L0 0CH L0h0Q H 0h0 R000 0 \08 0S0 R000  R 0000 |@00C\ 0 R000  R000 tDK0 P %d"9 9 -LM`@[y@P@@D፯PP@$K P@  ^pWT  04U004PE804 R0"80%HyT  -LM0(,S00pP 0@`p`$@X0 , l0* |x 0 Q0||Z0@ 0j@(@@H00AqH0 0A0 q@@$0@ 0 S<0 p0S<00t -LMH 00@R*$pK PP  `VU 0H0 0Q0:U 0S 00 0 Q0-P0L @@@ԮѮ4xH 00R:0hx Q0-PL @@@Ḯ൮80 p-LMPL`Q`3:Qq 0P`` @@@⚮8p0  0-LMP00 Px@T <40\ K@H0@00lS:5TWxP @ R000 $l0 @T030g 0-@LTP $ @T049 -LM0PS`p pS0pS,l@$ (0d@X0P@H L0W" 0S0S|0S` P@$0L999999T9h9|999 -L* 0S p|dg9 9 -p-LM Ps 0@``s,0 \0 p`g -<1`@P,1Pp  U00SL 10S@Pp00U00S&$10V00S VV 0 RW 0V0Q00ShWT0'PW  0U00g:gp: --L0LM0  8!0 \ 3i --LM 0w --00LM Q0f阗: --LMHs 0V(0@ R t X:g 0-LM@HPs 0P;(0@ R s0X:g --0 L M@T@ K ( T0   -L M@@T ( 0 K T0   -LdMϟt  Y  0R p h P l , 0 h p H X H0 %PP p H0W0H0 X0 0  X0 u pX00Y00S 2 H0 0%SSRS HT \  pH d ` H L H L  0BZS5 %|%|% %|%|%|%|%|%|% %D %|%0 %X %|% % % % % % % % % % %|%|%|%|%|%|%|%|%|%|%@ %|%|%|%|%|%|%|%|%|%|%|%|%|%|%|%|%%|%|%%|%|%|%|%|%|%|%|%|%%%L %|%|%|%%L %|%|%%|%%%%%|%%|%(%|%|%p%|%%T0  0` 0 0 x0 0S S S  h`d `0V`S`T`T \ @fT@Dp PX0W0  X0 p X00Y00SP } T@D`Q X  X p X00Y00S` e \r dh @bT@Dp 0PX0W00  X0 ` p X00Y00SP F T@DhAqh  p P0W P0 X0 0X0 > pX00Y00S & h  Brh T0 \ @fT@Dp PX0W0  X0  p X00Y00SP  T@Dʭ9X ,0S ,2\@fT@Dp 0PX0W00  X0  p X00Y00SP  T@Dml`  gcT ` X0p 0W@0X0  p X00Y00S  XTX p X00Y00SL009L  :8D@Kd(0`xD0[Sx  p X0W0  @X0 pX00Y00S v 0S  x0@| Tx0  @ T@D vB0@0` |X Qp <, W@X Q p X00Y00S F x !0B^SX00T  X0 4 pX00Y00S + x0 x0 !0B^S| x@Tx |Q X  >X p X00Y00S    x !0B^Sx0 x0 !0B^SwD@K%RD@K%OT0 00 T T @ 0 P` 0  P``QH0 H0 HT0 0T0 00S H\0 ܥ0c\0 HT0 0H+ ` H 0*SH L0  L@00A S HL 100 A RH L 0@C0Tppr0@ 0Tpp bH0T T \@H L10H 0 L0@C RL \@ ST  T T0 n 0` Vc WTdp ̣T d00\0-KSP  R1 :R D3P0 ,h l% >P &B`PbP P(K 0a0Ch0 1!P0`P0c P0 T 00SP000aP V0 CP 0bP 0 C`PV PP000lP  U- Pu`` T0 00 T T @ 0 Po0  PozT  T T0  0` 0`0 oT0 00 T T @ 0 P`0  P`TT T   0`00  T0  T  T@ 0 P`0 0 P`\l T   0`00 T000S T |dg 9 99 9 94 9H 9P 9T0  T  T@ 0 P`0 0 P`0DK P 00 h ` D KHT0 @0H lR H  T00T T T0  0X /00 T T@ 0 X0 0T  0 X0 00X  0 T1P` l0 x0 T L0 0H 00P0 P1QW P  FP P0cPh hp ` ?Ph \l NL R D0KD KP0 h ` -t0Y00SH0T ̌Hd -Lp9 -@LM9 -LM @pT0T10 P m @ 0` 0  00m0p@- `0Q c: 1P#(80S$H*   0!!0 0)0 !!0 pg -LM00P20#0R0Sp ` 0Qc : <"K#80S $H:@@0S 2[02KjP E-Ƞ@0Sp0 p `P@ 0@s  0R0 s$0@S$P10 R$0 @$0@S 00C0d:|:x::: p-LMh`@qP T0T Q 0QUqU@@0p Z0@Pꄯ:: 9 9,0, 0$ Q 0÷ጯ:::Dg -LM0(h h`\@\ 0 0S<:80 ٛ000 9g::Dg000 Q 00ᐯ::Dg: 0 S-L< 800( S $S h9t: : 9 -t0@LMA \0S%%%%%,h$h{d:p:9 9 98 -LM0@Qaڴa0Q @X Uژ!00UG@HT|iSp!1hMXI@ P0s+ <A0|Ps0S%%%%%0@` 0 Ps p0$@i 0s0s @0l!0 S0c00cA R\i(x:|: 9č: 9d: 9( 99, 9:0:8 9@ 9P 98ȍ::X 9h 9p@-0P-S0`P0S @,  0C0 RSR 00L0 Sa LW0LR7L0AL\0S 1! 0B RSR pU00a0pp0@XSxS0@A-P@a@P`pՅa0@S*P 00@ S 8C81000C0 @8 R#H0 S S 0 S S S P@ S -L M0 ` S S, 0  S S  08 R R# R RP0Uʄx@0GS  08#h XE8S@0 8Cp,02P%X0P :0: -LMp`P@`(0 S S 0 S S S RPU  KP 0P0 S | 9Dg 9 9 -3L M PP:bP2 PoxGaX@yTYT nTNTYTyT cpBah00c P2 b1 @G9o, @3tX@yTYT nTNTYTyTc1 000 R @p]  X 00S0 $$P00SL d几0s  0sa ڟP4 @4  4da 0s 0/pa 0s%X0P ,@HA=o !4wP40 04'Po+ꇠx:|: 9č: 9 9,9č:8: 9d::0: 9 9 9 9 0-L1L @PP,401 R"%#%#% #% #%01 @[Ud%0h01 PPTшڄ0 Txt0 `1 h0\ 0c!0S0cd0<0hx:d: 9 9 9 9|:0 9č: 9:P 9ȍ:X 9 0-H1L @PP,001 R$%$%$%<$%$%01 @Ue 0hP01 PTфڀ0 Ttp0 `1 di0X 0c!0S0ce00h\x:d: 9 9Lo9 9|:d 9č: 9:P 9ȍ: p-LMaHP0@SN A P @`:@T1 D B2RV&%D'%D'%D'%D'%D'%D'%D'%&%D'%D'%D'%D'%D'%D'%D'%D'%D'%D'%D'%D'%D'%D'%D'%D'%D'%D'%D'%D'%&%&%&%'% '%'%D'%'%D'%D'%D'%$'%D'%D'%D'%D'%,'%D'%4'%<'%D'%L'%P!@0Sp|xtplhd`\XTPLH꘯: 99 9,9 9 9 9L9p99999(9H9999 -h`hP0 @0XpTL@000S@@70 0T|:č:: -X`@0PpTL@ @Pp0S 0@0T00逯::0:p9 -LMX 04 D! Z0 , p((@ P 0 s ,0 Ƞh8 V W@ P8sW 0$Zڤ000 R 00 R4 peR dR `4; 40sS8L {80pCx:::d:9 -L M |0p S S0 @ SQ SO 0 8 R R# R R0 S S<0 S S S `0VܐP0HS ! 08#x hF8SP0 8CXu Q ,`KPXs FP&h0`  S:0:9 9 -L M8#8cZ00 (<2"(@4@, 0Sp `P0TPE $`0@S$Pa@0T0 Ё8CX PUc0J 0@TcZ1  S ,%-%-%4-%d1P k<1M$! !@0  WP0 8C(R R% R0, R0SSPc0JS-%-%.%.%A\ -t@0SS ꄯ:d:č::|:,99 p-LMP0 S S` S S 0 S S S S0 S S0 S S S PH @K P0@ \pp SL9 9 -L Mp`0A,(T 0P S S= 0 S S S R`V ,KP0, Rڰ0!1 P aY ,0 `0?P QPqP Hf  0 S Dgl9x: 9d:t9 9 -(L4M8"(`LK$T #l#3 pQ Y C0S P0 0S $0$@SWJ0PpKa phP0s \# PLK@0@T@4i p岤KDKQP0s a$3@0I.P,RŸPp@Wʼ"1Q$@D0W0$PEڀBLK @ h2 0T XŸ @p PT,2@0T Ÿ @p PT0001 R P@0 0S I $0$@StA0pS P0q 0S ( $0$@S(p0S P @0^ 0S  $0$@S[)0 P0S S2ḠSrı0 P0S S0Wp0 P0S S0Z0t Pp,x:|:9d:999: :::9 -L M0P S S@` P P 0 S S S S `0 S S S Su 0S  0S  ] P1| R0 S SN0 S S S x@ 1 D B2R*x7%;%;%;%;%;%;%;%87%;%;%;%;%;%;%;%;%;%;%;%;%;%;%;%;%;%;%;%;%7%7%8%t8%9%9%;%9%;%;%;%9%;%;%;%;%:%;%:%0:%;% ;%PH 0KP0 04  ? P  0K* K,0KP"[2[0CP 0KP0  RR R 3P 0PKP0* K,0KP"[2[0c0P 0PKP0d  P0d* K,0KP"[2[0dVP 0PKP0e tP0* K,0KP~"[2[0eP 0PK\P[k* K,0KPf"[2[0f\P\hXq'^POLPlQhE0K.PB0S 004Q0 0B RS R  0B RSR P P P P Pt#0KP0000 R@@R@t0 Sd S P꘯:H9: 9\9l9t:99:99:9999 -LT<84(; 0S JP h$989g@9N-  0`1tb  02b-T0 $\ <0 \ 00  Ƞ 0 Ƞq b0bb-l0 $ RT00QD1R  Q (04(b0bb -LMpP`P@   ` (0K $ ( ,,` & -LM`@PpP  0 P ,00,0@P p -LlMpQ ` AP Wa W L SP  bP 90Sl` P p p0 t0 x0 0x x 0PS:^8Q0  K xP x x ^ pP! #P 0H@0 n Po`0Q ㏘,0( 0C,0,00  W0hPK0  -LMpP`~P@   ` (0K $ ( ,,` & -LM`@Pp~P  0 P ,00,0@P p -LlMpQ@ጐ aP Wl Wh ㍗P  ᜓP@ 0Rp0 P p t l x 0x x 0PSE^CQx0  K P1 x ^ pP, #P* Y" 080nP0 @0 Po`0 R —,0( 0C,0 ,$  xW㌐ hPK -LMp#@0,0 $~PP 0 `43V ,3V &8yy W9,0W0,000 嬐KV&?0W00S 002Vd E2V/  0 @T&?0W00S,0( 0C,0 R M2 ,0S ,\,  J@0S$ @<00 0 0@0c01V 1V00 S00000 K 00L0 S00@0@0 0S 0R0cҰ0 ᲚP@ 81 $@< 0 @0 0D0 rWn   nP@i  Q T 000 00 w|dgf f |f{f@P9wt@}f~fvt -L\M0`Y!0rYt A P 2  @P 0H D@ XP T0 P L PP PP\ ` 0x0 C0p  !0 @0 !tLX  0P@Mt 0SI0S# hPKh`0\w >`@KpKl 0pcPl=9 A =p p l p l0 2R]ڠ"002c2c3x0 R`00P@ dŸ0S H`0  !0 @0 !$"Fx0׿@2`T 0  !0 @0 !t@#T@TQQ QL@ KPP P@T P@X @zx \ d0S`K pP@`KP@hK\ d0` h0P=9@ =C` \ ` \0 =D SP@2 H LP@( L EP@ @K㸎<0K8 KH0 D 40K0 KX0 T ,0K@ KP0 L pgQ:\9lg?B -L$M, ,@ p8 0 4 < H H 040ZD 6D2a0S0CP8c% U#{P@,  ,<0,0 R,  1@ 1 @ 1,0( 0C,0  Z<0H0S<0 H 0@  P7E 0-08PLS@ SP0P x 0R0000lg p0-L@ P, 0*Ƙ0PP0# _x 0@R 00@0h_0  !0 @0 !50S 0(0  Klgpg -LpMW,0 P`*0 S0!S{P@  ,00,0 ,0( 0C,,0 0Sp`VP:,0pp 00 -p RLP@`: 㣐P0 `P@S: -LDM0@d d0` S 0!HKl h VQ Ud l PP *l0 R0:z 3 PKBa2a11J"c11L0 P SPrXK~L T0PX0"PP L =9@ =CP L0 0p  !0 @0 ! h0lKh 0SGz" XPKPXP0\o =PK`K\ 0`cPl=9 A =` ` \ ` \0 1RUڴ!002c2c ^00P@ |!0S ^0  !0 @0 !|0 Q>x  0,0CS0 p||ꜗ: g -LM`lP?O0 piX@"cX  0@D  D \@0訠 $☀ ";p05 K R @j 0SU 0S ] )U}P ^U~P\U; A0ES P  @ P P  PUpU p 0UZm0 "0p" NU Ww x ~U Wh 0xU U U|Uu 05 0M  (0r05 UZ   ^;8p09` (0S.@A 20U0S 6 6   y0PD 0@$  $ LgTg\7b8g - Lp0ß 0@d 0 d H P X X X X D a0HS H@ > 0; `0HSDs%Hs%Hs%Hs%Hs%Hs%Hs%Hs%Hs%Hs%Hs%Hs%Hs%Hs%Hs%Hs%Hs%Hs%Hs%Hs%Hs%Hs%Hs%Hs%Hs%Hs%Hs%t%t%t%t%'A0H\XS X X"@0`HP``d0\0d0 P "30 X00S =S  0@d 0 d H P!0?0S`t%Tt%Lt%ht%|t%Tt%tt%QA0 0(!)^  so 0@d 0 d  0=`H M PPT JO  L-0c Z0 =XUPH @ 0`0Od  d FU-Dg\79 -PHLlMUp` {$:U :t:U:5p:8| 0S 0 x0\ 11F0S )9@ P@ 9UA x9U lT9Uc \9U T9U Tp0;p0TTp0;9U 9UTp   5,0p  8 0S 0S||^ ^^ 00CS0 8 0008! 0|08!x 81 0 !0 0 0  !| P@ 7U; 7U 7Uh00T7U! |7U81| R PxP@y00 7Uh  㓌kVT<dH0NTpzm0&0p" o6UB e6UK /06U 6U</T0Sp0p000p0V0 Q U 0 Q 81| R00 h 52h5U' 5U 5P lU*h0U Seh02 P@hP h0  SQ5U 5U 5U~81| Q]00Z P 0Sxi4U :40SS40Sw $0Sn(0Sk0S_p 0   P (0$0( R|P P?3U ,<R R 20 0 0;; 0 0 2  [`(p@g PKK020 n 0<p0 P@Q .SsP@G|2U{@  TP.  Qx %St08t0 @8t0  t07t00@t08t00 t07t0 P/ q0S S p0(0(S# @0H0 1P pKl p0 LP D` DP@\ `@h0`0 j@ `#l`LT  0X , 㸁U0U 0U 000S}t{t rtzt ^t g:t,@ot t t at nt gst@f@t@[t@wt@ht@bbt~f}f԰:t:Ztetvtgtt,:8 4-0L0Œ@PuRAp`@ .H0S`VW TbR  P`0 p0b p- 40t 0LM"@`1Ps sP<0 p80<`0R00@+R0b:İ: 0-=0p 0"L@<PR0S00  Q0 0 0S000hRb p-LM= x0 2`<PQ@Q Q0 p0191p 0Spb 0-=0p 0"L@<PQ0S00  Q0 0 0S000hQb p-LM= P0 2`<PQL 0C 0H@>T@@ӡQpb -LM0@  (0 P0SM0 p-LM@QP`H0Spp% 0  0S H0Spp 0  0S p, ,0H$PP OQp: 0-L@PP 0 p-LM@P6Q` (Q,Q&p0 >;-p0.(phQp0m h< p0ŒHQHPgHP(b x: 0-0(  SL@P* Up0@0  (0Sژ0  P HP 0 0S0Pp0@0p0p0@0p0p0@0p0 0-@LPp0P0p00hP -0LS0 -L _N -LMp@  0 Q   m0 ̌0p"%p(Km =P@ ( P@0p 5*0p 0M-=`b0V``V=J`VZ0@   p0  X:p0\\79 Q0-L@PA  UPE0 -LMPP2 L(`$pKP@ $! P@`P@ $ nP@p0:p0L0>0= 0-p0@ 0L50 "20#0 P0S @P 0P0PU00S P ^ZU?@0hTU0 -LM@Op0 h֭xI0s S0s-t0 A!`?̠0 S S \h\ !h3 3#2 11>gfffON -L4M`sP,"0$"111;5/"b1C|0St xQo @TPi wPPD@Tt05c1 @R  1P  2R;⣕$00@K $< 08 K➍,8N=0S,0 00 !0 00 , 4N=0S40 80 0 80 4 50~Sp8̀ S 0R 4@_4Op0LFd0>8 <AnRe 0\@Pu8iQ999?BH99(9h09d9P0@-0 5@5P0 SR0C BSRP 2P# 0DS00 ER  R R 0R0S0  000 8 80R000 R8 80R0Pl l0RS p-LMP@KKp0`  0 @Kp U  3Kp 0-L@  0^ƪP>U00  \g@g 0->L Bx@ \P( H  800 @00 0@嫳0\g@gԇ% -d LM0@0C0 R0 <00  0 (H>h鿀@g\g -0LM@  ,0Q l00  (00H >1>1=1p00|  x0S0 0h0$0(Q@g\g -LMQ@P`p00CSꨠ%ܠ%%%%000 P@-@X0T0P0 KD0 0塠 @ VTgDg8gLg@g-R Rt0t0\ \t0t088Q < p-LM@`P >0E/V> 0`0 0$0  p -LM0@S0S000A?y>y> 0-@LI0PS#  0P0^ 00l!R! l 0 1\ 00 0S00000CS00 0I0 -LP`IVp-0S# 0\@l0% @l T@ xx`dPp 00S 00 d0V 0SS 0 0Ih0 0 A -L@PI`\p U, 0 ` \L 0 1S>0`QlI\L0 Q` \L0 0H`F V0`b 0-@LPII U000 0 UR 0 S cc Q0S00 aPa 0U  RR  0h"I p-LMP@I `R1 R0S$ 0 0 0P 0  B\   00  110 0 0Q00  0Hp$ 0Hp9Rp@-@+ 0/.\aC PN 0 10C0\00 0\060C000p0a # B0!00p1 ! p -QLM`PpDH R- R0S1 0 0V$ R! 0 @cR@cT@ }w`dPp  00S 00 0V  RiH 0 A W 09-0S0| x 00QSCT0P0Q R 00c!0R#<0pc@- T0R   \ 0L0c!R!@ pc 0-@LH PR 0S0 0 0 0 Bn \P 1S>\0S0 0G0 -L MpG0S# 0S 0R Gp @@`KP@K G -`00p81P LP@U @ ] 0h_ @` -LM`00p81P HP@U \ 0_ @` -LM`00p81P HP@U \ 0_ @` 0-LM0@81P P" 0\ 0\  0Pz_081 Q 0  !0 0 !000at qt @-00@81 00S   @`_@ 0-1!LPS 0 0S-@ T* 04@S!T:PU R0 0Ո0@0@d@ ᙯll ᕯL㗯P0h铯 dg(:::bgLgpchgܲ%Hg pcP%,0 P 0SPdg -LM@P  P*0S S 4P: p-PLMP@` P P* R T 4P:p0SRV`0Sp -LMQP@!P P P U \*0S 4\:*00S E 00*Amۋ -l0LPpU` @T * \4@0T:PU dg p-t0LMP`U @ T*(04@S T:PU(0ph dg: p-|0LMP`U @ T*$04@S T:PU00(0aph霮 dg:gfff -@ML 0@0됀吠`Pp1#5|  0Ppp@TP`44 _m9g(:8:,:Pg@P@ P0 / 0-@0TLPodrPP@ 000 202 0-LP\0@0 0 S0  0S00or R 0 @RB0 -LM@P 0o0rP022RP 0SP 0-PL @T0 k00 p-LM@`@PT P U00002 P02@Tpp00 -@ ML 0@|9g -SL M`1`@Q Pp 0S+0SB@<, \0 P0  @ { P000  0@ @@ @@@8` pP@ 000^,<,<P)F3ig -LMP`@;  p@0@; -LM`P;0p 0P@ 0S000U L 0UP<0 UPS; ;3iX:\: -LM@Q0 0S! hU Pg -L MP;0p` @T ? U@T @T 4 J @T R 0 3 0 B?BS  Ā6@ FP`0 R 000?;X0 0V`P` :93i9 -00 ML @  03i -L M@p ;0`  0  P P0 5` <0` 0`:3i9 -LMP0- p :0` 0 8@: *P,0 @ 0P@3i p-L M@P:@0 ` 0 @:p3i p-L MP:0`9@  0%@( P@@@:p3i -L,M0 00 , 04 0P0D0 R< 00`p`W00S{ 0@  0000@0 Y 0S 40040Q < 0;0 0; #GP00:05:0P G03S? 0 4  < 00R0S9$00 B0cR D0 SH  0@WV<^ <0O/R QDQ0 <0XX9<,K8 aY ,@TĠP@@W00 X00SDZ 00X@@^d ,  T00R00S 0d0     @8ZP, `p000=W8P \D0X00S@ R00009WPC20 H0S 40 , 9@,KQ0 0000Z0,0 <0 8 00X00S40 0; 0;;* ,PP 0;᭚V00:0V, 101; 1e D0S ,0S @1+`R@@dk V@KJVHF젠P= p` 0;0;; 0 00:09Z 0;0S#8(40S'0#   3iLg -L4MQ, H  0`@0 ,0P L 0 \P0S0040 4 0 44 4R0  0Sy707 4oLP_88 d@T 4 L R*`0R:40@ T0Q 0S@03S T 0S 80080@040p 4 pL  ,0S 0u,@T 1SZW \  0b@0SL Th 1SZ Tb WXl@!R40H 040 1 4̌4  44  T< D  Z00R00Ss 1S9 H\m 0H @00PRp <0aUP! 0D P0bUP!00S\ 0e0 D0lU 40p DD H0S W0eSH00@00> 4!s:0T00SL( 0S% 00#0X00S 3S0 PPd@T70778707|Tl  Z00R00STa @ 04p; 400p40 4 L 0Q0Q00S 4 0  7077870|7ޘP0S\040070778q7 0|7ƘL=WT @ 0 0S 5  40@Xdlh 0Sl4p <\< S0 R 0 G00 0 e00 L0P 0e eL0P 114  4 40p@&L  aL 1SS P00bP0X0,CX 1H00cX00Q @0@ @d@0 pT Xl@Xdhld@86D  UP 6P08 S H0S 2WXdhl L00bL0!RR P00bP0X0,CX 1H00cX0 R @0 \ 0 R  @0d0 d@`  @ 0Q 0 R d@L L00bL0!RR P00bP0X0,CX 1H00cX0,Q @0d0L  d@@d4C  TT 1S, 1)@T 0 90 SR  407077LG8E6Z 0|7ᘗ#@#0 @0z 4@0  @Pp Q! z2pZ00W00S@ PT Z3i p-L MQ@P ` Q pT ,0  0PpQ3i -L4MLP3 p@033@0335`3033#TK@040d2[03,0(050 00S*<003 -XLMZp`,0 P \ 0S*U,0K0 0 R 2R  V AV )V $V *X \ 0S ,0K0 0PU 0S0 R00000V@V  VVU 0S 0S S  V  V  V V1V)ڌ1VU 0S@000 d10HlX14 ` AlQ!À401#8#(00 S 1V+ 0V'U 0S :F@0CT@S񟗁T%%%%ZP 7V;Pq TMPL0T@0dT0T`@`0_40OtPL 8!::3i -LM^P@p \ 0S*p 060 T` 0 ( T T T 0 00`T TT @T T  T 0 0000T9  T  T0T 0TT 0 0Tʨ0T` 0P 0|k@_kl0 X0T P0T 3 003 :: -LM@@ D0<~p@h 0-!40r@L$ r 00LP<0<0803(  3(@033 0P(:8:H: 0-40@$PL3t0S0t0  Q0 0 0S00t0S7070h340$ L 0  191# 3S,000`0Q 0-40@$PL30S00  Q0 0 0S000S;0;0h3-40$ 0@N cQ  Ŷ  191# 3S 0 ,0 0 0S 0R40$# P0 00   0-0P; 00  UL@  0S 6⒔L\0S 0hSLK0S 60h3 -LM0@00 68 d.L+0S  -LM0@00 6. GL0S  -LMP0L 2cC0Q0^, 00 n3#0 SgʨPE A0 @0 0 @0 @D@刀   -LM @40 0Q 000!RR 000 0, 1H00 0 0S 0Q0 ! !101 Q-Q 1S/ S' 000!RR 000 0, 1H00 000 0R 0Q ! !101 0Q -LRP`p  10Z @W 0R@0@ N0aR P\fP= 0 0 _Tp`Wp @ 0  1SS 000 0, 1H00 0@0S 000!RR 000 0, 1H00 0 0S@ 19 p-RLM@P 0RP^ 0Q0`D F0aR \p0S 0  1SS 000 0, 1H00 00S 000!RR 000 0, 1H00 0 0S@@ @pӻ9 Q-L@`Pp 1 0QpW 0S0 0.@TW U 101Ph0SJ !1R U# 1 Q U@ @ 0P00!RR 000 0, 1H00 01010@0@[ \!1R0  ^ 00 0 0  1SS0 00U09 -LM 0@S 0S p-LMP\` `U@\ W 0SE Pc c 1SS 00b0 0,C 1H00c 0U\* 0S  c 1SS 00b0 0,C 1H00c 0zP 0S \` \ 0S p p` 0e  000e0!RR00e0V`ݺ9 -LM0@S 00 0  c 1SS 00b0 0,C 1H00c 0/P0S  00 -pL @M T` PP0 T ;1@ @  ]0 0 000ǻ09 -LMp`(Pe(K, KOP@0K (0 ( 00(0 U@T0 (0$ ((00(0( ,00C,0((0,,00e,M(Q\: p-L M@` K#PU K0 pPP  ,00C,0(0, Ə0 $oP  0-LMP KP@ 00$r @,00C,0(0, -LM0`Sp  ,K_P@0K P@ 0'.008 $P @S   3Sy 3S0@3G < P 00 ( @ d 4 KNP@V40tu0 tV@0 00 0 00! 00< $ P<P@ Q$ ,  0R,0  _P@ 4L0XP)(d8-,0( 0C,0 ,,K _@T0 (00(00,00C,00(0 ,< O6㹎 #@5@3S~3S| 0T 6F 1P@3So3S k5 50#g0\:,949 -LM0P K$0 P@E $`0A?AST $K0P@'$uP@!0A?AS4 U-0p 3S6P!F0P@ 0 3S T0C38-000 ,00C,0 (0$Pt,} 0,  B, (0$u$,n,00C,0 (0%,b<9 -LM `P ,KpP@  0KP@t( 8Kc4K MP@d804 D0 0040 4 弑<K, 40$  MP@G<0 < 00<0DK<00 $ 80,0@0 P@+0SF  ^P@!4 (00(04,00C,04(0< (00(0<,00C,0<(0 c,,K<O000 DK4 O0,0 0P c,P~0,P@ \: -L(M 0@` @Kp8 0 8 K4@ , ( @P <` p9 -LdM0DK`p  ]P@8 P#PPKP !<]P@0 0c0Q P0SX0   X RX \PP)X0X0 XK \PPQ `V T0S*``UL 00@L H /L0,  B, L(0 PPTP,݋ @ V05@1 0305 t\0 S@`V00PU0SX0 `cPP 0-LMP KP@ 00$T @,00C,0(0, p-LMP KP@`*0 S@ 0S 0`S$V  [P@ 0 00 $0`@Vq0,  B, (0p,b7@; 1 0-LM0P K 0 P@) 0S 20$ 0K2P@ Q  R 0S R [P@ 0,  B, (0 P0,K [@K 2[P@ p-LM K`P@T(K  p 0(0 $ [P@ (`(H$H(` -LMp`( K!PP ,K  ZPP(0$@o  0PP ,  0R,0  W[PP (0,  B, ((0X ,⣊  @[P -LMp`( KP@2(!$P0 R5 ,K  ZP@#  0P@ ,  0R,0   [P@ (0,  B, ((0_,X  Z@,00C,0((09,F -L Mp`$ KP@ $0$P" 0S4P7@  0P@  0S-@@TP ZP@ $0,  B, $(0, Z@$0,  B, $(0-, -SLMpP`&  R#V@; 21  ` YPPW@0`7R -LM@DP  0& S,0 0,0 0-0@0LSP S T P0@ 0g P00 -LM Q@`P) QW 0S%0Q0U00S3Q4*&0+&<+&P+&d+&x+&+&+&+&d,&d.&l/&t.&/&/&/&&P >& P-L@p T 1S Q@T 0 S\0 R0S0` 0C#1V P`X`VPP   0 S0*00 * gP-,, 0 0C0, 00C0E|g 0- 0PSL PU* 0S PU:U 80@ ddB&0PO LQ$0$0$00 $  0@0ygggg9 p-LM PR0l`00d @0 \ @0C6LS0000S pph颩gg$g -`1 MLT @!Ca1<10>0W x   00K84@K@8:P400 @r4@ TX R @  &VP @0`SJ@0VP@0/ 8{Pv `VZ@`0$V< 1D Gd0H0 P KP0KPK  0PK P0K@0 P@KPK!1PK< 80`60800K /t1H@pDp0 @P0_!D`1@ `d0V0<@0K806D080t 0|0T@0`@0P` `<9|0 ,00,0N@@`VVF18 *8 @` V,0sO7ggHF&3i -LM pR 40S|0P8 00Q00S $0@@Q Xx0h0P@ `P 0@8@806*=80@TP0 000000p  p 804809X \@[, g3i 0-80LP 0( RM 0a Q0S 800808 ,8 0h10h80H 0800#0(0@ 0 00000Į:tbb3i80080@98080 0800#0(0Į:8080080 p-LMP]80`" 80:8080 t 0S 20Si8080080P[P0 S `0S80 Pqph1d@80580僀@ (B&0OB 0R(0S(000S 0  0 0$00P$@0 80 8|!0S80 80580I0C0Dd 802@ (B&0O@ 0R(0S(00800 0S 0  0$0 0 0P$00(0 0 $ 0P P0K?<@ B&0O$ggggggĮ:gg 0-LP@M@0KdK0P 80  0 -LMp` dP0KK PU q80 080  d  00PP t@0 80 080UK8Ō8}@AT 9g -LM@ 0P  -LMpD80 80\, S0K<  @$@4 Q0T0S0C 080@ S 4t $@_Q 0S*3( @_Q(0SL3 /P(0SxC0/PlcP0Sd0 R(0S8@>0#6ȟ0 ORQ0S3 bpP@U @0Sd!PU @DtW@Ÿ0 ORQL0 R G1P@ 0Y0 X0S0!0 R +P060 x1P@ P  P 0 00 pp01  +P060 qP0 0 R  z/06x@0 ZX@0 090N3i|dg:g`g9ggghgg g -LM`\p \ (PUU , L0R \0P@ 00d@0 W @8 @bT9N@P0"0錳:@g8g -1`LPpPH 0SEԁԡ 0R1@Te B忛W0pL0@40(`L09,0 8 8 D0SL P Pm鉜W4 00W0 @0@00 40S 0R0@T m8 RR :0.S 0 0 0$0 0@0R 90.Slp0\ 0 @000H,0@T 댳:Xg:hg4gg`g 9 p-@ ML8P8`88 4X0P`P@@@>phg`g,9D:4g -LM@P PP P$ 000SL0000L0\g 0-PL @R (0SP dP R (0SP 0P0SvP0Sohg`g -LTM0 l0K 0  < d \  0d0 0 @\ \ d RD 0 t0DX0  \`P0@W0@tDX  <P04KD @R0, `0   0OS a &80 nU@ V 0`0 0 @<0P0D`PP 0O`"8@#!P7 X,K< 0-P0t0s ,0S 0@00`@0\Xd `0X0s00 0X d@ `0`\@4 Q4@V\0@WXD@ Q 0 < 0 `!<PB-P @T : +` I`000D T:@T +I\X d@ ,TX0tDX Bd0p KD0pKt$0OPK0^tX -0S*P KPKD 0OW{Xy T0<0P@@@00@ ] M-LM0000K0 p` \  0. 0@U( W80@0P`pG@0P`pGY  W 0 80, VW @0P`pG -L M@0, 0a + H 0@0 Rp`0  @D0A ,@@0Pp` W p-LM@ 14 `R3 80   &< 8080 | 0P | 0S P80 <80p44 T00Q0S<80P 0r|P PU   P0 3i490- Q000S00 R000 - L0; S 寙xg 10S080T: 00@Q1 0 ! 0 -LM0@\ Q 0Sd0Q !0S<0 G0 VԵ:tgL9l9|9 -\ 0L!R @0Q1S0!!0QԵ:tg9 0-@0LS 1@ 1S 0S @ @ 0!0R0\P@0S HP@0S0@1S@x1S(::tg 0-LM@ddd 0P D0D T@@P@@T$P09D:xg :$: -L M$$@ 8 0@9D:8g 0-L@PKUT T 80 Q0(0˗0P0 0 Q0h:8g -LM@0J00C0h阘8g -L M00 0\40 1, \b\ `P`V 0 Gp,PY  !0Y 0P@/ 0`000,04 @  00 4  0080Y40 Y 4PYo M@0ppVʯU`3i -L M0SPIJpP`] V @ 0@  xQ 0CS,  @T! `(p 0 (, #P0p@Q ( R,0,0,0$0( ,0 pT 500@0W 0@  0R xQ 0S0^ #(pK'`@0K 0BP0`P t&&Ԉ&P&,&t&T,0P0  0 S 0 00S* 0 0S  0R 0 0R,0 P@00 0S0+ \ ( R,0,0,0$0( ,0( P(0,0 00 \T00,  ,0P00@ ,  000S0 @0 P0  00,0 @mT,0 P0 @0 0 l:d: -LM0P@T`K0&$pK  0pP@ $0DS 4&T&&؋& &$0 $?$ 0S = $0  0R 0P@ $0 $0@@0$ $0 0 @ @0$  -Lp#P@A 0@1A 0 Ps `@0PU`P``4000 s@0 p-L M0PK0%@ `K 0`P 0S 0 Sp p -L M , P0 ^  0R 00P,0  0R r0 S R :t Xʄ0S00 t0 0 0S0Su00Sb X00S rV tQ 0SR:X00S :t> r07 SRX 00S*0S$R"*r X00St0 0 0SRr {sus0suu0sXR0S0 uq000 0scg9 -LM 0R ) 0 `R 0 8 PFp`0@  ( P0S@ 0R 0@ 0 R@0  0-L @\ P( ^,0,0,00(, 00Yo \0 -L,M,0$p 0  0 `P 0S 0+bBP@P@@T  000 0CX:0S/S X0h 0c #0% %0 0 R2  0 /R @@P0S @P@x k D20<"Sa 0S0 0Z0SQP0K P@KH0 @00HK00 4 ,P P L D 8 &P@880[s@"  0 S?@#*R0@×000s@0/S @9<坔P 喔uV00勔㡓>@ & ;0 psdoPkHX_:0/S U0+A2 u%xgpg -LM$P$ 0 0#40 @ Rp8  Q R 4 00  ( @0 < ", 0 /S I  , 5R  /R  2R0 /R, KR, ,0 lR ?Ò00b0 /R07 00S09940S009900900S 0:00  0T 4 T 80 0  0@ P0@gP 1"00@060 M$P R R0 j7ã000b0 0 j00 0 R090@4 Rd RR R  00xl00CS<<0S;P0$ 78 R2 P0$  3#0S \@0S:00Q %P  80S   %9\20S 0 0 j 0 ( |`V   |0S  4 R|`V   x%00K X0@@ @ p< RP0$   <@@X 0.S0.S0:, 0/S  0b0j007, 0/S 0 b0b040SW0S8 0Q0R00SI@090&pg @ -LM80@0 p,0  ! `0SlX 0 T !#PP p U00ZP0$  P0  0`0CS ZP0$ ,0S P0$ 0 ,0S 0  $;0@ < RP . $ 9 9p@-@^P 0S 0 0p`0^; S 0S1 0S  0 `\ 00S0  0Q   ^ 0S 0S0\@ 0^@@ @@@ ` ` 0 R 0S 0S 0\ ` 00 S0  0Q  0S0\@ 0^@@ @@p@-@`PR 0SN0RK \ ` RG R 0S 0S 0S  PP 0S 0R `S00 PS0  0^   0R 00 S00S0  0Q R0 0p0 `S00 S0  0Q  R@ R 0S7 R 0S R 0S0\ `S00 PS0  0^  0R 00 S00S0  0Q 0 `S00 S0  0Q -LM @Rp` 0S`V^ ` 0S``X  P0S P0S@@V^ ` 0S`` \RP 0SPP 0RPP^ 00S p-LM0@S`P @P00S T0 0P PPP>pp 0-@LTP vP@@T00 p-LM@PT` _P`@@Tpp0S 0S0SQ  0PR 0P  R 0P 0S 0S0SQ  0PR 0P  R 0P P0 Q0P@-ll 0@Rl l0R  0@Rl l0R@ 0-h0MLP\@PTT 0L@8808 @0 @ 0hK :g8D:gggg p-LM 0PS`@<P @ @@@?Pp?(9'@ -0LM`@Vp ۮP `VV  !=P@P ` 0$0 P0 00$0$(0$0 '/Y 0<@$:H- P 0S P 0Rg p-L M 0@00400 S000t ` 044 P 0  PK P 0 0 0 00pbtpcg0S  0"S  L00 \ @0D0<0804000,0(0H0$0000 00 -L MaqQ1@0\00 .00,  0@S Xq R%Lq R 0S ,,ٍ0 d000 0P00@4@댐0,90P<0@@PR P TPU>PU T RX0X0X00T X0 D  D ~40S 00|080ggxpc3iggg`8P0S \ R`0`0`0 QP0\ S\00` `  -PL`Mu 0Kp d Y P0@0  P4p 0P 0 P Pg -LM400CSl1l!p2?0`PQ@T | 0U @T $q<| 0p P pp5T` 8 +8 80;804 40S<0S  #PT Y40S  +   00 400 ]3ig -80L @P`   <800 !NfD <p00Q00S0<0 PP < 0W0 BR00S< #H0S T RX L0 X0X0X0 D00D0s< T T RX 009gg<00<0 -LM@\HD4t t0P\DT 0T0 X 0@hC0TST00T X @Xgg -LM<0T 0CS@<0  h| L<0SD0 h3i 0-|0< P BRL< @  0o0S)<0SD0 3i-D0 H R<0STP^X0X D0X0 TX 0T0 TX 0H 0H0gg-H0D 0CH0S<0STD^X0X 80X0 TX 0T0 TX 0gg -`LPp @T P0S\@P T -LM 0P@  80 @0S 40S <0S 000 400CS0 0 3ig -L M@0 K  0 @ P|& -L M | 0S; QV4 Q80;808@;80:0|0<0 S4 D0pH0S0S T RX0X0X00X0T  RT d0T0T X0 PXphfD@4 40RV`x99g99@-2@H?0\ | 0T \40Qg -QLMp@`P$K40 P@T$ -LM@80  | 0P |0  R Q4 40R< 0P0R00S < -L MQp@@ @\ R h1PU 0S PU-U A@@@ 0,0S S - 0 iXS0` iYQ&0PU 0S PUU $ 9@$ 2P$ P 0PYP|9$: :g -PL M0 `L 0 0L!X P@ 1T0 0j04` \,  P0S ,KP! U\pT5P@ ` ,L5P@W,p @0 0j0 H0 R4`4(,0 00!!f. g:9g-|0S80  0 R | 0 S  R4 40R0S -LM\0PS@p$0  0`004P %; 4 $0 <$0Skd RhSfRd01 ?8`ᄀX\ N4P@* \0R\0ń0d R@#P@A0\ 000   0V0P@@T@ 0004P :040180 R 0S  R0\7@ \ $ \` 3P@d0 Rd0 0ǰdg -LM@0  01Q8 p-LMP#`@4T  ?800`VPZp& p-LM0`@P  0p30P$0<$0$0<$00 0-$0L @P R  01 R P 0\ 0$0  p-LMP`\@ $30U00S I p p\ 0S jAP @  0S p@ 0S p @  -LM`@pT P R0 U@W L墎X @垎0 |P  p㑎g993i9 -L@儎<0< R  0S hw(9gfg<9H9 -1LM 1R  p 0`PU 8 00S80`PUV Y'Z@p=E@G=W`pGY(3ifg': P9T90@-QMP0 @-PT \ ,P^Ѝ0Ѝ0@UЋg: -LMA\-P   -LM@pPp `pPD00D0 0`Pp0S P- L p00Csp0 D Sp Dh"bw`9 -LMPp@`d`hP 7 V p0SPR0 @R VP p0S8080 X80:80-U@ S80580D!0"`P@ {lQ  V p0S RVQP  d R p0S R p0SS0p Sl0S G0 P@>p0Sl0S  2wx999 -L`p(l@PT 80  @RW 0x l0S h 80 s0WS 媋99 0-0LSP@@400CS|00 L0L h0h S0h0hP 0劋9 -LP  l R R000 D  l0St0\D0x0x0x000hd!Ce9 p-LM`@VP8 P00S  R000   pp00p0!Ce 0- @RL R000 80D hP l0St0QD0x0x0x00S0 00@P0D0lP40SP 0? S 40|0 R 0 C!CeL:VUUU p- LM@`T PᏥP  @TL0@Q @`0(0Spp$: : -pL@`T PgP ` @TT  R 00@T 0 @R T0 $: :4@P -LMl0@`tL4p<80 `x` p\ (PTP`|p@8PP `p  99949 -LMP4P1p ^0P|@10` @Hp@< @0@Wh@T  @T\l@T < @T :9:9H9999 -LMp$ R @0L", P< 0PP@80004 H` 0PPX0`00P 0x00h0Pt00p0PT>0 <4@PT P !\咥\#100E SP\@T,^@T \咕\#10l0E SppP\@T@9$9P99999D9h99999,9999 -LM` P |o\0,0 h0@80 ,00@ 0P@ ,0 S 4,hD0 QK A 1 @! DQ q P@ 4 80 PP$  0 P d;P@^;P   0000P@0$ 8 $ 0$00$0$4$04$0$0 0$0 Q?KpP3@ $0 h! Z$0$07T8$0$$0 0S @P00|PYT-H! 00000 R0PPP $0 , 0 P@ (0|`&12-.*0K0 P@0 0S :P@:P  00P $0000 03P@40SA0@ 0NP@|PU 0S(K T|PUT 7`0 @T (`,Y 0-LHM D040 X \ 8 0 \KP5P@ 0 L00 -LHM`Pp7@TdK   D0`@ @@ d <0 8P P@  0ST0 0TT00 p-LM`PP@ P@4 0R@ p  @P , -LM@(p . KK PP 4 00 `@0"0 0 P  `0P p  000 kK PP PP ` R0 PPP uP.0@0 `܀ 000 $#  0K⤐K0 )K9KK  @0@ 0 @PP! 0 090@T, 0  P P0$ P40SP  PP   E@K* p0K 0$PP o 0 (00(0 ,00C,0(0~ ,cX{ : -LlMp0`$0 @6PUK $0 S $c D0P dP `0 \@ P@KUx@%P00P 8K0$PU (|dg$ 9 -LMC0,0 0 P`pP A6P@ 00  \( -K KP@P HPK (P@`7PF@ 0@K K P@` 40S-@ 20S 40S@  0NP@x" P@s  @K_KP@ 00ZP@b 0P@Z @0P0@000 P0! 0$%  X0K`PK0 $K4K DK @0@{0 @P0@0 ) } 090 d @ (00(0 ,00C,0(0  -P,0 S ,b,LW0S -nP  0 P@] |dg:0 9 -LMԀ0p$0 `V5P@ $0 S $b@PK 3'P@ZPF 08K K P@PK M @eTp '|dg< 9 -L$Mp0`$0 P5P $0 S $b@@K &PP@F 08KD K PDP@/,0 P$048,0.R'|dgH 9 -LM`P4P@0 RC 0K@ 0 夀 P P@pW@ KHP W K! 20:#: Q0 <   Q @TK K0K @00  Q㄀ 0- -LHMd@K` p@0<0 ` d @ 8p PUT@40Q0 `P @ <0 d 8p PPT0S@ KPj P@KP P T0R TP -LMPpz`+0(@TK0 @  p 0 `P@0@KSK0K K ˠ0ˠ| `h @H{ 0R A@[Yxg -LLM040 0XK0 T0 X , $P H@4K80$DH4 K Dj D0S , -L|M0`P pPW 0SR$40SN  S0R0D 6R pYX0@@ 0@ K0  P 0(P@`@ 5K01#5#S0 0SRK 0 Pp0Kp0 hd -LLM 0 p`P100 0pK D0 H0 l p L Dp P@``Q  @0 P@lY@ -LM` PD0K0  P MpKP@ 0 -@ET0 30S<@ p m%0 -LM` P0K0  P !pKP@ 0 @T020S<@ p A%0 p-LLMD0``K@80 \ ` 4 < PP  pP PP -LtMp0Kh0  l dp PP `HK40SP 08 0b00K @@KH0 D 0 4P 0P ,p 8 0 P -LM` P@0K0  P P@ p 8P0$ @0s# X2P㄀K0 @0  0 @~0儀K 0 P@00CS@ -LlMP` KP@ 0$p P0S $0@0s/ 2P㄀K{0 @0  0v @  0,  B, (0 ,S0儀K 0M P@00CS@ -LM0P#Q`0K  @00   ` P@ 0 p儀KP0@$  0$0 :#:0  0 @ -LhM0P#88S`4 K6P@ 0$p dP0S $0@@K0 :#:|0  0 @ 9 0,  B, (0,2S -LM` P@0K0  P P@ p  P0$ @)0s, @1P0 R 0儀K 0 P@0KT@ 0@ x0 t 0 0 @Q@㄀K0s: -LM 0PK`0 0 0 P 2P@ p P0$ @)0s, 0P0 R 0儀K 0? P@0KT@C 0@ x0 t 0 0; @@㄀K0s: -LlMP` KOP@ 0 $p|P0$ @)0s8 0P0 R, 0儀K 0P@0KT@ 0@ x0 t 0 0@ 8 0,  B, (0 ,3R@㄀K0s: -LMpKP`P;,@KS 0K40040  @0K0  ` rP@ P  P0$ @ g(0 "c1, ah $ 1\ d0 ` 0 0@,K "P@,0s0,0 $0s0$0  -LxMpKP`mPC,@KR 0K40040  KP@ 0$P P0S $0@(0 "c1, ah $ 1\ d0 ` 0 0:@  0,  B, (0 ,Q,K !P@,0s0,0 $0s0$0  -LMp P@0K  0 P P@  `@b4 R0   @T @ጀKT p0K0 @ -LlM`P KP@&0  X "00  @$P 40S@ kP@  ,00C,0(0,P@Kh0K0 0@ -LM` KPPx p  0$@ 0  P ,00C,0 (0, P -LM0!P`@0 dK0< `0 d 8` P@ATp14!Q K0@ 0 ` P@LP`U 40S> 40S@% W@W@TU PKT@ K0@xv\P0vtKV U@KPP40S@@KPP,,xg p-LM0 `P0 K0 0  P P@@T|@K0|0 "0ˠˠK Kx {P@ p}KP up 0-LHM080 0\K4 X0 \ 0 WP@ LP40SH@ 8KHP NL0eHP@ 80@@T8 KB@ -L -LM@D P  0S$ 40S,00,0 -L$MpP`' P@ ! 0  X$04\ 00K P`0pK`, 0 ,,8K 儊 -LM`@P P  0  pW$040(KS ,00,000.@ W  -L$MpP` P@  0  X$04\ 8`K00K P0 , ,,00`  -LM`@P P  0  pW$040(KS ,00,000.@ Š  -LdM,`0p@ 20 S ,  0(0L0(0$PP0StPK 00 000 @ 0$ iPPk 40S-P? S>P<  L 40SP2 mPP- 0PP%  40S$  0]PP80 @00@0@;80  00 q"H@KzpKP@ 00uPP  0JPP $z0P % 00Pl9 0D0$ (0PP -P0L$  40 S',',''',''''80 P 80080 -`@p @0L0C@0P(w0 @ -L,MpP`@3 @0K0D0 0P KUH P` 8@ 40 L@ 0P , HK 0 @R800 Y   ,8 P00R00S@HK 0 ( -LM$`Pp @04 R 0,    , l P` `, -LM$`@4 R , P) PP0S $0 P,  p 0  ,  000c P$ -LtM0 K @8P@x0t 0 400C S6 ''''''' ) @ K@$;DL  p@K8P|`DphHd K \0K(T K0@ P@`pHL P  090 @J@   *09@J -LpM$`@4PApQ|'|''''''0T 00S00 KP l00b0 0 pL0PT8! 0P 0`;8!f@at $ p-LMP@`@P8 < 0 8'Jp PX 9 -L M@P@(0`0 @p -$ LM  00K: -L(M    00 K: -L,M   0 00 K: -L,M   0 00 K: -L,M   0 00 K: -L,M   0 00 K: -L,M   0 00 K(: -L,M   0 00 K4: -L,M   0 00 K@: -L,M   0 00 KL: -L,M   0 00 KX: -L M8 0  0 $  0 ( 00 (Kd: -L(M    00 Kp: -L$M   00 K|: -L$M   00 K鈶: -L,M   0 00 K锶: -L(M    00 K頶: -L(M    00 K鬶: -L M8 0  0 $  0 ( 00 (K鸶: -L,M   0 00 KĶ: -L(M    00 Kж: -LM00 0  0 $ 00 $Kܶ: -L M8 0  0 $  0 ( 00 (K: -L(M    00 K: -L$M   00 K: -L$M   00 K : -L$M   00 K: -L(M    00 K$: -L(M    00 K0: -L M K40  0 $ 0 ( 00 (K<: -$ LM  00KH: -L(M    00 KT: -LM00 0  0 $ 00 $K`: -L$M   00 Kl: -LM   00Kx: -LM   00K鄷: -LM@P08 q,"9 -LsPq<"9 -LM@eP 0 00 0d: 0- P0LS LP  80;80@00h 0-0P@L 0.0S 00 0$: 0-LMPP @0@0 - LrP"9  -LLqh"9 0-80L @P P<800 +E80 0|"9 -0 L g -LMP`P |0R p  $0Z40Sz,7',7',7'6'd5',7',7',7',7'1 WI* 0s 0 0Sژ!0"$Q2 0Sᵁp ( KP (<0S$ΌP0,qB $0S80080(0 z w0* @}P@ 0 W*|0 R 0s 0 d 1g!Q P@0Ag*$bЋgbbtb -LDM@PH D 0`S D 40S S DD0ß| 0 0HŒ PD HT 0SD< |2  Q92!a1 \3 0@K `0 PD |(,0 0 R00C S0P 0P 00C |  0 U  Q  RD0| P DD< ||<H4/PKTPK0 ?ĠK᪶`vp0TP K`p0@ 0jPX!T 0 D) @KPDH |00@<0H0aS@1@!UP 3P@UnH0STD|<dUP0K8K0;T!52c~HaȀ2ca10 0\რ+ <@4TP *[O[O @@R: 0``( AP*0 P@:00@C "b"b0#l00X d2111H"c#b1 `130$AmQggt7\7:#9@-0PSpU0 0 000@ S  p`U 0 0R0@0 Sb0 S .000@ S  LpL`U 0 0R0@0 S00茼77E-` M@p 0 0 \0 0.\T.0V0 Ѝ.\ D\ 0 S.S\Z\RP J0 S .S RP \ZUv R0`@e@c\ 0  0S Wpp0S 00Np ^\\pPEP*0  0S Wpp0S 00Np^00P0#02SPp3^_000S00W V @V^P 6!10F000nR^`VL 0 S 0n0 lS0d~0^ 0*0^ 0:bP0u S .S PR y0.STWVMꌻ70@-P| U@B .U@ 01 c0 C  0 R0Z  0  01 PJ0 R0Z PJ0 R0Z P J0 R0ZP0@0000  0@000|@ S .S A-@pP@  0Xx= ?0 1 C@nT0 7#30 T00SP-@T`,J 0P$0S!^Z@TJ 0P0S^Z@TJ 0P0S^Z0S0S ꌽ7p@-@?\00\0AS`P?@01 P0 0RPu2 0?0 1#0C0 R0; /R0 0S"QZ0 R0( /R" ^ 0SQZ@0 R0 /R 0SQZpp@Np00a0C0p00Np00a0C00a 0C 03  QZQ p R .RAQQ 0Ғ?AcON -,0L;0 -0:gg -0LM0吐pP`,0 ࢂx 0  AT 0U @$0V0W00S , P3igg@- @ $ 0 201 R 0\ R R $0^0T00S gg0S R00  -LMpxP3Qp`@` PU,0K @T= 0P"<@,0P, @ @8@00 `$ ,P@ ,T 4p 0V 00q x0sk 4K 00Kp P@ \4 $ 40 h 40 i 4 0464 0464 0464 0474 0474 0t4 04 8  004 00 {00  h0  00S(K, K PP \, h h ,0 ,0 i ,0 j, 6, #40l, 6, #40n, 6, #40p, 7, #40r, 7, #40t, t0, #40h,0xh0, x00#40h0, z000h0, {0004 ,x0sv0004 ,x0swW ((Ulj i0 | n t0rp h0 0h0d -LMhP88 p 4` x0s v x0S:Wqt0 40 , tpdX0A1G\0$ ZV `X ,0H `0Cd0 0@K@fP@ 0O$ 00dPh 802 0去Z0xp$00W 0, r 40KP@X0, G2# 4Q x0000s0廻X0`7#0a#d0 dX0A1A ,0KP@ $ Dht#9 -LM0P8@4 x0s.h0`)x U*d0X  B00C2!3r T0Q 0wPp0$0xP0irx 0`f#9 -LMh0@ kh= 0-PL@a 0S=00 0 -LM`@p\0S 00S. &\0S P$ 0p0p\0 -LM`l@pp80< !,0eS0!W@ PP4X0T l -L$Mß @@@  YS04Pp D0 P t\0 'h0! Xx0SY ` @0 b2@ZP X0x d#BR  Z `0D 0c2# ZPd0( K`0`"00K,`fQ|"|"4 010001P*0x000 s0 \80K  ;wP7x0 qD0 4Ht0T$p T q! (0$冱 (0K$p [Pp( $\ W (0SD] j@0T$p@0R4$9@$9 -L MQ@p`d%X` 0D 30nR\050@ 70 0 `NPP X 0\ P -00`X H a0N 0-LM$P 4@0  @0 -LM00(P0C4`p00 P,K0KX PE5 0P@600K4@K00@P@-4\0P0 R (0U  P 0 PE A\0 0S 4"P@ 0\ 00U00S°4忰 -L$M40@0 < D <0 D0PJ 4K 0 K0oPp<@00K408@K@姮Pp+84P@ `0T*PU  0 @ P0 `0T: zWD00D0  vP 848ph8dPD\ -LM4p`0K4K 0PP-00K408@K@PP84P 0R *@T T 0S P0 0R:&`# 8 -LM⤐Kp  | PP@$  0S   @T9$ @-@T30SQ @0(0$ ,P@{`40S|0" 0Q| P $0 LM0 0P@  m$0S 0V@ T 40 08  0,0007x0s1 KP@  O0@(P000@KY 0Za0Y  Za [| 00 04@ Kc[  9P010R`\ 0 0wP@  o b -L,M|0`p YPP YP07 V$ 0@ 0@@P U $0000  0PP(KP!4 4 :PP, ;80j080,0 P@  0P410 $8 !8 0 UP42 0 $" 04800 $" 042 4$ 2@S\P 048<,0 0$(,0 2S<0 \80S0 4S2 x0  048<80 0400020U 0E8  R:0B0Q 8\ 4@ ,0@0!@ x PrH 0,8<@D < 2B!?04 H @D0H00cD80 4Qt0LP 3R3 H0 x0l3H tR880l00P R*l0 4p0s4 C@`\ d0sd @0RX& OP|0@@,P 0 0R  Z P ;. B<)ԭ,ѭ0,0 |Q-P00B UPP< P ` PP$00100P0010h0 0 刐 |04 "!;42 奫PP,0<P@ &sP 0|0,08 *8 ,倭0,0 y sP sP sP @CYP@V0  x0H0 ?"!0 #L,4$ 8<@0H&%0@ 4| 0 04,0dgh$9p$97x$9 -00LM p-P`   R0|`@0Q J`?<b;_$0 :$0 " -LM0K"@ P0   -LM d0 0d  L0 @T0@TP,0``rZ$0,@0Z  -Z ([| $ | r p-LM40@SP0 0<l0S 0S K`V p 0{0S0 P -LM R`0(  $0 ,` h0@Sph, K 0S2TL B 0PP$  &$~WL'$9 -LM0@ 0K5P0 00  00 00$   0- @P L@vP00 4 0 0 -LM䑟0 ,0 @`t0 pS( x0RP#N*K y\ KZPPC04 K0 !P0 PK  DP @P -0  < 0 0/&00  K0PP0  0  ,0 S ,A8;Rp7RLKN KO0KJK00FKH KP0[ 0P0K|dg$9xg -LM 0@Rxg p-L M<0@SpyPP `K--0 004 0  0 00lj i000n00rp h0 0h0 0-LMPx0h 4l0 0.$ .10.!  0 @4@0m -L M00PKp4,0 004 0 00000h t` Px0s@h0($240 h0 0 !1@00#!  "  004 ` 004 0PH` x0 @040 (8 Dh0@ 8D040Ld $ 4x0\ 00@ 400(0 vi 80qx0S 1\X `H@0L aP` 1$E,$P`R lj i00r0n0j0rp h0 0h0Zm -LMP@0S` p0s 0s0s$0sH0sL0L s0s@0s 0s0s40S 0ql  0P(0s] 4 0R C P \00 xP 40 (0s (n0]00s 0rp 0Uh0 0 h0 p 40 Q  Ph0h000h00 00Dp 40 Q PDh0h0 0 0h00 00h00s0s -LTM@P 0ST 4` X 0ST h0ҥ0D0 TpXx0 R0S*XX  P@0K0\0d 0L0 TpLx0 hDQ!0`Q!\H zp`0pX `K c ٚ@pKT00\ p S; X`  bƚ8@Kd0 P@勧@0K\ 8d0H HP0bSP1TL P 3@8bT0SUD0SPpP0$  T000N,0STXx0`K pㄚXʵW`  bzdd0 @pK8KPp D4K00 K0P@00K8@K40@%@ -LL P.\ K P'@ PK K 0@ PKD @ P `P0  0  0 ,0S ,0J J妽;[0 [ 740w 5 @0QLKN KO0K0N0 JK0E0FKH KP0[ 0P0K5|dgx:%9xg -LMP` V$ P 0@ B`TgeP`}Y 0 @`phI -LM@ =- -dL[ML 0 ,0 d! dA P! h0`! 4l! p! >K @h |A  KKJh ! P 0@ 0 6 ,0S ,A0h1 `LA0X Sd1t 2R\1 2 x0s, h`V# `>K/>KX X`P@ld\d0x a0`V`!\T KOK\ `1QKd =KhPP >D1ROK@墡PP HD1H P0bT!S0!P1 0U*0S S0|1  Q > | >KP T1  @ 0 PU:^hA0S`LA R0p0l0!h0XA00dNKx XxQL0 0P\PL0 x0 pĂ0 4ȌS \p@3 (@K 4 d|!R<  KK7(@KA?A/(@K0K0000h0 S|! :h!MK >KPP  lAT p 0Lp \0lA H}HHx1s KtAtA?(K K?K 0 48<S@1\SX `H@ a0C`p  1PF,`$`h2 (K 0<|!MK| 0@ HNK0H圢]`/>K<@0R@@0@ T`! SbV~KA_x0 s@0041 81(@KV 3 V) (K00000h!0S:MK9PP @ 0l1S pA@DpA Tl1 `Vڒ @0@ NK 0(@KpKK,0?h\0(KKK,020P!p1 l 0 pc|dg%989:0 <0< 0< 0-LM0 PR 040@0T  R00`0X @ cS  0 00 -LMPp 40@0CSBtl0t`\l | | 0 L0000s4@. 0R40`X  l0  P0  t|0sPDtHLx:%9 0-0L@Pt $0@Mx 0"P  0 0.$M0%9&99$9 0-LM 0Px @ 80B00  B40R''''''''0     ;0 0 0-預@0 @$0 @ M! "Y lpb"`0%&&/@&0O% & "!! @!0P @`! ЍCCX8^n좙N - QLM`pd XQS :QM Q 00@ T){0iTP0; |17. @P P% 0 P: 0 S:Y   4P `@  ) 0 0i 0 |00Q  Q iQ Q00  0-80LS@P0 S0  0S S00Q0 000,K8P PP $&9H&90 pg 8 8-#LP $0X  0X H0 ػ: 8 80-#L@㵿0PS᩿0 - 88LM#q0PS  0R~㒿X0 0rpX0 $0S1 $  0$00S\!S :0S \D | 08 `vV- #V 0S c `]0 p 0  eR@TQ 0 0 @@Q>K8$@L\#`*0  0  Q 0 0 ) ig`&9 -LM@b D0S H0S\_0\0L p -LCMq 8 8#$ P @R `52 P$0 S $+,IK J/K0NPP(h 0S$1(0@ RP0  K 0@ (lPᲾ {(|dgd&90 S 0 4   0  - 8L8M#@`pj;0SP$h5T \5T{ ?P5T0;0 #<5T 45T 0S t80@S m0P080b@4T 4T004T000P 0h4T- \4T P4T@0@4T=0<0(4T 4TL0 4T0004  C K 93 0@S0@@H03T 53T- 3T t3T0:0d3Tz00S0@0v QHrp43T00=0k 3Tf0Sc _2T0D000S0<0U2TQ ,2T$ 2TI0L0 0P0 0T0>2T:@2 82@T @/0S0+ 0) 2T 2T1T0S 0S 1 0R R   Q  0P P 0T 0T 0T 00T 0T :00S0T|0T*`0Tl0|0T 0T|0T |0kB @sB@vB hB iB jB@fB@qB@f@xB@tB@|B@nB@wt@oB@::~fyBrBpBuB}BzB}fwBgBvtmBfBlB {Bܻ: -LMP0R,(Sp@TZP,@(NY ` VA P `PfPԼZP,( -0L@pTP`/ 0S0 cPV 0R`@TV 0SP㨼0@V Sᚼlg0  -APL` 88#WP@ } pR:0S 0S  0Ps $0S(0 $ \]d ig p- 88LM@#P*1`s  p,0<@80IX0` 0X0 `PA : p-LM@< 88# P1`0`S0`0  Q0 0 0S00-ph -LM@< 88# :0S00 0 P -LM@pTP` 0=  00 @T(\0 z<0SĆ7 R-L`Pp U @V@1 `VPprGp&9 -QLM`p P 0 PR@T 0=00 0 @T(e\0 2<0S101p' -LM@0 0 $K01K $@ 1[!0 ! -L@M 0(K( 0 $K01K $@ 1[!0 ! -L M Y pp0Wp`XP4  R400400@0 @ @0`0K@,000,0 j0  尡 4:0S$P X 00S* P0  $   ig -LM@ mP 70  e0P00  70 -LMX0@0CSX0P(P,PhP P  -LP`p @"00P, d 0 `0YFlg|&9 -L@T 0` S V@0D00`PU 00S PUQ dp0S S l0SQ `h 01lgbx'bpg 0-LMQP-P P@K00, 0/P0S000-0T@K00, 0PQ0 Q0ܻ:ػ:,0 P h0SlPpg -LM@\t  uP( h@0lSl00pp pgl \p0p0p0 -0 @LT`P p 0S @T p0 S 2! 0W*Pp lg p-LM ` 0S 0 PU 0S PUp 0SU 㰹@᥹pplg@-00 Q:bP, Q*@0R : 08 <4P 000aS a00R R 08< 408 08 -00 Q:lP Q*0\:00 0P00 0 -PLTM@`P p@@ @0S񟗱' ''$'4'@'L'T'''''\''''''''d'p'''''''''''''''$'0'''@'''''''''''''''''''''0'''<''''p'|'''''''''''''''''''''''(''''0'@'''P''''''''\''''''''d''''''''p''''x''''''''''''''''''''''''''''''''''''''''''''''''''DpB `0K> `0Kq:070A4 p0.0 c+0\ 0@$0  g\ 000S 08< 4 Ud Kd0S 0 0\0S0 āUh Kh0 \P*U 0 P: cR 0P*0 0\*W \*0 RUhl K9l000| 0 RUTp Kjp0v w0P:UC 0 P: cR 0P:0 } { `0Kw `0Kqs0àpǠn0<àk<ǠigpelcaP07*0qZU 0 P: cR 0P* 00A S@-@**\ *!00S \'\''''l'''00@S S S\!0S * R:!0R0SS `S0SS 0@S S S S 0SP`S PSpS S0  P P P00S*00S:00*S:0P @Pܻ:p@-@^P 0S 0 0p`0^; S 0S1 0S  0 `\ 00S0  0Q   ^ 0S 0S0\@ 0^@@ @@@ ` ` 0 R 0S 0S 0\ ` 00 S0  0Q  0S0\@ 0^@@ @@p@-@`PR 0SN0RK \ ` RG R 0S 0S 0S  PP 0S 0R `S00 PS0  0^   0R 00 S00S0  0Q R0 0p0 `S00 S0  0Q  R@ R 0S7 R 0S R 0S0\ `S00 PS0  0^  0R 00 S00S0  0Q 0 `S00 S0  0Q -LM @Rp` 0S`V^ ` 0S``X  P0S P0S@@V^ ` 0S`` \RP 0SPP 0RPP^ 00S p-LM0@S`P @ P00S T0 0P PPP>pp 0-@LTP  P@@T00 p-LM@PT`  P`@@Tpp0S 0S0SQ  0PR 0P  R 0P 0S 0S0SQ  0PR 0P  R 0P P0 Q0P -L M88@ 00 P9 [h&9pcg( -rL Q0P0 졟 0 R1S 1 R d 0R0!R0a50S 0S 0R%L\ 000R00R00  @P.0  0@ @P0@0@0@_ 0Q!R0 0! RmD     0\0 ?::::8:dg&9 -1LS70@Ze0PX0H0`  ([p00(@0 (x0ed0%0d0` Vq@A@0 @P `F0V  m[ : ( p-P0LM`%QU @ :01ph鯳p: 0-L⩳,0P@T @T0h雳xg -L`㕳psH0PU ,0SPUh邳@Adg -LM@#0 0S00@ hxg -LM@000  0@pnhxg p-0LM0`PS@00P `0S $0 0`0S (0 0`P, `p >:gxg&9 p-LM1!S0#R@:5 `0 Q0 00   `00`0pp`0  p0`0 0 0 @0  !  !\@P `˳0S ph000 0@@0ʲ :AiAi 0-L⿲`@PQ \0000  `00`0pQ0h餲 : -PL㞲5";52p!t1x"x2x!1p,<E<4, R 020  0 `  R0 10  0 @Ta a 0 RV 5 T 0 0R0B 0G @TQ Qx0  0 0S0C 0* %01$(,0@T 0 R 01Q @TA0 !h (5&50 R404 D040 0 40 ((((p:8%h0ixg ::dg:$h -PLQp` 0@S` TV@0@S0 0C0` *n000 p-LMK`L@T 0S PU  pP  p-LM@*P`% PP 0S 5P@pぱ@_{-ppp -0LSp` 00C S `0gS0S0 C RV> PgU; 0S8 U0S6 0@T W0S  @TWPT UP\ x 1`?Bc00L` S g0 U R0PC\XP0S :gfff, ,00S0 000:tg Q00 00C0tg -LM܀`0 V$0  % P"0 @PPPTU 4pK kW P`PU@00T00S$0 S $|dgtg:&9 -LM0@S  P, _ 00ah[h(:Q 00 -L`20pPU $1S PU@T 0  R @T VP 5 0S 0 S VPxg -Lp20`PU $1S PU5 @T 0 R @T0S nVPxg -LM@Q20Z,0 1 1PU $1S PU @T 0 S @T`V 0p\,*0 0#\:Y H(P  P 00 P$0  Q 0 xg::: -LM@1X0\ $1S \P 0 R Pxg -pL"W`4@T 0S @T XR 5 UP Q UP0PP*0 0#P:P P-L`Pp @@T Q P P@ 00 0@ 0S0C 0 @@\ $0\   r2 ( p-L$M`00 F0P@T 5 @T7 0S H7p5t!0R$< K5 2Kt|dgxg&9i 0-5P0L5@T h@TQ 0 S11 10C1\kJ>0h!9 -LM5@05;>`0 9hi -LM@*>9(h 0-@PTL @)kT00000 p-LM`㽮p0P@T %5R0C @T᭮80phf(51S xg: 0-@0L@PT 0TP @T00xg -LMPU, `@ :U :U :0SP:U ,0 S d ,bPp 4:U  :U :U :U*:U Z9U$ \ @p  0  0,`05 @-P%   $)q $@T(@K 0 (0K'K1P@ <P&&P@D@K  1P@ <P&P@0 S X0T @T @ZTg|dg('9(H80'9 -L$M@0Q0  %2 @00S@0 0 S h<55P2K4 K t@00CS@0ʼ5<55 |dgH'9i -QM 0P P -Ѝ0 ЍP0  ЍP-0 R 00  00 S00  R0000 0  0Rc0 iN -LpP@W.$!`0tP 0pP@ 0S 0S @0S`n@hg: -L$M@@KP`p $10` $0 P@  0S @TT T00 ,.=Q :g -L M\ @\*x0\ 5S\ v40\ -R1Rh 2i 1i i i -L$M`Ap@` AW`0PD0 2` Uc@V 40 40 d0S @40  \Q L3 R*TA`@` R񟗠/(h/(d-(h/(h/(h/(h/(h/(h/(h/(h/(h/(h/(h/(h/(h/(h/(h/(h/(h/(h/(h/(h/(h/(8/(h/(h/(h/(h/(h/(h/(/(4`K 0`P 1  5  ;QS D0S02K D 0  dPP7` @ *K. *@0 S<K"㲡p#!1R001SP1Q0Q1`/  0P@  Zc1 017! 0dD @4`K @BK 04`K `*P02K= 03/`30<K @0 @)@0$!0)d@PA` 402( &)P80@0C`80`:ʚ;T'9 -LMp`Fb$1W(07 % 0(   R \ 0S  R\  LP  lLP11<<10P@   0@T "48<#H 1 5 W3T s T3 3T 00S*0S%0S" 3RQ 0 0CA  0 bP`  c o$adzb0  !  !@P p0S B 0R 000S`0`0`0000Lb0S/000 0@@02T' 1T0  !  !@P pḦ0S ЦA000 0@@0嶥5ፎ50  !  !@P pኦ0S ᢦ@000 0@@0別 KP% oaoaD0  !  !pc:AiAi8%h5݆0ip:@-@@:@0\#" 00  @Z00pc: - @?LM p0h0hE  \ 00/00D00S J , @40ȝYZpc[(b] 0-? L@P1lSh0 e l1d hfPe 00`2D0 0h-,( -LM`"@R \0700`"R\@-@ *,  0!\ "0! ":Ⱦ7@-^p`*#!^ ",!1 #: 770 0  0-0LSP@/ S /0  0S0S 0S0S0S 3000  00 00l fd0ST ^L 0^ 0 000  0 9:?:-:3: -LM@pE@,`K4K P@Q,0[ 40[`B 0T  `J0S  @WJPP0 007 {P@"   00 p`20S`"00&>`B0d" d" +JPh2 0h24 7  -LM@ܣ@,`K4pK 1P@`B6T - J0S  @IPP00CS0 ᶣ R0700 d20Cd2 IPh20Ch24ᚣᖣ -@LMhsH: - LP`@T0 0 00 h0%0 t1l!0 Uppd0f e@RD 0 l'9@(=(Hg -40LM @P0 ,0Hg -LMp`P@ DP 5T` 4 20Sn 0@/ 0S[ SAPP  0R?000Sp0p 00pŠh0 .!  , !4@P أ0S | 0@P 0OТ000 @@Ȣ000_ ὢ7 0t/_/`@ _40 3A0 'wP.0iAiAiT'98%ht'9Q0X0ᰁ0Qx0Q *p0Q  5RA05L00R  R R / 0Q0h02i 1i i t@(i -  0@  -@L`p  PP @  0` pP0 -'9 p-RLM`@PPU@p 0-L P@\p 0  /0P \ 0 P-'9'9 -QPLMpP` J WH 1RI 1RD 0S?0@S000000@ PU P@U 0S @T1! : P UR*01P UR:$ 0U0P00S @ P ` `T @P` P5i 6i( \ 00S \P p-LM0 PP `@u  0#U TpT0000 0  NH 0S  0 Q  0S`: -LM 0 -LM@ P`P, 0  xSPc0JSTU00U0S X00X0S40  ([- PpA X1  Π L0Ap,0HDL (P$P` ( 0$ ( 8D ( P0380 0< (8 00 S 80S <0S Pl0  )P04 | 8 80,0@00 oꫪ: P0- L @T 0S $0PS 0,0PPP 0R PR* q  000 PH0 -!40 00 p-LM`0@PT@!T 0 S 00 0 0 0d0 00dS00 0p P 00 0 p-LM@PTP` 0S0S|2 v0Sp 0P*S~ 0Su |Rk <2R` 0SJl0SGVB VV  2R V6 V1  0V P|00pV p0S p}z 00RpD <00 CD<A1R V00|0SP0S K0S 0  pq0VV0 DP |0( 0C&0BS0#< q c0#22c !kp鈿:B p-LM@PT00P``V,0Q#8Q<QQ([-$`pd0( !$D ( $$ ( $$ ( $p -@P0T@!TL0dp` 00 S  D 0 00  0-D$ <0P0 4 PCD@L<A#|D 0x0 00 0@Pt X0dPTPlP`P0ܾ:G-$d A?L0CR0`@0ltAp0PppP00S M,0 8, .!0S 00Q^Ѝ0 S0R 0R 0RP 0R 0R 0R 0R 0R 0R  0R 0R U: 0e,c0 \CRPEڈ0Rh00S0 p-LM$Pl@40d 0a`SRQ` v`F $00A?C0CR$*0S d00l  !l00Sl0 d00 P @0L<#0@0l0 S0 Rp0 _h0d TD< e0eed h0T 0rSe \80 0rSe \` 0-L@p0p`l0RSSd0 @ 0PL 1#0,< @00`8 `@0< 0Vdz $0dA?C f0CRs0S dXX l0R X0RWh B al x0X `Pl :R80@X0d0 d 0@P L2#0< ,@00` 80`@ 6< 0X00CSX0d00d0^ Td P00 `0d0T0L0 Rd 0 0d X0@0P L2#0@000 )l0d 0C l0d X l0SW S^Td P00 `0Ud0T00 R  -L@pl0SSSd0 @ 0PL 1#0,< @00p8 p@0< 0X h0PW\0p XP x0R*$0dA?C g0CR0S 0dXX l0R X0R0S R} p RX0S,`0Sl00C ` dl000 0 SP Td P00 `0d0T0d0l 0 Bd0l 0S\l0 a0 BA`C}l0  Bp0 0Cl p0d0PUdP0 @ 0PL<#< ,0@00p8 p@0< 0p0CQpd 0 XX0d `O Td P00 `0d0T0G0 Rh0 0c S}XP{dy l0SZ S2`0STd P00 ` 0fd0T0"0 R d 000 S 0`0 p-L$MbŸB 1!PPPU  Q 0CA 1Pڨ1PPUQڀaà1#0CP!\1P0PUQ8 K0QP 2[PU02K00Z pP2[PU02K 00\U 2[P02KU00ڔU 2[P02KU00X\FX`PA0  4PUpxcwcX7,yc̿7ucvcpc@uc 0-0L PR t0l0d0d ;`0$;X0X 0;T0΅&MK(˅0h D@uc777 0 R0&=  R0ZL0  R0Z000 00$0$  0t G-0P 0T@T`0 .T0T{X˓ 1 Q:0 R@0T1 Q:L0 R ,00@ TT0THPG-0M  @ 0"00\0Z01T+!0PUE1T P0`1 \ P @ڏUZ0 d`H0 RL0 R 0 0A000J0CZ0X 蠟0P NT;PE! S`P\Ѝ0@ S c0 !! 0l0000PnL0 La0 0! R $00" 4 L6  -L$Mp@`K 0R0(P00"Ƞ@TQ0 @RT000 -L M, 0,  pt"t2pŸ Q0 `@00 PR 1 0R00!0` Tk`0 VŸ 0SW,00!0?`V `FV0Q⨑P 0Xk!T0C 0X l0X0CC!1TkTD!0 0000 Q0PP X[ 0PSX˔0,0C!T˂0.0 oQꔐ`唠0 Q1ҵ> 0 0 P 1   B0^ 0 0 0b 0 0Sڃ=LHPG-@TpPpP1^`ᶀ&^@\ ^ !000 \ \ !000000T p \pP QpP ^  Ų000t G-M 0Q  ZP C 1Z00\1 ZAl~dep@0dQ.ڰ010   !0 0c^ B Z^  Q  00 S 0Ѝ 4 010\~ \" 1. HD0nPk40($000 "$ 0 0c\à3 B J3c@0d^@ڰ3 3. 0 "$ 0 0c\à B DQ8ßJ0 10 #0#40 0bP B2 yŸ J010q2 2. Ÿ0   ZKl2Tb@0d^:@P2 02. 0 "$ 0 0c\à B  QJ0 10 !0#40 0bP Bl J01Td1 D1. D1$a@0d^:(1 1. 0 "$ 0 0c\à B  Qژ J0 10 p 0#40 0bP BV< J01Z$<0 0. t -LM@+, +&(uD01>0 R@P 00007 -LMR@ \`pڈ,A0 B<0(0#40"(0aR# A  R PtF000 0#40 0bP B Q \PڤG0<0 0#40 !0bQ B PU"<0a0 P$0 1>0 0 0"$ 0`\à @PU I& o0 1>0 ` G0<0@0F   00 "$ 0 0c\à B 3 0S:3s`P0fU\ß+050 0 "$ 0 0c^ B  3 #Ѝ+0 50 0 . 2嬢` 1+ 0nPڰ0000 "$ 0 0c\à B <2^ ,2  nPPaoڸ0000 "$ 0  0cP B pGW113<`ӗ`Ӆ!0tQ0nP?ڱ0000 "$ 0 0c\à B  1^V P1 nPpaڸ0000 "$ 0  0cP B 60 0 000   0 0 00   vwcX7xcuc̿7,yc- 8Q Z y8Q ,8Q .\000 0A Q 0@-@0SP Sp 0 0"$0C0 00 0"$ PP0x00t S00 "$0 04 4000S 0 0 -L@`Pp0 T  0 &Ġ`00  0"$ `Fv 0 `Fv00 -PLM0 @\ K @@@ 0S0000 0-PLM@ \ $PU 0 KS(  000$P P-LP`+ (  P pp0V p 0`f 00FS0 `@P 0&SP  ( P-L@p 0S `P 0S(d((T(((((((Q 0 0A ^ 0` 2 0P0 #20S 200Q  0A  00` t2l"c0#22cP` D200  9Ws |k \_   0 S00000SL  0C00< 0 00Q: 0 A0 0 80 PQ) 0 A0 0 40 00Q 0 A0 0 00 R ` 0h00W  00000` 0000S0S 08(9T(9h(9B(9(9 0S p-PLM`  Rp0S00 00\/ @Q Q0#S Ra\00Q00S0 d0Q0 @PW 0@P0ppSp 0-80@S<0L0 P0BSR 8P0(U 00 0$040<  (! $ -LMPp(@  P@  ( `P0@ <(` ,0080 ($ -LDM`4T 00L PP ,0%T%0`0$p PC2a \ qp(`(@((h(T((̎(((U XU 0uPUP H@0 0R̆((((PE@0qPd7t00K4 K80K,KL,04 80~P   0qPE0 $p PL0 0c P  T 4 LP j07sPE) 0qPE0L $p P$p PL 0 0c L0 T4$p PL L0 0c 0P0  T4LP 8U X& 0uPUP H 8"(#8RR00Pp 00L( $p P0 0c 0P0  $p PL0 0c  T4XO Y, TP> Y @ T@! T @! TM0 0dP 0ST00dT0 d0S00CT 4 P LP 40T0 0TS, %T%, 50c0C2l P Yh(0Q ST0 T%0c0C2a 00(S QT T%0a0C2a $p PL0 0c  T41 U X 0uP UP HI $IR@2P0L@TL0@(  P x 0 @0 'wPE#50Y*U XO 0uPUP H  !0#50\qPE: Y p0 S000L0  ,P0@0(" 00<0YX@ '*@U *X 0uPUP H:ğ 10!@P 0 Pd7t  @" 00<0QX@ :L@0@K0 HK@  LDK<0K < P@tL<@D H0P@W L (!L0 $D0H  @0 $p PL0 0c  T4P LPP O LLL4 T 00P R,0%T%0b0C2a 0LS$p P U0PEJ0T 4 P LP 40T0 00T S500$p PLLHjLDg$p PL0 0c P  p $p PL0 0c P@ dL (! L0$P@ P U *X8 0uPUP H:7tPd\!X@ " 00< 0RPl7| Y00PQ P  1 ^  00 L0 $p PL$p PL0 0c  pP L (L0 !$ 00$p PL L0 0c 0P0 0 (9(9,:7(9)9 0-P@L,0  C(($(@ $0 -L M0 40`Rp<0S7,0b$0,0 0XP00  80Y @1@!S   0P00,00PU(Pde0PX,0$000 00 0c  4P<<0 S00  -WMLMh , h d ` \ X T P L H D @ < 8 4 0 l% p5 =K hUp h@K1hK0PU1h0hS0@5 B hK1S@T|E Q1 Ph K1SPU5xU S0!5 004T5 *hK1@^ JT:hK1% R% JEUK0LhK1 L@PU `E dpK 0PU@@QKA ApP @T! E0Q00hPU:|x%PPdU P ubU |Eh0K10Cst5 E| ^\t x%| j% 0@j$ P !R  t|0a CTh0K  *@T*0 R c@T:`(  0 P ` 0 0Y0K !   <$%  `5B%05 Q=K  E| ^ʘ%|hE1hW <$?0#0#% 5 % *l%QL*QE` 0 %  p5H0T *K1@T:|%0BC P%@8P%0C !0S %EbI80C !0StN~t P|xP| Cx%E0R0T00S lE0np!P  % 15 Y PP 0-LM@P 0 P @xp p 000000$)9H)9 -LM`P 0pD SP@ p0 p 0@0 x0 8P@ pD0 p 0@07$7p)9)977 00a0ဿ:yc -MMLQM $ P 4  0S0ʀ!QxxxaxqGt1t!JNK4 $  @D01Qڐ 01Q4!Q01Q!Q01Q܀0ԐMK00J  01Qڌ`p0 0 p`L 0000C04 4 0$0 4 x:|:4c` P00S 00CS 0.$)Pg*9*9*9*9+9@+9 -Lp0`S0S @0 S 0S0S PT 0 @ T 0 P 00 S 0  0-0 SLP@l 0P 0h -L`lPᆱ0 @Pp0`p 0` 0@0 80 00 00 0( (0@ 0HcLc`((((0( 0-0L R (0Q R0PS0hE 㰷|@Pt 7 0T0T P*00P:4P 0 dgTgd+9Hc+9LcDcLg+9h-\  0RQr r0R  @QP  0R r0SP   -LMrPrXp@`@  Pl 0Sd Vn 0@S`` @0SR T  0R @Tr0S@2 ` T00 S 0@0P 0SPP R 0 0S 0S P0SY 0`0P0SP0`0PP!pjP`pG@ W@ 0S V``@0 SX +9 -LM@FP@ p-LM`P@@U  r00S 0P@pV 00S 0 \f'PPp -p @L` PP 0   0R L'PPVC 0 Z 0'ZXrrr0S PU 0 00\  PP 'Pr r0R S c'P0 Q0SQ0SPV -PLPp <0S 40 P 40 0 R 0S 0 R 0S `1@90lHз$HpVT nP@g `VTV d`80080:b p-LML@0`SP P0  hpyP Pcp@-2\ \ p"Q`@0  n `&"`b.bn  n ` &"`b.bn  n `!"`bP. b0n  n `&"`b.bn  n ` &"`b.bn  n `!"`b.b0n   n `&"`b.bn  n ` &"`b.bn  n `!"`b.bn 0   n `&"`b.bn  n ` &"`b.bn  n `!"`b.bn p0 Q| 0 n `&"`b.bn  n ` &"`b.bn  n `!"`b.bn pPcy7 p-LM@PT7` \\0 MPL P 0 a!0S00@@ p鼿::Xg -LM@00C R000 h` 0 Xg --1LM@0T` ,0 p !0R @TW LP 0 \NP lM0S  ;!R 0RP* P!W 03<PP L  0.NPu;p:M0S   >%P ,8%PXgʚ; -LM Q`Pp0@X S 0SUTX Qa((((((((( (d((x((((((0 W(;T :9 0S EKLV 0S80 0 0pV p 0S 'B--P@ ჭ @ P 1 +9 - 0L10p ܳPP X0@T L` R@TP0$hgdgg 0-LM@P0 t@k$<d0d0P0 0S0 0P p 0 +9gDgdghg+9 -PLM@,P 0Pp1P {P`  tPP( pP㜠`P@0P|0 p0orL H!  ! ެγʳ:dglg0 0P0 1:lg 0-L@P 0S0P0 AlgP0 ,0 0P0!R00:dg -LM@ \ <0S 40 -LTMP@`pp@ }lKD }hP R P0t U P@N 0KWp  40 80080 e}pp0K 8 `Pp@ 80080"p@T 40  0t0  DD 0h0  ` 00d0 <0S 0 X @0 T <04 `Z W 0S D$ t 0hP 0S  00 0pg -PLM@0 80 CR8 40R 0 00  B 8QJ@P 0S0C 0  ݲ0h h +9\gDg+9,9 P- L 0SC h龲 ,9 -L\M p t `@Px@ P3@$ 0 x0 &30#0P00Sp 9 00 0R* @\  T00R00S T !000lKDㆫtlK`  x0h dp P  Y000 \"Ppp@0S Pp:Tp\ 0S 0S40,  \lKDKp t`p0KlK8 ` <` 8P h dp pT\4`@ 40 040p 0 p `A@pgtgxg -LPM`@K`Dd dd0K \ T 0X 4 0 r PP 0 R  @PPPPP !P 804 0C80 0 R @PUBPP; p-LM80@SP`P 0S< 4\P1\Q% 80S0S  RQ 00 4\3`p80S 08000~4QQ4P 080 -LDMƟP , T :{X 0 \ Pp/0  00\ X. X X#{t6\ ,0S `,!4P D3P@ T 0R4 &000T0 T0r0 g00CS5040r 40,0,40r 0l00lP 0Rd0 P,P 0 X0 0@ 0<0} r0 d0 0 P`2 P0SY@8008040  b   P` TP` }P40407740d P` 40)` 80S`0C80V 0S0C 0 40 hP dP _r \ DLJ D4r0 d0 0 `LL0r r 80h080qe00 7PZ dP !4\ d "C'7P\ 4 XY @T 40 0\0 <@0000D R0 00PK,   P`  P@ T P@`0 0  P` 40@ I 0Jd0S @80S0C80:0@d0h R800C80 h P40@0Z40 0S Y000@80S080|   P` tP40740n6|dg(,9Dgj\g4,9 -LM,0 Q0A00S0C0`p00pS 0SC 0C00W @P P®P@ 1 0 KU   E5dP 80S0C800d040,] Pd T0X0S XSXW@-0 @ 0Q!0P*0 00P:P:`@ -LP|M0p ,0 嘠 I?  `Vt @KD0V0d0 吀 `P 0PK0  Z?h 0K Vp> VW"@T 80@ 0CR80 @0S$ 0S0C 0 @P 0<0 0 S 0 p1 ,0S d,  @P @T 0 80SZ 4080\Y0S P@~ 80@ 0CR80 @T @0STpZ 4Y3A2P7 @ ,|dgH,9l,9 0-LM\P@X T 0H@[<0<@ 4(000̿:gt,9`gTc(|,9 0-0L PR  〭P@0 H 0QP  00@0̿:`g -LLM@`Tp# dK R 0 0 0 R000 0 0W  PU 0S0C0 @T R000 @D㸦 0 ` r Pmg,9 0-l@LTP  tR 0 0 0 R 000 0 0  0S0C0 l@T0,9g -H1pLMX01I,0 S  ,/a20PV  v00S+pWT wP`  01ȟQ0X8 XT   ;P0S pV W0 p@00Y P 00 0 Q ?Q KD͢ 0 K0  0Rd0 0"S0S 0"SPP XGP p0@S񟗞<((((((((0S @K 0K@SPp R L ($ 800C800D <050 r00 00K K2P㘐p80080 00 0 00 D 7SI | 00 < R  0@  @0| 50@0t0  t  0 K0P  㪨P@ 5%` K040(00 r0L0 0K0 0/7p-P@K""0P0KP NK h@ -p0P@/p P  0 pP80080Q 0 S00R0#S0Sm SKAPp RPv|Pm R`Z @ P P 0SO 0S0C 0H @ 00 0 <D30S 4 0 0 4 L $(< % r00 04  @0S 0S0SD0h@T;T $0r T $000 T @Q K   K@4 0P @@ P'P 0S0  |P0Sz Py  0PEpi MSK .@Q r00S80p080;  P Q0S%Y*" Q 0SS P@  0 S:9P 00 ?0S@00 0 8 0PP7 |dgg::п:H-93iH-9 0 000 0-@PL0Ƞ00 00 0 p-0LM@`,PᴠT*\0 T0#03 P00Sp@ 0B00R@@ -LM 0@PSJ))))pT,PW`3V/ @ pp@wU1 P 0$ 0A0Q0  pN/@ T0S0pᴠ0-; -1@q-`Xppp -L M` 0 P Y YpYp XpU,p P@1P 0$ 0AQ0U p P@ T0X0U00 Sp 00S 00S 00S 0S P aPp0S P0 0UX U ,0000p ,֟ɦ -L` ^@P+P@ Z p帀04 0帥U 0 0P  0mg::п: p-0LM RPpP` d @5050`,PϨ$ $0 phg::п: -LPLM @p \p Y `lKDmWV WVWT 0   lKX ` L P@; % $00  l0I/ 0 WV WVZ'  00lK` d0 h P@ 504 000r p0  0l0I/ 0 Y4 0, 0 0+`Vg::п: -t0` pRLlPP 0 @e `$$ $0 phg::п: -LpM⬡0 SP( @p^ `KDܞ< 00 D\0   @0|0 x 50p0 7S20 P0S `V 0S(0 S (4 L r0(0 080<0< 0 0圡P000p0LK"፞"0L0K9P JK d 4 0 |dgX-9 -LLMlKP Dp1`V  R 5R `V@T 0 X P0pS X 0S;0X0 @T Z  0Z @T0T0 L0 `0 T 0`0 0 L P0pS P 0 S 050$00l P0005d05 0Jl0 0 P000xg -L$M@PPp 0AS^DK` 0`U80 D @ 0 < Q nD0P0CS|)|)P)d)@P0 VD K# V! @#Tn,P80K  X8  000hS0:  10 ?A1c0㖤P DKD0  n  pP )gfffpg -`LM ⸦d1}i l10㯳>o lz.0O00pP@0S5PU@ڀAz> t1R!    L8' ).04Sd00d0c 1 $/0Sl2 ?p2`p'KT0  xU 0 0P00o 0 00 = S000 0S000 0S000 >S000D)`:p8jt-9 -LM@K(l"{Rp2 p2p2 ah 0P 0P>@0C !p @#2  N=@0C40P ,0P(0PN=@ 0C! ̇ -?0LMo.S@ 0`?C0CQCD0T T0000 0 -9-9 P P111< 1N P PP1N  -LLM ğ0{@P `,0 j' 0h dKh O뫯hpz.0S7WpWd0[PUTK8h R h5t0A0D,0 S 4,/dK0  @T@P0d0[Uǖ 0  0 0  B0 ǖǖǖH2 1l0 0ǖ|rh _W 0PUp p 00  t0 |P@pP0U}l0 @0]ǖ5,# d[t Qd K0 R QQdK0 d K0 h Ð R h B03 0-ǖ 0&ǖ 0ǖl B0l 0ǖl0 0ǖl 0ǖz@B|dg-9 7 Q00S Q -LMħP8S vSp   Wpz.0S7 B `<` ` ``VW z> @R4p@TP1 R P47 S7䗅4S gV ()))))))))7<7J47<P` W@z>\Ġ @Tyupp lS Sppp 0-0 0 7LS@P< Q)L)x))x)x))x))x8 0\G000 00CS))))0800008080:00;0<0<0:Q 0007 7D"R  -LM 8@SC \ Ȁ 0 S05| 8A-_─pP0@T`t0 2 Q 0 0R<<0 Q@TpWPP7 -z.0LS1P` QS1/A Vn00S^ ^q υpVL 1q R 000^Q-1q> 0 R!1?07^Q 1q> 0@T@p%0`MI1q> 0@T@0!0q.S 01000S.97.9 0-7L P|000 RzΠ0S 000S20S@O0$0T0 P0Q00R0S>S  R!)!)!)!)!)8 1S1 R70 1 SR|7 Q-L' QQ[$P P  P  P HP 0P `P lP  0@*S")x")#)x")x")x")x")x")x")#)x")x")x")x")x")x")x")x")x")x")#)x")x")x")x")x")x")x")x")x")x")x")x")x")x")x")x")x")x")x")x")x")#)7nr.9 Q-L QQ20@S 8$)@$)H$)($)P$)X$)`$)h$) `0lH$7P  P PnP P, 34.90 0000  p@-1 @^PT * ^0 0S0:[0x(0CR  x80x8 ^00S0 00p00d0bT00x(R 0S00 000Sx80Cx8 ̫7.  0>. 0 > 0.> 0.> 0 2"()') -NLT` @\D0D0D0>@D0H NTN@Pp\8 SP  @pWZ9  h@P$')')')')')')')')')')')')')')')')')')')')')')')')')')')')')')')   -0L0CS$()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()()s 3 -LM0@0CS `))h))|))h))h))h))))h))h))h))h))h))h))h))`))h))h))h))h))h))h))h))h))h))h))h))h))h))h))h))))N  hU 7  0SO<1c1c10 < 0 0C-LS&*)*)*)*)*)*)*)*)*)*)*)*)*)*)*)*)*)*)*)*)*)*)*)*)*)*)*)*)*)*)*) `$| -7@PL`@ R0SO/9 00CS,+)+)+)+)+)+)+)+)+)+)+)+)+)+)+)+)+)+)+)+)+)+)+)+)+)+)+)+)+)+)+) P} z$PY 0R0  %"!:1`1c1. #0 p )P0 SCLR0S # 0@8S -LMPU, K@ p `K  @ {xK tUp0[PU0p0K@0 ,0S 0,W@K] ႟|dgH.9 -LQM `, KNVh l  p@# K]KHhl!o0(K@   YK V08 `V p#H@,0 S 4, NK 7|dgX.9 -LdM`!@0|  ,0 Pp  P xKY@ rK  0P lKYP LKh0hZZx0K0L00@0 0D 0|  0 ,0S ,|dg-),)h.9.9 -LM─@KP` p$ jh  PK  ῞ $0S $|dg.9.9 -LOM─NOKP` p$ h  V_K  ᑞ $0S $V|dg.9.9@-PP@  0@  0@ -LM 0`  4R$ pP& R $0S $$OK w QROK QOK 8PK Q +|dg.9 -LMx0Q@4`KPp $0  ڔ  $0 PS $|dg.9 -LMP0b0a^, d@c3 )^'Vpf  pb08#h"00 G㢔00C8#hOK  S!0P08#h_ #<" a0b`0 ,0S ,1  ᶝ. 0p00  pW@J000 _K  㟝OK K 㚝 Y 0|dg /9 -LM0a b0^$ d@cp ^V $0 S $7 @F_KBI0 _K1 X OKKS  0|dg(/9 -LMNPT`p 0S , @@TH ZP@!  `#0@0.@D >@` 00'R/0?  PT p-LMNPT` 0\!  @@Tp 0S V P 0- PLP@ 0 @00 -LM@P00r -02L4M@, 0T @0X 0PK080 PNKO0K夜  HK⠜ BK✜XXPK @ BX %P P@O 0 0 L0p 0 T 0  0T0 ☀\ $4 0@1 #2\0`%8XP.騗Y Y ^0>757 ^0,90,9 0x  |/9 ig:xW)G-P#00400M0a 4 㲐ᴠᶀ0p 0@0 40.#40 !44 "0 0 4 0"#4 0 !44 "  0 40"#4 0 !44 " 0 40"#4 0 !44 " 0 40"#40  "4 4!0 0\0Ѝ7G-8M#800Qڸ0 000庀40( #40,!$$0 000p40' #40,!$$0 000`40& #40,!$$0 000P40% #40,!$$0 00 0@40$ #40,!$0$ 00 040,#40  "4 4!຀ 0 $ 070pp0 $!070`` 0(#098PP (098@@ (098 (098   0$0#00Ѝ7 -LM@ B{P 00 -LM@P00 -L$MhßD 0@ ,0 ` H PL DPL 0 0kS0L  0 SL0 D@LP  H \ 2\20 ŠH01L0, ,400<@K30  9K  HBDL0 peW` 0 UPVR 0@f0eT@!  ᶵ  pdH0DWP`PP% 0 0 0)$))L  @ H0#L 0 0 0 DL,0 S ,Z@ D=0=L0SP@ 0kW 0 0`S p ; 1H0 0R\ ;LL1H0 0=|dg/9 -L,MH `P0D ,0 L H0T  0RHzT <@K 8 9K4  LH0P HP~0 0CS 0 0 S T `TP0H@00 TeX p`P  0 V`U> 0@e0f T@! L0vP ڴdXP `P@@K 0 X0L `P00P0 P@0Q H 0 ,0S ,D H|=0|= %P@ 0Xp 0 0PS ; (1H0 0DHx=0x=Y ; 1H0 0t|dg09 0S QQ  -L$M`P,0 S PU=0=M@<0<?p  Q8 4  U@ =502=50:0SPPU 0S 7S U1<#0!-.   0S=0= 7S ,0 0 0t8 7Ss 8 R] R 0P@ X Po; 4 R =0 =7S=0= 7 SpQ "= F WW4 W2 5 @W* W$ ]7PpE5A,0'!00@P 1p ,0t Ӝ7S7S00@  P7 0@ WPW(=0(= 80S~7S񟗁hk)Pi)"r H@, "0b:#: Saʺ0g:#: S,e 0aZ"%ZUPU`PE,e –2\ 0Q 00RPE2"0b0:2"r0b". 2S/, 000,0Œ`2S2"00C:220   "2"002 *"2`S0P@ o 02` -  LRN@8"# bpj&jV`V`FP,U•2\ 0+ 00R`F2ʾḢ2S2"00C:220  "2"002 *"2PS 02P -LM7`p@P D2S  82R =0=o|0 P W DZ00P00S7 1R  o o# ə7 T1R 00,0 D 0 4!P1<11 Z !1R001S1儡0W1刡 0 Ο4 ! !@0K  00K P |8S,pꈎʚ; -L0M$K0*`Xp,(PU@P@6 P0+PgU 0(0S0    B0cc  0R P  0@pXM(; 1H0 0=:zP@0/( -L M@ 0PS*PP8  DK D1`QB D?C0[@0 S 8x)x)x)x)@K ݌:K ٌ 0V 1@0C8#8#$0$  ]PP$=0$=4K@K ᶌ4K4K ᯌ,K0SpWD`ꪪ -PLMp 0S5 "48<#HTھ 0R @ `V  qdP$=0$=i0S0S  @D PP$=0$=骪 -0.0SL ΀> ^""  000   0#20 0$ Z7 2S0 R<= 0<=0 R<= 0<= 0-LM@KP  P0S {){)|)|)|)|)000000@KX  P0S{){)|)|)|)|)x|) 077 0-LM@KP Ë PP P 0@Kp ᱋ P00CS<})D})|)|)L})T})000077 -LM@PP@`p0 V 0 p0qiPj Q@0 @$1S` A0B8R p#hK 0 SD0SA Q)0 @$1S` ' BV(00"h"Q 0@4Q1 0@4 Q0 R@@0S(S0 F0V(0"h@* 0 F0V( 0"h@),0\0 e<=(0<=0\0 LW<=(0<= 0-LP\@  0 S  P 0   ˊ00 -L\M @p#TP0 7 p! "#0$4t p0 `&0 S\ T $Pl h d ` X x | 00S<=0<=0*SL S SXP  S\P  @=0@=0P R\ R 0SX0S 0 S1q> 0  R!D=0D=7S x Z H=0H=P0 / @ X0yPP`PP 7S "=  d R GT@ X 0S :Q.  '/P -0@ 0P0T   $t  0#p ?0#p0|0t0`0\ @37S 0VSM 2SJ  D;@:0 ĀX0 7S3 70 l R >!Y >00L K P00 P NPH00@  <008  3[d R > (0p 00xH KdP0d04[S +D0  4[S *<0 80^)<@#[ #[ < 0@S  \  40S7 \J ^H NPD00< SS 7 7 3[<.0[,`S0C.0KP X0 0P0 l0 3h #7p p p j P@`.0[ CS. K ⃇ "-0<0.hH K`nP0`s"m06 :  0Y0p 0x0 .  Pp @ 0x`=0`=2S\@  0S`@ SQ<=0<= 8 LK0LK P0Sd@ S7 -LM@pP` (=0(=7S ^I 0P 57Wp80p8X=0X=d2V"0  00 4R `80 P4 0 00S<=0<= 0-S nS S4P 0P RZ 0S 00 Q4 1 8 帓  40S0> 4P V: P5"-000|1 R 3 77 777L1 R 3  - 1 R 7677 "-000 |t076"-00h=0h==S 2S0P SQ<=0<=\ ,KR,K =PPy0Sv0S`r8909(7 - 0LSpP l=g@0V l=D V 7W 5!hꅨ0 0|t09 - 0LSpP p=g@0V p=D V 7W 5!hV0 0|09 -LM"`p w 0 St0@ 9 0RL%4R#2 +0 ,0 RN Ď4 @a 7 Z < W !0S9R>  & 9 1 Q $ x1t1Q 0P` 0  ""0B8S02ā, 200C:2 㫂P# `b2S  P0 $0ᬶ 448 00 0x % `% HS┶0 <  2,0a:#: S,0 o ''J* - 0L S` "!@10_ 0 St *0囯S }W 0 00 02S 0 S mI - 0LSp00 $("8k"Π' 0BL%R^RP 2S`SLeF,P @ 2@ST㇂00   10QO 0S2S `h  -LM7pS` "=  \ 00P@ϠD@x 0-"]0L @ 0S  ? 04\ 00;0 0S00\ \0S S0S SSZ$-MP\;  \ \ \ t=0t=Ѝ0Ѝ!Ѝ0\ @\Ѝ0\ ʀ\ \ЍЍ^\ \ЍЍЍG p-LMǐ@\`P p7  |8S 0S=0=p` 'P =0=p 0Sx`V 0Sx0|0 CR  0 00 00|7S`7xg0|g7p( -"=P L p ^@0 48#Π `10^:V0F@` 0$4"Ơ#2  V0F`@ 04#2 h -LP MLET ȠRN &`0,x@ x"=  <  20c:#: Sʺ20g:#: S=0= 場 g ʠ,ʠ \ 0m -`LMPp! @B' >:0 0;ypJp0\0C4[ B  y;R -TS  y3535t0c0u 0d 0x 6 p0&06p(l t8X p00P t0 0x0' Px00x07Wx00x0(*,x| 0-!@PL  '0;:0 yB0 [0C\y%#53c0t0d D0u & 64 0&,0 l p(p0t8t x(7|80(*, -LM7`Q 0S7 <4700CS@N@pP R YPp@ 7 B<7,40S R%\8S Cy0S00\8W00 {P P   -7^<00<L00@`pP0SpW`P@D0啉P\8SSd80 {P 3i7  0S764700>0>0>>S0>00>0>0>0>0>0>0>>S0> 0S S S S >00>0>040>0>0>00>>S 0>7677 :0 0>00> 000>00>000>000>000>S S S S00  0>00>000>00 -LM44;\, @P` ;\ ;\ :\o B:\  0S`,0 S ,3:幈P`1p ȠLȅ \9q> 0  R! 1?07L87S7S7 p R 4` :LQ7`9\9先P`@ P7;77S 7S7  ' P7;7 89\P`Ǖ ` 0S7779\) 8\{8DP`z!>  R 7 7 ;m4`7j7 g ;8\\t8 @Rh\@8P`T7@ 208S(84`7 P`BI'=7\ C7\5 7\-7P`,7!S ]74`207\H7P`0S 79 57 {:79 57 7w16ćP`96\D 6\6岇P`8 0 6\H6堇P`Pp 7P` |8S S S` 0x0` x|8`5qP`7S  Pp x0   YPp 5QP`:4FP`|7Sy 5A0AS2`t' 07 7 S'  |$y02c$02Y4\ Vx4\K +l4\7900K P4\A+ty@04\87S'R 7 cv- *'3\ 3\7@h3PQP3\7S >1{.  027#500.0083\ *,3\"  3\PpK! $v7S 2 P KP [OKT! :0;P0K2\s 2\P 2\7` 00!円P9  0 0$2\) 2\ `L Pp 0|S:̐K |  x`V0|00 Pp| 0S*vPp  |x0<P`rPK! "xP`kP0[ SN @ uP [OK((P7S7p7SLP|dgii iii093ii 7iii i8i$i i4i|i 0@T@ 7 0  7p Uh;AsN @0'00pP | -5LP@g707p@ O[Q}'p !L} H}7S7 '00'0y2 @: : ;6}- @@ s>03037 037 | =>0. >0. L7  0<70<~ p s> @ 0$9\d= 7 "=  D~p0< sl01N  0d\Ȅ0=  |0y\(X 19 p-LM`pP1q> 0p@T@L(1@@R p0S@7SS'L1@0SH @ ?"(8@S : R2 @ % >> @@ @@ 0@@ >,@@ 0 S@@ @@@ p @@' DP @ ;;P   -L$Mh5 `$  7L#H30 @<3K @R707W7PS{ PpF p8@S d Sp(_PTW5  Wp]2Y"7H 000|8'R ![0S |' 07 $0S $妰y7S7  (8SP '0S !0000y7ؤKVPWp 0 RpPP DpKppA 0  zPPDK0q> 0  R! 0S1 \\ ;1q> 0  R! @p \|dg19:1919 0-G.0P00000.0L  7  000.00000000'  <"-000000000S P  {"-0<07's\ 7Sx8 2x -LM81@Sx081 -LM@hx 0-@PL, z0818!NR00h  p-!0LM@P z02 |8 \ P=P 9B7`S  8S0$8DphoB/*I* p-LM`@`PUL=0 L=p p-LM`@OPUL= 0L=  ''z7p p p 0-HLTP ! aP@@T0 -7LSP` 0 G!B000BB@pBW B000 B7SSPp [[ 3z2S   -LM K`@`P9 A p@PAU A000A7S" lPP 0Q 'y[[ y2SA000A GA000A&7 -LpU@PT` Ap0S 0S`3`#0S:0S`VPA p-LM7`QP7  G0 9  2C 80C8 R xQ 0 Sx0|0 00C0–\8S$8p0  (19 p-LMP`3A@@D@.AT|8S p'A@phA p-LMKPA@`0S  AQpph: -LMwP07@ bP@ ( 8R 0S `pV X@ m@7 S U=0=@ 0`x@ -L@`P@K@p#P@ P@h@ -[PL@ p`o0@[0[ \xV @[0S0= `00=[@ x[00[0 mg0@-\P[@[ Q 00S  Q Q @T00,7 p-0@LM00"m00  =΄ 0 0P0D A909SS 0 phphbx0<0 0-3LP@0  Q  P"-000X'0R007673 777007  -1LMP@Q`'p10SKgp9"Ƞ2C3 ,^$1 R9) 0ǔ9!2C#0! `R$ 2S00 x0|8'00D2"=   iEB s00 0xi( -Lp`02,R^PP @2@S T\u000`V - 0@00"m0C00pLP|p 00C(0  0p<00O/00Drp 0-3L  P@ 00C07 7S"= D 00C(07'6 70 -7LS`P+p\ G1 L<1u 0R| 000C07`0 R "=  0|8Up (19 -LM%@: 0S$ 00P 47 -LM`4@Kp-0 , 80 v`XW@'0' <0 Pa T  P ,0 S ,凫 8KP77 07  b[@T 8K P<0 HZ8K P0|8  4'0 D<?!:<0@ 20 `,!ۘ &8K ^P t t0T 0@P@TP0PPpWP@@y|dg19 29,29L8D29P2929299 :090@-R9)Q??  @$,  0 0-WL@xQ 0S|0x000C0S 0 00|7S7x0|7p0 ?0!! p@-@^P 0S 0 0p`0^; S 0S1 0S  0 `\ 00S0  0Q   ^ 0S 0S0\@ 0^@@ @@@ ` ` 0 R 0S 0S 0\ ` 00 S0  0Q  0S0\@ 0^@@ @@p@-@`PR 0SN0RK \ ` RG R 0S 0S 0S  PP 0S 0R `S00 PS0  0^   0R 00 S00S0  0Q R0 0p0 `S00 S0  0Q  R@ R 0S7 R 0S R 0S0\ `S00 PS0  0^  0R 00 S00S0  0Q 0 `S00 S0  0Q -LM @Rp` 0S`V^ ` 0S``X  P0S P0S@@V^ ` 0S`` \RP 0SPP 0RPP^ 00S p-LM0@S`P @OP00S T0 0P PPP>pp 0-@LTP ,P@@T00 p-LM@PT` P`@@Tpp0S 0S0SQ  0PR 0P  R 0P 0S 0S0SQ  0PR 0P  R 0P P0 Q0P p-LMP7P@ S`` 0SI S p 0PQ Q 7S ' PP PS00S)))) 7SS' iPPP00'R' 00'RPPV 0Sp: -`LAAP@Pp Q2q TPJ 0iSSFPUA0 =7  0S7 q:!1R#001S@1A0A1/  0P@ 5  :p*1 01:0(7 0m29 -QLMp`o PtX oPd @pPP0!P21   r r' r7  ZZ: Z8 5 7S  PZ "pPp@0*!00`7S 00d7Sh7`0h70d5p {P 0"= @ 0@00 *7729 39Q0ר7SP1> 0 RPH)P)t)|)P1> 0 R|7 Q5 0Q 0 $ (,<4q7  "=  0@007S F P 00008K q2K  q'008K q'  q2KD0 "!=0=)0@<0 g39 *@-Ǒ\@ \@@\  p0  @K$40@ 00S@ 0-0@0 LPp@0 0-0@0PLUP#P p@0 -0@LM0p00@ 0-/^L@ *0SQ*0S Q3R /0SQ 0S n00 \0  T0  P (?S ?S000@ ip0($0 0 00 0@- 00  x0 p0B0 022 00 0 " 0^#40 7*00 40 Ǒ R  R    .00  00 -SL,@K0@K MP` p0 0 P o00CPS񟗪 )))))))))))))))00pP@xk$4@0pP@XKX:-$4X0@ <"-#400P<00P7   o>P S0000P oP o (P00"H  oP 0 8#H o (P00"H  uoP00@ ko (P00"H  `oP 0 8#Hz  PSo@@o0f0d0`77H39h39 -00LM0 @ 00d0C0 -"0LMP(@K0 `pL "o o00  0f0C07 0-20@0PLPEP  o@0 0--0@ P0  L 0#40@00 n\  0#40,/@", ,?#80,/(0"$  0  @ 02,4 0-=0@0  7LpP@@ @ze080-0"<""Ġ0  p-PLM U`& P@ U ;0 00p 1pho39 -LMppP`"(8 R000R0" C 0  P@  (( 0S 0 0 0c0 0 H4 -LMP'[ 2p:\ R   P \ 0 C[ 0<   0 4 tP`: @ d76 3#40@: ;+6 C7@S@ 1 R7 0S/ '0" '000c0 0@@m@@@@N@ p-LMHX4 P%$ `$H%X 0  `P@p -LM("HP0  0 000L -[0S 1 #:0 Z00[  0pS00C0PL 0<"= 00 0 "=  00 P`< 7@  p0  7!40 Z 0#40@= : ;T_0@S/7 0#"= 7 0"=  00c0 0@ @@ @@' l@ -LMP[(Q010#0Q0"h C "=00V  4 &P[p@,  V&40`  00#4000 0S&"} 30V00S 0 0c0 0  / + p( -LM("HP0  0 000L 0-Q0 L OP  00*2300#400C40$2#40  a 0 -Q L o@pHP$̠ P$H 0 0 p@T23PPP%40P  0C4000c 0 0 p-LM@ P`Q@XNP%̠$H%X 0V0K  $40@P00c0 0p 0-0LP @*PϠ  00@ 0#40  a 0 - LMR0 R S S S 4SL4 0,ȠL4 0,ȠT -QLM@`p G3000A3@W{ 2W' " W =P0= PP  0iPPZ = P0= W 0W("(aPPW8 PW W("(PP 5 !⟍ 00W WH( 0b("(PP 5 !{ P8#8((SPP 7Syo3939 39 -(`L"xxPP0  @0 0K00p @j  j p-LM@8#hWOPP 0 @0 0;00`jp -'[0PS 1 #:0 0 7[S00`<2L 0RS00C0  0< 00  0 4 PpR  PpL @00 岀rj nj' jj ⶁ*a6  3 #4!0"g7 : ;  7S70 R. 0S(' 0 0 0`0c0 0*[ '' ' m: 0-7L 0P@0 0! 0S0 R0 ?0 0R 00|0SP0xP0|P0@0000u0S 0 0S R0 0( -`LPp 0O 0 0P@ V h0bS 0bSv0S=0= Rh Rb  040Pa0b $c \00 P0S 0D 0B8S0SS<R 0 S-: &        8   0S  A  D  aP`x=0x=0S 0SR0S~0SzcP` -LlMPSt 7S, x | GJ? RL x`K 0@ p   x,H P`x0  p0@` , \,d (P)$ p#Lx4`|0 P` $ P: 1S :tP=0= R,0 S ,嗝x`a0b c@$Pe0S`ppK 00S0ST 0@ RV 0S|0SS?V  |tP|`  h|"-0t|xa0b cP$`e0S@ @ p 00S 00S S 0P RW 0S Y @PT00U00S`0S @ 8Q  0R  00 0x |w PX  KP0 S  0S8[S >0   p@  РK 0@ P`H,0d @pPK0 @`K <0 @ P ,8'x4!,P`p0@P.`J?`%A P 0P0 n@  04S PP t`V P@pO p =]렀 S?0 帐" wmf Pw"=  P\ 80  0R@@ @P`@@1d1c~p p ]4@砀0 0\( 00DP`F E0@Cp@B$ %d \8' x 4`P)Ap 00 @ P@dX f P`` pWY 0S  D0D8S㴠 dl   \T3@0 0\(@0p P`  0@ p $ %d@\8'xP  4`)p 00 @ @ d(e P`@p"-000  "=  ᘠQ =  Q 0D2P mpF DP`E0@$CpB@ %d \8' x 4P`)A @ 0`pP@ ,0$ 0Q pKBe pK -P 0SP  S  "= P t@K )e  P0S 0Sp 0SWp X!P|dgp49X49 4977 -LM7`SSP0S Pp =0=M0 S p OO [ " wd P"-000$7S =  Q  50S00hd! T@0L0@e0D2p 0xhW49 49 -LM0 p P` 0@0K  0lHP`P 0@ pP`4 8p |,#H p800%lpT 0 @\ `> =0=0S00a0b cP$e0S,K 00S 00S S 0P RZ 0 00 &R< "d  P0S 7 -LTM0 74 S8 X4PK P` 0@ p  ` , P`H04p  `PPpT,\(d (P) 0@ p8`$ #LP`X  4 P :8 1S:0=0=84P 0=0=40 0$ H 8P4! P4`a0b c@$Pe0S@ D ,`K 00S0S+ 0@ R@X 8jL  0R 0@1d1c p < =Zp@0\8< 000004p4DP`F E0@CpB$ %d@\8'xP 4 4`)Ap 0<0 @ L`@PdhL =c08< P\ DpW` 0S 008 00x0 |o D0D8S0dl  < p Yp @80 \8  D P` 0@$ p\ @ %d D\8' x 4P`)p 0<0 @ DP`dh b08< PHp  07SY8 =  Q Q 4pK p  0@ P`4`K , Hdp0P@h`4ld < 4,T L8'@P 4x )P` 0 @X0 0P508 8`!@0 0@-8DŠ0 Rd cb NP0S@@  S 8p"= D@ X49 497 -LDM, 7S0 X  0@ P`@K p,`H0  P`p<@p`,\'d (P) 0@ p0`$ #LP`D  4 P :0 1S:,=0=0 d Pd ,=0=0  !d _PH 00d 0$RL a b0LP4S 0,`4.J@1d1c1~p.H P0 4p 8 XP2@08 @\(d00F DP`E0@Cp$HB@ %d \8' x 4P`)Ap 040 @ L`PPcdhL d a,04 Pdf8  ,7SV0 =  Q N p`K  0@ P` pPK ,Hd0\`p`X P@< L.T8'@P 4x )P` 0 @D ,5,04 o0 !⛃,0@0x 0@0D,d dHp0p, 0x, |X49 49 -LM, 0P0P\0 0S   0@ P`,0KH p`   p4 P` ,80@` \,d (P)$ p#L4`00 P`  P > ,P=0=0S0`P ,=0=0"= 00 ,00C0 0 "00000  ,P5 0`! ,@0$0@<,49 49 -L,M, 0 0P0P\4 M? R? 0  P` 0@@K p`,H0 P`  0,0 V@ 0@x k4949 -LMp 5P`I Pc ]S·B"  $8 0@"  42 0!< #(80$H!400 R¯ c *40 5< m!~ <@040@7@40 4949 -LM0 0S 0, , <1c1c1"-d(Q!-  ᅞP0 00pc RΈ@0 "< 0N="40 `@&T P `c42 0!< #(80!400 RI  "= 6 g$4F0@402E##,4D0!8C#$D@`r00 ߣ0\0;D@`r00 У#@`wr 0ţL0@0 Q` PD 㶣 Q 0R\ 0R\|dg$h;9;9:h:9 -LMv@,冢T$$  ᱒|>94>9s* 000ᔊcdg 0-P@LP  0R P 8JP  0 0 000S  ꔊc 0-lP@LP 0S P8 JP 00@ 0 00ꔊc< P0S  P 008 Kꔊc --L MTP000, @"48<#hdV000Aڲ1 0S*P0P00 0p0d 00 /DP0000! 0`d0 0`0S S $ 0,0 0%,u@ RS 00S 00004ppY h0@0TYT 0, R Z @ TY h0@0TY4S  @4R R00CS|x*x*x*x*x* 0S 3 00"P 0 3R3Y h0@0TYT `0 ,0R Z @ TvY h0@0TY 0S04S `2t 2 `S[000,0%S 0S 000`0R 0Sh` R 0,S 0 R 0,SR(0 0 R. 0,S 0 R' 0,SR! h@T  0S @T 0ST 0 0   00CS{*{*,w*,w*{*000L00,0% 0S0R 0S R 0,S 0 R 0,SR(0 0 R 0,S 0 R 0,SR h@T  0S @T 0ST 0000S :S00 Rhg$hdg -@L0 4S`  0 0S 5P 0 0hv0sp p2 0 pdg00CSp}*p}*}*}*}*04S0 0S50 \i -LMq0P@S80 @TP  h0`0@VPTV R BQ0 00S U` PViT h0`0@VT0 R  00dg$h -LH0 R <0S Rh00S0ꔊc -LMp@P`: 0 0   0; 0T0@0 0P@0C@ 0P00PA0 0C 00  0,K0K0 +PKPy @ 00 0ghg -LMQ@P`p 0S T 0*@@@pg@^ 0 @$Phrh:hg -LM@ᇔL0P 0$!R 0P,0( 0S$h0S  S  0 S   0 R010`0 BS RA* 0S RR0Q 0Sڂ 0-@LPA>1P P .  b9"i i@!i #i %i giH>9 -LM4p0WR`,0 P 3Q 3Q -,0 S , }0S<0S9F/0SS40SS00 S-2U/ +x2U0 #l@K@> > \K>82 R  8K0< K;0K  0!LK >1U@K>0)T1U  @T 0 R @T1P 00ST 81U K@> >8 8K>5PKX X~>  PKH Hu>8 8p>5 H HFi>\C00YF\>J0 X 40QG0 ] M |dgiih>9i@ii T>9 -L$Mp, D0 @78P<`KH t1S t P@P D0SE,0S 0 0 S$14,0,0\00 (0Xl0$05 ,0( 0 L H75@S ,0 S ,{l0S0@K@0 l HH  I0S0H0 `P |dg i |>9 p-LMP@L<\`0P $!$1S 0P 㧕P000p5 L0Q0 p\ <00QV$h 0-0PL" 5\0<L0@T 5$!\0<L$1R 0@T%  i0000P0%  Y0 00%  NP0000$hp-! P Q|0Q 5Q\ 0 R \<0P L0Pxg -L(M0p(0 `BP' 0S 0P! 0SP hPU 0 S PU 0SU000  (0 S d(z 6 PCPP 0 0 @T? 0S 0@T9 0ST4 @ 0h 0 0R h 00h0hP0t0 \80K7 K4  H K P  R000  0S0C 0 6C  6C |dg$h>91i -L(Mp0@ 0 0`0CS0   0S z R000  0 PS0C 0 U 0, /0K@ K$t6ICz|dg>92i 0-P@0L @]\0 $ 6]P  010>9>9-!QD0* Ƞ  $0Q1  0 g -L M|B^` h/PP T2T"@P2L"H2@`@ 00  S `PP#"48< #ȁP 10S!0 0 0 Q(@<,$.4<(p , 4"!$<  0 00 0!R 1P(@<4(<"4$<0000Q(<4<,$!4(. , <"8!8 0 0!   P0 R<h07D0 坑00d: h::::3i>9 -LM0@00 @p000\P, `4  `3 Rx 3(80" S 0 4 \. 0@S岠0S P 000 Z *48" <#R*0Sp400 P @0 t 0Z801h0L2L"p @2@"p\ W/ @W(T@D#00C0P P*p 48<#\ 0804DPᾣ01`@Y"T@D000P: Pp 48<#\ 0804DP, 9KPp 0px0 0TPn @0 Qi ,KP_ PRたNo=$h h:::: -LM@0P p0`S_ h0 ^ 0SW0SRPM X1Q 0S<0C s< 80S$ S@0 @cP80SQ 0800(0`c0 1P0@@0 KH@Pp80 P1  0% L001/=巖$h3i>9 -LM@0@ Q0(0 <Q03?@0 hG8 -LM@@001P.HP)h0 # l~   R 0 0 0 R000  Q00000 S $h鲑&ꌍ h p-LM@P` P900P30800p p-LM@0P `0 R @ `y900`30(00pph> -LPQp `V @T h0  @T(0S0S@0S Z@  -LPMPH@p``KTD Hp7940L 00 \ 00X0  T <04 U400 r ڎ -LMH0@S0H0 -LM P("(@4 `p,&48< #80A 0TP, 00  0S @T,3S q h0  ,0 S00 S40 S80 SU 0S0S0S 0SG , 8 P80S 0S$0S(0S& 0S0S0S 0S  8 ޯP834 S\ 0 0 \\0 ,@ 0S0S0S 0S 0S0S0S 0S h0 ~(0S Z Sv34 Sr80S Y SYZ 0-H0LS@HP 0 E8@0 Q Q0S 0S$0S(0S  00 ,  d(0S 00( 8  -LM@\P` p  0RpX 80S0C80Q00W\ <0S 0  000 ) 7\" <0%@`V 00S 8Z R 0`V 0S 0`V100V@`cXP` V@40`VX`ꔋp $h -PL` R 0 0 0 !48< #Ȁ  1S0 0 0  0 0 Q 48<#P0 0 0! h  J (p(C< .$4 <($, 4,<"0!Ƞ  1S0 00!P(p(<4(<"4!<0 0 0Q(  <4<.$!4(, <,"8 !8 0!  m((p<,4.$< 4 (,!Ƞ'<" 0@0  1S0 00!P(p<4(<"4'< 00 00Q(<4<,$!4(. , <"8!80 0 -LM@( P"hp<4(<&"4'$%<(!8,"800 1P h0  P(0S3S3S80S0 S0P R000 R 0 -P L.("hp&$,('Ġ,. Ƞ"̌ ,@T h0  @T顭P3S3,S  P0T R000 R 0@@ -L Mp(`@"X, fT, K0 !100 <4(<"4($!< $p0@001p,KP h0 B P0 0 S' 01( <4<("4!<0001P' h0  P3S3(80 S(0" S0SP 0P R000 R 03S3Ȱ8 0R(0, S0SP h -(L"XM4"S !<4(<"4 , !<,`)$$00 1@̡ȁTp h0 Q@T  ϬP5 1) !<4(<"4!<, 001@pT h0 @T3S3,S P0S 0S$0S(0ST 0T R000 R 0@@p3S3,S  zP0S 0S$0S(0STi - 0L R0:: -L`MVp(#,0 000 30SA# 0V0R00S 0R:0SS S S S S S S S St"000 D1   ^P "48<#8SPPXP@* 0@TP:UP! 1 RPP@ 0S`T 1( 0( 0 0c0  (VxNd!V! 00 0`,   V00 VY0S 8#8#$0$ 0 81< 0@S": 0 @0 000P 000@0 #$0$0 0 :0:00:0< ; 1 @\!h?9(?9 -LMP h --LMP@p "48<#hdV%մ00Ҵ0ՠ 0$V$S *Pp%P000 p 00d 0E4P0%000 0 0 d 0 0(Sm1  @(Qcꀸ****0*@***P***Ⱥ*غ*****0************************TV****** *(*(* *(* *(*(*(*(*@1F#V)0 0V#R!00S4 0)S 003 |3!1\ ( 0 zCV00V0000YP0P00  00000@@ @T@1=2 R T#V  10VR000 0Ÿ0 00 (0K# 0( 0m,^ 1 R^1 坌,V1 R1 001 000 ! 00 0Sv<000mT@҉BT@1 Rb 0 R1 V004 0 RO V r R t0 QB `TP> 00\  0S 05 L0 0\!h:"h::(::::*::: -H3LM p, 001 C]P  0S2` PU ( @彅$1S 0PU@K20 ;0K< K 0( <K80 P@ L0P@ @ @P80S0C80y<`0Y `0Nڽ0PD0 `@` @QP Q TPU00U0S DQQ @e`@ Q> T 0@ T@d @T 00 0 "4 40i8#8#$ 0$  0!0i 00 0i0  BD21<1 9Z 80 ,0S ,p0 2 00 0ƽP  0 0@؅T T00T0L<0V 0%S L0VPUoP|dg$h4?9$h -L M 0@p@A`0d` 0p0#!dP10 0d0  0pp  -LMKdX? B8c0@ 2c2c@2`ϠAl  8 #, E.Mb -L MQ@P`90S S S 0 @`W*^  0[PivX|p0 pGWd`P PUaPZP.:\!h:: -LPM p᫄PP) 40``V'h@KD+1dp 0l0K8 ` 8 ߆PlLLlP@0@ ᎊP  :* 0- L"48<P#HP1 T X"48<#HTQ00ADT@Q<0h@| 00 T@ RT 0h黄JT:<0h T0T0X0SSX@0:8: -L\Mp@`0xKTD4PK$0 0 400S T00X0 $0S $n0 00 4t l0 p H r 0`MH@$ \0  5|dgD?9"h:\?9 - 0L iP::T!h -LPHM`pKUD 400S X0`r 0@4P0\ T X@ 0P `?9 - LM@T`0`p0P@c 0TPPl@pK41[ 880cX%X 0 \ 阊ccT: 0-LM0P [[@[0[ P@20霊e?9 -L@M@`Kt$ PpK29d .9@TŸT 0@<Ÿ< 0@ @P| R  eB!2b2c621b1c \0P*0 RS 04P:1!1!@P @@;Q/4[S@ `08 !8#8#Q!5[@S `08 8 #8#P    0O0\ \ eB!2b2c621b1c1 0כ\P7t7?9|%h?9#h:"h::\:$h8%h<&hg?9$%h?9T%h?9#h::?9 p-X`LMP>@T 0 S00 00C00T p8%h -LMU0@S u000 RT` "2SX00X0 om0X000 0X40S) 0S& " t 0 00t #/P000 "48<#Q000 R000 0S  b`L4 X :0( P 0%0S q Q 3 R(00(0  oL30Sg 13PU 0Qx PUP0 #$0$ h("("4 4Z0 "48<#8  `00`0i $)-"("4 4Z00SF Ђ2  Q 嘒6ʬゅPd00d0I 000 @`P@" @00@0` "4 408#8#$0$ 40"040  Ÿ0 10 d00d0U ' 0S 0S~ 0Sz}P`@i 00 0 R 0S 0 R 0SR h R 0S  R 0SR@|00|0 $R(00(0uP "t00t00%p00p0ᦽP@`000㜽P@$h$h`::?<&h::|%h"h: 0-L@PՀ0P  $1 S 0P0<0T 5 R l0 R U 0Q5 L0TU 1<10,0( 0R$h : -L M p0 01 cQ E 0  0 R6 0Q0R  R  @, T  "48<#0!$(,"P:,@ @T, R3 0 "48 <,$#8(!8 ,"hCV ڲ "48<#V ᯼ "4 408#8#$0$  "4 40f8#8#$0$ TA 0P $(,.4,8 <"(!(#8R`c-ڲ0#$04V `H R000@ x#00C00f8#8#$0$  "4 408#8#$0$ S,0S , 0S00,00 @ T,  ,@ "48<#Zk @"48<T#, `V_0@00 001SO pPP`0`呄0V0C0@  P`冄00C0ܻV@ 8#8#$0$00  0 0 000  R000 g0 0 0! 0 0 0!B W P 0P U ! h00h0D 0S0 0 0 0z 000匹0 00C0Q Q00x>P l 00S0<0 0 0 0 0 0  00 00|%h:#h$h<&h - @LTp l` PO R0P00@ 0U0C0 $R000 h݃:|%h#h p-LM0` R |P00C0@ T T@P 80S0C8000ph 00 0<&h$hh%h 0-4@L0S $P0000S0<&h$h -LM|P0S ppp00/"?CQT`1@0000S 00/"?CQ@T<&h::$h -L,M@  D 0 01H pC0WL0 P@T T WSX00X0SKDT KT phWPH R 3 R@X2`V,`F0S` +XC@0(KP < +000@ (P0`D0 @ 0D"P00P00i`0i`T T2 R@ `Vڀ0@ 0 (RKP2 `F0S ` *T @ (P 0 0<*000  R H } D `@  (ZKP@0 (KTl0D0 X`i4@K *2 [R3[Q0S 10[#0 210KO8K@  *10[0S' S 2[0<KA <0 x*20[020K40i`hS20[3 [0Sa x f*@0l(JP 20[020K20[3 [0SN4L0@ 0KP <  K*:h:d:$h: -@`LPPpD 0VpD 80S0C80Hp0000 `0}P@~l%hh%h p-LM@0`+TP p*0D #10P걊e`: -0LM`(0 ,K0 ,K+K1Kf}P@$ 4 10 S 80S0C80}00 R }0`pW $1S pW80S0C80}PU 00 Q PUP80S0C80}xg -PLP& EP` 0@10 0 pD00 P)@PE0U :0U0*00`:e p-LM` 001PC@ ch) 0!0e 000e00 000p -LM1` P@,` 0`  p$(00(0o驶P 0S   CD\00R00S 17 H <  < ,0H\ Z @ PPZ @H4 #8#7<0H 0<0 {8  @10 00487 <0H 0<0"202ɰ(g$h -LM`@ 48<pH#8SC*0S01<0 g ^7*PP.  0 00@0 @ @  #` #00 "4 408#8#$0$  00 0g -LM001pCW`P 0S@ S0 @T@ pdW`0h@C 0@0P" -LP@5`Rp P W P PTTv Tq ThTb _0DS\W 0S W 0D`S**** *4*4*4*4*4*4*4*4*4*4*4*4*4*4*4*4*4*4*4*4*4*4*8*P*h*x*m`0FSt`ȕVh0h000h0Vh0h000Vh0h000Vh0h000Vh0h0@0@00FS`ȕVh0h0<<*m0 <T -W 0S0`V Vh000 Vh00 0h0 00T !Tr2TWr 0So0 0@S S 2P aLuP\ +uT@WWTTuTK ZTH ETC㓭0 Dp 0R*****************************++m`0`t`h0`h00h0#1h03h0#3`h04*M0pS 0  0! TT:0 0ph` `` %0 p T -!T00T0 0 0p03i! -LPpR@W@L QG 2,00S,*0@P 0 C!=!TQ` Q T`V00V0SQ  Q @fTP 0,SpDV@D`F 00C 0`! D !1. -L$Mğ`V, P@p 0ES@++,+X+0+T 0S @T l4R \ğ,0 S L,^ 5'5'@0Z 4PU @s$1S 0P<0 S PU 5SP1-T 0S0  T 0S0 R ƕT 0S00S0S$3PU U @s$1S 0P< 0R PU 5S0@T 0 R0 @ TT0~0^ @ 0P7s 000o00H0  SD :;f5 &Pp !DA D51' pH00 0R@0  0; K<0K0<K 80 sP@ t

&0`000 嶀0|dg@9$h p-LMP`@_ U  U U -0p V0 V0V 0 Q000@0 R 0S 0 R 0SR<00$h P0-L@ 0PU 5f&50hb& 00PU0 -0Lp`P wPP @00 0hMʚ; p-LMP0  A0d `K1[S 0S 0S S p08#H 0S0![ p0K p0 !K 0@&h --LMpr`(` @ \2T 1 h0\B @TV) h ,20S@0  (K 0p@L(0 P E(P@@L@0S   0S 0 `h104  B4 0 (q0Su R 0R8 R 0R( R 0RV$  0㲬PP h 00S@0  (K 0@Lp(0 ៾P (P0(0 `|ޫ@L⤽@0S  @&h:$hʚ; --L M0`Ph Ap ,00S$* P`7 @m0u0 p!t"4 408 Q 0H (0 0Pᒫ(QQ@0P 0S "48<#8SSx0S 0 "\00\0  440$h p-LMR@P;kS5dS*S 0@phP`  㐩0 0 h000pP 0S`P 0 Rh0h000h0P -pP m0CSP pP ު -LM Q@`0pP 0Q0U00S;Q}+++P++P+++P+++@+H+P+P+X+h+P+Ui0 pX1 ¼Pp\PPpu@UL  0@S p`1 R 00CS P 0 8 P1p 0S0 R 00CS/p0(00 @9p0 T8p( pT0 Xy-pu i @9::@&h,@9xg8@9 -L,qM1d\aP0@ !0>0T紀ᶠ@. t.%&tQ Q Y 403074<Y  01 (th\&h -L Mp|, @W`0 q sP P U0  00aSPUY$ 0!0@`T0TX#,0P00 /ݩ t,00d0   "000/U 0 0lQڲ!Qz @嵩 R0000 0` PtTP, Y 尠ᲡpX 0S06SPU  0S00L100 @ 0Tp0000 0 V  |P h0  HP%0 0  jTtTP 0 R  0$0 0S  ᐻ ak0S00`0 a!0 g0 X  0R X 0Q" fH ,000C  R0000 0 i@h -L --LM x0,  `0x0t` fK1p 0` ` ` ` ` 0 0#2S S ,0 S ,Y 0R :Z.000 0`Y  M Y ""!R00R0SX 000 bR 0 0R%0% :Z000  A Q   0S =R 0<,4$<,!4 $,. $<%, 0 ᘀ Yy Yk ,͟: 00Y0U YI V̟1018 R 0RDpW. 6S  R?  ! @0[8 S,!Kʌ R tK  0PtQ lQ H P!0 b0b S0l l0 P T@PL\Xa!0lS0S0 eR 0 @P  I PE0SAtQ L1p 0bS00eS 50 00 `Kp lQ   L!R p00bS0`cV9ڸ\ 00!R 0B 1ʁ `F0V t0ʟ0t0`<: 0O(   00 0 f 1SӲј0f Ӳ1 ն0 6Sڀ^0 0`bVMڄV000n /0Sb 0R   ( 0Sft00t0_~Wz |0@ u t1S Sp0 09A@@d9 A t00t08  fh0 f t0S pL1 0cSX0`Sژ "  X1R 0R 0R60CS +++++++(+(+++(+=0ǟ6 00 0p@% t0 6S S0lS=L'6S 1$!S ! & 10cSƟ0006 RPbl6lt  PƟoR` l R 0!R 410cSڐ6b 1P 40 A$1Tk!R? 62S 1 W |P h0  HP Y0@0b0ኺP;t 0h!0bS5t0`1 S`5 0 0bS6 0CS "+(+(+"+(+U 0 f &\  0bSQ   P 6 Sʸ$L00S 0 0cS L0 b00CSH00@00Q/0008[P0  ^ & R0PSh A0K   t00t00 6S SI8C80CS$+$+%+$+$+%+P%+0 t1S S \t0 } @`3A l0@<3 3Pa!Rg2PaR@t0 0 t0 0SRt`2 R> ; 0t000,Ÿ1|0 @_W|0  |P h0  HP0  yL@?0Si  cL@☧᪷ {g0L!t0QPS  F 0( 0 1" 0C S  0bSQ0P0S 0R. 0@000 \ @ |dg@hD@9 :h:`:i:hH?hhKJI:$hh:i:i@b@hhhhh:h:0Q4 000ᚵ\ 0 ?0PIQU 060Pa:Qဵ}U{ 0Pa+Q^ᑶI@ ̸0P0i0= f.@!0?0 Q Q PU  0RJ @1 0c0cS000A9 Q V<0P 7*000  6<"06 8CR 6S# 1'0 1u 0 GP!<P$1`Q0Q0'0 !\@0< <T $!0, 0cS `"000嘴0#60#?08Pt0`0`S 0K 00C0?3#3R 020 6 #0  0000cSL0L10T1 4@_0  $0 0p 0\ 000 0 0 A  0 0M$0O4' T!000bSLD00/4%GtP  R @  00cS10cSژ000 0zP5 Q  0 0bS P00[K6t S7 10T01t 0W 0 0bSRH&0000p&60x&?08Ot0`0`S4  0KB0!R& 1'0 10000S00C0 `afr@0O  <7 xb7''R?\ =   0\ \ 00cS10cS L (1 0170S\ L!p00bS P0Q0R00S 0S T@0S\ X10cS0T1p L!Հ`Vt 00cS0nS 1S:6S0 t 0R00 l Rt9 0!R 410cSڠb l 9 W  |P h0  HP1@ ᏶t 0h!0bS5t0`1 S`500u 1R 40 ;0S .*0?0 NO nd 0Rs\ oT@L\X a0lS0V1 0  0000|  @_LW| 0 |P h0  HP50 (  L@0St; R  0t0%0,t0aNt  0L@#5 dx,x0 ?08BNHPKxdKuY Y000 B @@K H@KGK0\K Kd@KcKK0 Y Yx " 0S, 00 #0 S  dK 0 P p `DpW TR p1 )0dK p#Q >@T3 0R #3RʌdK tK 0(P Y Y 3P101 0S.101 D#P 0p ( (  0|< H0H0KGK D d0KKcK0`0 K^? /MP   0P`0 0($0W 0P`  0 ( X0t0 0<4(<"4!`~V0hhhK+ -LM@Pp`H$ K0PP <4<("4!<S 2* :S0:0Q:D00 01 000Q00`0 D001  B F 00C0x 0@P P 80S0C800 EE_ 0hhhK+ -LkMp PLT\`P@F n T ! ßD X U`@ #t0D SD K1nK @P 0S  0 o/K PP@ b@0a Z Pl0L0Pd @0 0@0d 餘pbPP Tp  pl 0 R J 夠a00s U 1c@ l0L0D= SZ `0`S7 000  10eP P P 80S0C80@ HDD8 0@_Gn0d@  @ dm0[ 0 " 000  QʐT0S0 000  QT0S:0:PDZ :=DQ 7 :@hhK+h -LMU0SP`0 " S(  04 ,0 0*0Spp4 p0V႖P` 000SV 0 0 (0 U0S S @ <4(<"4!<0<4(<"4!<  0 4#$0$ 0 0 :#40  0 R $30(,!$#, : 2"0P<4(<"4 <0L<4<("4!<0U 0S_ SI 0S|0S8 S# 0S S /, Q<# ,  0D"0S;0, P4 0`  !4 8<#` #8 0U 04^01t000 04 l0b!$(," "( 4 U 40!c 0"4 40 \ x 00(@/0 X0@0t 0 0 % 71!7; t1@`Q/ 4 , g ::: -PLdM0| tp,0 @P p `21S. 6t0&< r 0 Q1 !0npP\0 tp  Z S2\ Z h hX0G0T1!Xt \ TL0\p G P0c3R Xx  X3 pQtp P:0 ( r0S%@1X:S 0!0bSx Rڴ;!;xp0 aS0b0bS ^ tp0 0bSt1Sd   S(h tp tp00S 0S, J? dh aX t ɃXh  r X00R00Szh00h00!0bS:HD0OhzD㣔Pp" Dʟh00SW $ 0h  ZX0h0\ p 00 0\ 0S| h0| 0x0S` x 0  0 @C t0 1R0B0X401 0,$,!$#, 0d,$,!$#,\ 7 T0x#Q7Q8ȟ 2Z`ZZ"("("4 40 0CS0ՠ0 S 0!8#8 #$0$ ! t1S S r0S 40 00 0St0 0t0 1 0cS 01!S7ǟ 40!0000@ 0R \'0?0 A400|0 ( t1SV uSS ` R.d1l\d@00@0tp 00 0tpZ1 0cS0Xt0 tQVT6 ,0S `,E0t0uB7R `0(S `p2WAW6S6ópt0`5zA|\7 1!"4 40| l t00| m0%00 |@S;0 0H @v` S!@( B"40 0l 0| |00H A0 c^ BFW 1 0cS!P2d0 2 8#8#$(,"8SP D0!C P"4 40DDP0$ l1P d 0S00X|0L M@ (pR<0D0   ( [P@ V`<K  <K 8 D D3@(\P0 pD  8 @4P0 0 P0#2S00T0 |dggI@9:: -LM<9[PPJ ,1@0JϠ @70=q`@ `=V@^ = 020 0(B)&QN?  P0O/t0|6ڀP ü&h0 `1d1X 00 t1H0H0$! !  s t DPph:h+7y+:: :?b: p-LM6pS0| 0@`@P0 <U Sph40 RP 0-L@nPn[g 0000ph@h 0-@PTL R0000 0 嫐O[@T0i44 0\0!0000 SQJ -LMD@@6S S6St0 R`06w5LA0Sh: 3QAQ @QF -L,M0@S`P,r 0S R 0S0S0S R 0S0s VV 0FSqhV Vd 1 R UZ @ \I @ 0R: g| <bt1S  | 8X|( SK0 : 0P!0\ d >|,<| ("  000lh|dg0hhi@90@-dd0`@S =0RHP00Q=0P(0$0/ b 0iiii:gfff 0-@Lt0P  0ht  -LM4@440 (0!nj hsi:ii 0-L@P;PU@Z0 -L4Mh0`,0 [tv |P h 0bS700cS60(R6rN/(00(00O/"9C1 S 01&6 SƱֱS0ü6Ä"0@?09d2 R |PU 6S6S@0 R P 40 T0tY0 8S ʰ0 G P!P 0QPV$1 A@10@1< ,0S h,=|@N0 8)0 0<@K0;K<0K( 8 tP@ T0 S0T0 06$0 0$0Q<0P [ [/ 5t0%K>0PK4K(0X@XK0| |0@ <(0|dg@h:0:::A9Fr:d+i -@Lst0`0p hh, N? , O?Ɍ LQUP1 Q 0r00r0P0,H0l <^*40  ^:00000{@h::id: p-L M@.t0`140040P,|0@ . P,ʼ0PUڰ0 ,0`0Q*80 080x0LP` `0 ?088ph<00<<00 @hi:i:i 0-@Lt0P6 S \0P\ L0,  a R 8 80 ?080h%i::i -LM` QpP,`  \ 0Su0 @0W0T00S cV`U W W TD4@ , 4 Wj+0++؍+,+ؑ+0+@+l+++h+++4++ؑ++T8` ,0S 00h4A,  0QP`0 0Sx  0D0,0 h0    `  Qh0<  P`,0 0SK S- ,S,Px7`0T:0,ẛ#000, 06#0 ?0, 87,,00,010RP 0S PQ vP`q gP`k`h0 S0S0S 0S 0S 0SQ0s Q XP`F ~ 0S 0S `P,A, 300ᅜ,WP, .0% ,"3,,500H0H0S0@ 0 , QϠ 0#` 0 0,d1  00# 00 B0aR  rṊ>, 00 0r ,, 0`r0h0    h0    -` ፊU 0 Q  0o& 0`oY@h::EA9 -L M`@pP , 0 S_ UD 0 R R/ ,  0< 0V, V , W W *P P 0S0 Rڰ7R'P 0S0 Rt0t000t0 V0W 0 W* 70t0 0V 6 P p-LM0PS T0S0 ͛P@|gP@ p`[P Fh0 00t1@000@070ph:l:i 0-6| SL@@Pڲ0 0S @꿆@L⅘@0S  ( R 0R8 R 0Rh0  cQ ` 0 PPD 0S00 h 40S@0   K.V h 30S@0   K 0V h0  0@KS @0S! 0ወ@HKL0 P @L@: $00Q$0( 0pPP000! P 0 xK00  0 Pt p(D0j  0 ( p@HPKH@KGK0K dPKXd@KcK0K LM@HKH@KGK dK$K 0D0 yd@KcK06K0`0 9 "(00(0.0S 00 0( "   (0 0(0 0 000 000 R U00 dRP0dU|0K Pp | 0R0% *0`P G0KTi|dg,A9iʚ;P@9 -LM@0@@L?@0 \h5 @0 -LdM̂0Q@,0 p`P㰢 0S ,0S ,50SP0@ShP P T2 R Vy Pp 0t0 x U 0SYdK \KdK0&PYA p0t 0R:l@K0 ptb@HK@PK0 G0KHKp HK00 PW [&[xdKH0K [\K&[0Prx0dK  dKk0 c0Kd K\KpvL  dK0\KdK Pp` x` Z|`|dgL+8A9L*Xbi(H8 0-QLMP 0S0S 00S P0@ SAPP T \ 0 0LP8P @0S  0P喽L+t:L*i --LM` 0 pPY (@#w*Xx (08 S, 8@o0 rP@d 㨄P`7@O @ 08#8#$0$0 08 (00310#1<1!0S1 202! !48< (#( (!(!8#8!QA"A" 8#8tm#$0$ ,0H 0,0(@0C>Pr@X , 8 冼0Z 0܃(0S9@:i -L M QP`p@ 0Q0T00SQꬭ+P+\++++L+ԯ+(+ܯ++Ȱ+ +(++0+\++++++T Y Z =, ,5X2 qPh0 22  s t , h0   , ᜺h0  0S 0S$0S(0S 8, ,Xᜓ(0S, jh0  0S  0S$0S(0S9 , h0<<,80»,000xꤔvh0   0oc 0o곓-h0  ZVh0  OK-Ih0   0 o 0 o鈴2Ri::b:G8HA9 0-LPt@ጻ0hm p-L MQPP%0S S S 0tPPp*pT pL 04phN( 0p:ih -X0L \<1  %( 00 0~:0i --H0L Q 1(   00 0b:0i -L M@+@K0 0 P᠃+ ["2S- S (00(0B( 0S:"2pS0 S0 $(,<4<#: *0KW0S0000 m+ ["2S S( 0S:"2S S0 $(,<4<#:*K) K)0KP 0 $(,:0# # #8 0)[ 048!,!$ <0# #$# 00S 52 R (G24 `V $14 Sc `V +[ i0, O\`lB \dB`00S DP < T0 > 0pR1000SPP000PƠ0 .!  , !@P ` 0S $000 @@ 000_ 00 0@T W 0S @T 0R X 0S kP$00$0p*K P[ᧃPP+ [000ᛃPP + [ kP0i:xg@i8%h0iAiAiTA9 -L M`)0K V5) [0""S) K S1S1S1S1S 5 R t5,  , 700,1S01S41S81S )0[S ( 4P @p`00ppp!( B("("48<##804 I 0 B 0 )P[Uh U]40K (40,$,"*)0+ K00*K+ K*0KM*[ 048!,!$ <0##$# 00003 R 3 R 0 R ß ( B0@ ( B0@0 R   B0@  B0@F"p(0/0(0) +0K⍁P"7000 Q Q Q QT00S SN000J00S 00S S0 0 0 00S (0/0(01pW(1 S 1 S1,  ,  NP @00@00  1#$0$,1 庐 (1 0 ! "  440)P[U U00K 00,$,"*)0+ K 0嶐0*K+ K*0Kh*0[0+p a +0K0 P0#$0$ 090 "4 40 %0i:Hi-QM P PR Ѝ D00 Ѝ* 0 Ѝ0i: --l2LhTMd 0 Q,0  pP1  00 0 0@S0510205 :x0K ፀx [0S 0001 ,0S ,/w0[S 0S*ᙁP0p00 HKdK0 "bV< V  000@@0K HKdKc@KG@KM\0K H" tKPo 0 `91/<1t [000x  hP11<<1@D0K GKd@KH@KcK `0K:`i|dgxA9|i: -2LM0`SS@ S"2QQ2 QQ Q(p!08#x |PP} 1 01!1* 01101!@<000 p000$00  g0O!0S. S @G$0K $K#@KP@a0` 0 !( B("("48<##80 1   @K @ @ 0 000!"4 4 0a0 0r  440(! 10D 000 ~7$ 000~pb%`i :-QM P PR Ѝ D0, Ѝ* 0 ЍZ`i:G-@0 !0P8< 40#0   0 ! 0 8<4 0#R 0 08 <40#0 (0,$ "^ X 08 <40#0 (0,$ " ^  D@Ÿ@ 1, !4  ,$< "1  . , !!8!$X!l0p $(, !0$0#0# ! 0#0#, ! $< 0048 P8A0!0$ 0#0#.,0#0# 0# !  " X0 $ 00# ., (0P 0 !x@0$ 0#0#.,0#L0# 0# ! ". X0 P77 -LlM, P0 0 10 1 0@ !0@0@ 00L0 0 T 0 ,PU`E00` 0p\4p 0 'L 08@ `#X&&ĠP#l#4Q'(.'D!!|0 80|P 1P!<0 0@ !qA 1@ X !lp p H@ \ t 0 4`@P`P` p8apdp Q< AP`0 aXpd A!ppDP T` lP`h p!Q1|`!`Hpa0#` `q "Lp \ph@q`p tpqxp pqD`p Tp \`pAQL``p !x`p "0# ! "0#u,77777G-M8  P< 8 4 ȠLD, P ̉H4< 0 l  $ H !D!0@,!Č(l ,l( @$.($@ `, * p(,( $P&' .h1T)̠)$$ĠƟ)$%801*(%|05 !%5 * !*  1şq|ş`ş耍@  唠 ! "   "l@嬠 !0# 0#l ll!T^T 0# d "! "`\!l!0# X1l! \X.(Xd1`. H\#d,8``.dX D@,`.Ġd l.\X h01 03 !xh| !` X0刐0\T0@H 1D4 q0@ ?0@0c80 !<\ P!TP 8PtU"\@P P<?@1p@d Zp: T@P U \:,0 l o; ,{@0 SP,0 -,0@k -L4M0!> ?P@Pe`!8P 'pmvmz0fk00 0#000c= h 0 "   b-p 0i0D  0#000c9` j 0 "   b* 0g{0| 0#0009  fk 0 "   - 0h0` 0#000c9p i 0 "   )`0j0  0#0009  g{ X0 "   , 0fk0 0#000=h 0 0| 0008pi 00 000=`j 00X 000c< g{ 00000: fk 0 0 000c9h 0 0 000c9pi 00, 000c=`j 00 000c9 g{ 000 00c= fk 0 0 000;h 0 0` 000c:pi 00 000;`j 00D 000c: g{ 00 000= fk 0 0 0008h 0 00 000c<pi 0' 0#00c<`j0&,  0#00= g{0(0#00c: fk0)X 0#00;h 0*0#00c:pi 0' 0#0 0=`j0&|P 0#00c9 g{0(0#0 0c= fk0)0#00c<h 0*` 0#009pi 0'P 0#00c=`j0&0 0#0 0= g{0(0#008 fk0) 0#009h 0*DP0#00:pt 4i 0'P 0#0 0 lPnpP  xlP : `j    -/LeM0p @ lK,0 -p0l p `b?!0@?PP@ ei@Pn ?0S:@P?0S: -Lp M0`,0 @4K  b!}@T  ~0 S@( `P 0  RS  Z @$1  b!1@T(,0 S ,T|dgA97A9 -@LMT $ @P@0 7G-(M$$ $0 ```P 5j# "< "0  0#   D 0AiP i;,  0 0  ^   `00` 0 0Q%j3 0# Ƞa,0# ,e). @ @$ 0Q." p  aƠi! " 0 @ iˠ "! 00`@P?Q  ` $0 ` `@`P@` P0` 0$` 0  @P(Ѝ7 -RLMp+ @>?A @` R,: P, ,!P`P` pl?W `\ @pG0@?W@WP 0@Pz0@ -PLM, pX @0 @0K- M >}. Np >.~~΍.1@QS@@`aq  ␀!N01`$P~`Pa.(LQxh ,00)&$a9%G%ᨀ.,Qq匀円(nx%Th0vP.#^PLl G )ጫ7᎛ '(P!`"p`p`P , 0 0Ll\$1l(C|@厏 ='pp*C(`~P%`&`P`Pa0#@$^.T= }` 0`lppPCq(,ΠHD@l| 0q<`^ 0@N0lQpCpa`3` P``` P%00`&! "= p P `.M.  .0@~>. N~ ~0@TO^t^0@10  a0@N~ Q0@^  0@00 ^ߍ7 -RLM`pG @>0A! c RX:P !0@ R: @0S*H0P@ P p`i VHP  0@ `FRp @0 S*@0 VVP !0@ R:@0S*H0P@ P!0@ R:@0S*H0P@  -@LM, 0 0@K 408@_`pP`4%$\'&dts?s_`  0 @ #Ƞ8!(0p$HP``,4H[0@UP` !4%lT"$ K?K_`@8`p0!#^8'$Hxa ) ,0 p\P0\,@PPP~(,p00@ ,oA,0l P Ppl, PP,`pPP 0P0 -PL M0 , / ^0,40 P`0p  @ 0 !ĠP`#L"$40@ 0@#Ƞ8!(P40$H`0S40 `00`00 Z,o -@LMT@ , PH0@ `7 -PL M0 , / 0,40 P`0p  @ 0 !ĠP`#L"$40@ 0@#Ƞ8!(P40$H`0S40 `00`00 Z,odA-0PpP%%Ǡ% %,1d H!̒00# 0@0#@$$Ǡ$ $,1t h!̒0 0# 00#P%%Ǡ% %,1t h!̒0 0# 00#@$$Ǡ$ $,1t h!̒0 0# 00#P%%Ǡ% %,1t h!̒0 0# 00#@$$Ǡ$ $,1t h!̒0 0# 00#P%%Ǡ% %,1t h!̒0 0# 00#@$$Ǡ$ $,1t h!̒0 0# 00#P%%Ǡ% %,1t h!̒0$ 0# 00#@$$Ǡ$ $,1t h!̒0( 0# 00#P%%Ǡ% %,1t h!̒0, 0# 00#@$$Ǡ$ $,1t h!̒00 0# 00#P%%Ǡ% %,1t h!̒04 0# 00#@$$Ǡ$ $,1t h!̒08 0# 00#P%%Ǡ% %,1t h!̒0< 0# 00#@$$Ǡ$ $,1d Ȟ0 0#@D 00#@$P%0A-D0P@pP%%Ǡ% %,1d H!̒00# 0@0#@$$Ǡ$ $,1t h!̒0< 0# 00#P%%Ǡ% %,1t h!̒08 0# 00#@$$Ǡ$ $,1t h!̒04 0# 00#P%%Ǡ% %,1t h!̒00 0# 00#@$$Ǡ$ $,1t h!̒0, 0# 00#P%%Ǡ% %,1t h!̒0( 0# 00#@$$Ǡ$ $,1t h!̒0$ 0# 00#P%%Ǡ% %,1t h!̒0 0# 00#@$$Ǡ$ $,1t h!̒0 0# 00#P%%Ǡ% %,1t h!̒0 0# 00#@$$Ǡ$ $,1t h!̒0 0# 00#P%%Ǡ% %,1t h!̒0 0# 00#@$$Ǡ$ $,1t h!̒0 0# 00#P%%Ǡ% %,1t h!̒0 0# 00#@$$Ǡ$ $,1d Ȟ0 0# 00#@$P%0 '7H0@-@P!0\#0 0(S"Ƞ0 -L0 M( @KP"h0dp 0 8#x "W 0@2K,0 (0 p,KL,0 0("x(0W0p@d;08 (#H,0T108#xW -LM((KpPj@"h8  8 08 #8 "S80 02K40 00 80 4pK z400# 40 s0 0#080 40(0"(8 R00  8 80@ U400# 40 N0 0#008 0#H40T18 08#8S80  p-LMH`P&$H ph; (-"xPUL`@:08#XU@: (-"xPUL`@:08#XU@: -pL MW@)*0K0 8(<, 4$P`  0P `b0P,`p%<%(%& &Ƞ&W0 P`@: -pL MW@)*0K0 8(<, 4$P`  0P `g0P,`p%<%(%& &Ƞ&W0 P`@: -pL MW@2*0K0 0#0P0 8(<, 4$P`  0P `0P,`p%%<%(& &Ƞ&W0 P`@: -CL0 MX4 @CpC0K20K0 8(<, 4$P`0P ` 0P,`%%<%(& &Ƞ&0 P`0 0#0QHXpG@D0 8(<, 4$P`0P ` 0P,`%%<%(& &Ƞ&0 P`40 0#0QG-08@ <4@ `|Pe%L%ȠE q%0E吕aP@8 < 4f `D0`&! 0cqS%,,E%̠ 1%E0n 00#H*j apQ% 1%Ƞ % 0 0#0a L`& apQD% 1%ȠxxD % 0#0l0P* apQ,% 1%Ƞ  % 0n 00#T`&f apQC% 1%ȠC % 0 0#0aX* apQ% 1%Ƞt % 0#0l0\`& apQ,C% 1%Ƞ  C % 0n 00# `*j apQ% 1%Ƞ % 0 0#0a$d`& apQB% 1%ȠttB % 0#0l0(h* apQ(% 1%Ƞ % 0n 00#,l`&f apQA% %Ƞ %40A1!c \p*R0 p0 0crSl% 1%``A%$ ! 0#0`04t `&! bqR%1% %$ !0l00#8x *j bqR%@%%$1  0!0#0b|< `& arQ%1%h%$  0#!0`0**<*(*& &Ƞ&`0 (8(8(8(8G-0@P`p8 Ƞ<̌ W4ČP`pሕՈU< |0 0crCpş$ 1$(dT $L!0#0l08x P%e bqBş$1$$$  0!0#0b4t `&! bqBğ$1$$$ 0l!00#0p P% bqBlğ$1$`$$  0#!0`0`&, l0 f 0crCğ$ 1$ $$ ! 00#0b(h P%! bqBß$1$$$ !0l00#$d `& bqBpß$1$d$$ ! 0#0`0 ` P%e bqBß$1$$$ ! 00#0b\ `&! bqBŸ$1$$$ !0l00#X P% bqBtŸ$1$h$$ ! 0#0`0T `&f bqB Ÿ$1$$$ ! 00#0bP P%! bqB$1$$$ !0l00# L `& bqBx$1$l$$ ! 0#0`0H P%e bqB$$1$$$ ! 00#0bD `&! bqB$1$$$ !0l00#@ P% arA|$1$p$$ ! 0#0`0`&&,&8&% %Ƞ% P0`(8(8(8(8G- R8M0 00 1 S`@Pp0 q 1ѷ< 1 R Ե@ 18 1 P յP 14 1 ^ ֵ` 10 1Z0 S$ Y NX,Y,Y,Y,[,Y,Y,Y,[,Y,Y,Y,X,000PTGTg#Ġ#, #<,!q 1,A.-Q0#Ga. "  "P0# "0# A !04 f"Ȇ",(1&)V0# !0#0#05 41*+|f !0#0#0# 0 Y 'Y,HZ,HZ,HZ,Z,HZ,HZ,HZ,,[,HZ,HZ,HZ,[,  F 10# 1Pe  0腟0#0" 1ş " '0 !! Z ` 1 !0 1 00 0Zj( 0 1 1 1Z8Ѝ   10#% 1  0E0#0 1  " 0T!" `弄 1'0# 1  0D0#0 1  " 0 `` 1 0#P 1  0@D0#0 1  " 0( (4)@S#,8,̠ a!ßC04p!A!P GPe |:UUUU:(:8P -L M@|q@*) *))* )**)333 *))* )*`)0PK@ဠ*) 0 , V   0,0 )*))$* )*x*!)*))(* )*T*"))0)$) ), **$ **, UUUU3333 -L MQ00 S`p: 㖒x4 0\ * @ 0 R-0\@:vpWY v 1 1(K`  Pp ,00 @0004`4\0 W Z  01 R Qv 111 P `QW@:D: -p0LS`P- 0@S%*#11A 0S0C000S 0 0S @:D: -LM0A0SP 0PU|a0S00S8 PU0,qU+U%1l 3P` @1!!1  0l㐐 0 `嫑 ᧑ ᣑ  0 000)l 0`0P0  1D:@: -0LMpQ P`1`#V@dP0Sm110!01Qx 00ࠀ\D:@: -`LVP p1p#W@P0S@110 !0 1\ 0@000  00@$D:@: -@LP 1p T*` R 0ES011 RU 00!!0#  0 SQUQ 01APؿU 00  PD:@: 0-LMP̐ t 0!S@*X0 !000庐@\ ,0 @0qD:@: i, -L M<@\ ,0 @ i, p-PLMP d0Spゐ ` P *0@0. 0S+ P:0P  0@ PSp00Gp0S 01x  D:@:p: -PLMp <0S,4 8Q \0(04 8 H1 X**11 00C0 0<0S  0@ `0O  P p(84 R 00040S 80K 2P0 K 8@ #0(0|4ˏ80@:D: P0-L@ 㼏8PQ 40,808Q0h骏0Lii -LM`㡏Pp@T& PP D`F⋾v P`F@8 80v408@ဏ|vPDD 0@40 8@00H:iLiA9A9 -L h0A9 i -LM,00 ,0 <0<0P i -,0 ML@ d0 @ iA-0P pR `0U0 x0 R0^$P0S 3 @x0 QQl:D:@:p: -LM`C\ß ^, `$p6 "83^ 03^  c,0 S , P@ %|2^ 2^P@  0Sꌐ,,4,<,D,L,,,,,,T,\,,,,d,,,,,l,t,@TtPK$P`K₽$X'  0t0 p 0R0R *hPDP L_L\ Lp ?. ! h ޿P41X |KR  P`p@PK` Po`L`PK0O D 0h00`@ @`P0@0OPKd`\XTPLHD|dgecic@fcA9gchcP:p:::::4:::X:|: -LM\4p\P@,p 0S \  P m` ݼ3#3@#3Xϼ 0L0 @80  3PRPp  0S 08S, 4P3  /P, R  ,0 0,0<  @010Z 0 S 0 000 00 000$  (01000`02@<004PP} Zy 0 Sv 0,` PF0  f 00 00S , RD0@0] , 0S*!1!!0@ 0S P (@0,0l>,0@. 7Y `10S$(0S!QQ Wa 1 P L 0@ 0  P 0 ,0 0 S Z 00 0 00 0c0S 80p t \ l X h l,D:@:x B9 -8 4(0L0(#Q (0,0hx -L - L0S`0S񟗆D,,,,8,D,QR~L h 02 d0010p1P1  0( PQ6UڼP ~ `(0L0A CP 0UP`0\!P`0S`P 0^ !(0 0AP  0UW 0@0P$LP@PUZL85$?P`$ 0U 寽P`QRzQRwQRt鸗, B9- 0-$@PLP R0000 0 PL$00Ph: p-0L M\` L @ pG0P00K Kʬ@TL0  000X $P  (00(0 ,00C,0(0, dcL:_,P 0SP R R RQ000000000 0 00  -LM00K0PK @L 8 pP1  4^a0K>A$ <   $  (P@0 | 0-0@LP$LP <0LSL&0#! -LMQ`&R"Q W 0\: c\pGPVWpG @lV@1  `dVPB90B9LB9dB9 -LMQ`&R"Q W 0\: c\pGPVWpG @lV@1  `dιVP|yB9B9B9B9Q@-@  P 0 0RQJ PQ00P00S 0@1  -LMR`@p/Q,P  U$010^c^PT UP 0  nT 1@bPT B9C90C9\C9 -LDMȟd d, P`oPl p@Zl`  0p   <K 5 0Z  <0K4 0< KSh Z l ` K_p `V\l `q00 S$* S" L@K l0 R 0 d00`l l ` K4p} `V2 l `q0V  0P 3 "R @ R. 0% d0`0l0`0 `e V00 Q030"S@V6 ,0S x,d 0 Rh0 0#0Qd h@ h0/d<K <0KF<K8 Z  <0K <0KE  <K|dgtC9 -LGM@ \, pL POoK YP 0`_P.00CS"0,0,0,,,,,,,,,,0,0,0,0S& lK ٶlK lKY @ lKʶ|0 ,0S l, l0KEQ lK0`H|dgC9 -LMPpl @P`Q XW 0b 0J ( K @lwT= @ 0 0T1X) (0 }T*X` 0dCPQ0!0@Q0a005:c0PQ0C0(lGE(0 4E(l9( K0D QP-LP[ E Ru u0X* 1S X:0S 0/ 0X+ 0Ua7 l zP 00CS-,|,,,,,,,,,,h,,Բ,ܲ,,h,,,, ,,D ?. !P0@ 0 P0U`!$D DDDtl @1@0So l (0Sf 0/>P 060#0 ?.P ?.&"( 0!>!B("(,0/>P 0j0#0 ?.P0 ?.&"( 0!>!B("(0/>P 0\0#0 ?.P0pm7 r~r|rl @孻@0S l? 㡻0S 0/>1 0 ?.! !0 ?.&"( 0 x "  ᷱ 0S  |dgD9 -P@0U0 UXp`L 0l>  @zO 0 -LM@>{ln00 (-"(LR (-"(L (-"(LN (-"(L (-"(L (-"(L,0 0  -LMXKpP0ȐK` @. 0@T Z2"VXp 80 4 0 TP l ㍷P0 pP 0/ 0VL0 H 2P#0AV} /PT0SH H R*WRl cDP  0L D 0p @ PHP 0 S  P@Klѷ 0 @SV 8D0l 0 9Pp V7 0`S@ 0QE 0 W  E  ᰰE 0l00 E 皷PE 0pc@0!R`0E ᖰ0PE00l pぷ:h 0 `BkAl P 0@ 0pT,,,P:T:l ӶlU -LMPp`@0@@T@000` 0@0fT000@-@T`pP*000  000000 !@T:p@-@T`P*000  000000  @T:pQ0@-P @00 PU@  0 000ݯp@-^@P%*`0 13R0   "7! 4<4 4! >! b1! `` ^:p 0-@P LP 0#40  00  0#40  000(C80 -$( , 0 48 < 00 -LM@z |02 -LM2pS`@Vz_z 00#P0 `FV@~ ᐸb0cR1!~ ᆸ20VS2z0 P0#0Zz_ `h@ -LM4r00@KP ` 0 ' s3[S/Ki0 300Q!0[0!0K•\Q 3[S<0 300Q!0[0!0K0~? Q 0 ~? R"~ 00#P0z0 P0#0Zz + ׮ 0S 0 300Q!0[0!0K! [x0 "! K~ 00#P0/K0 300Q!0[0!0K! [x0 "! K|dgD9 -LDM܀0@R@$0 pP*X` .00d@K@~ } 060#0 ?R@ @j $0S $$qX`a@|dgD9 -LHMp0`@KP 0 `@K XJ 0\0#0 ?R@  @0 0S 7|dgD9 -LDM܀0@R@$0 pP*\` 000d@K@    060#0 ?R@ @ $0S $$\`@|dgD9 -LHMp0`@KP 0 `@ح \׭ 0\0#0 ?R@  @㽭 0S |dgE9 -LDM܀0@R@$0 pP*` , 01d@K@㘭!ᗭ 060#0 ?R@ @ㄭ $0S $$`{A|dgE9 -LHMp0`@KP 0 `@e!d 0\0#0 ?R@ @J 0S Q|dg(E9!t!c -L4M@ D0  @0\ < !\1L DlP K0X0 @@\ TT@ P p D8K[P 0KW<8K8 KhPK@8pP0KPK`\L0[@]_`L$  @^` 0'0| P`M? )p !4 P `"$' 0tPK P`" p(@ p0K$< 00KP)`*D `8K0K PT@P K@T@ @0PT0@@SP XPX Z8K 㫬0C8 -LDML H  4KP0 @, ̵P@h Lh 公PP K000d0 LhP0P0C` \0 n 4K DK⮵PK@8pP0KPK`\X0[@q_`PKL$  @k_` 0'0| P`= )p !4 P `"$' R?tPK O_`" p(@ p@K$< @0KP)`*\ `<K]HDKD KeDK 4KU<K \QP K@0\`0L0S`0 \ d^d Z DK` 4K&#L,0 PS 8,|dg0C8 0 0 R h0 0h0 0@K  0@0 @0T00 p`0 0` I p`80 H H0, !,?/#?"/C1@B!LH40 8 A40\!$尔4D 8HQ\4 V8 @ 0@ 0@0`ݮ0UP֮P@1@#Y@ ήP@1<T@Z L2D`"S 04 S08 SH3 R6<0P PL2D`"S 04 S08 SH3 R P<0 Z L "0,@ S<`P PL#0, S PHo,@W0PH0 PL"‘\0,`S00`S ࠡPP PL ‘\0,@S00`S ࠡP P  -LM p`P\  P  1PJt0 0OT S8 0# X 1P0 ?@H@,P?@ ?HTL3"0 S\\L#0 S\8 0‡@80 -L MPp  0,P ,@`VPUPa0  0` ,@V,0⣭`VP0  0P`,0UPV p-L MP O> d  `4H@0 @K@TP@H P 0 S 3 SpVVU -LM PL`8 @ TdQ P^@08/@ 0O ?S0 4 R P, ,@H2PP 0O  ?DHTp`0< P̠\ 0!O>P `0/0 00R#Ac 0 \84@00d\ 0t!O>P `0/0 004@R#d \<0@P!L!40\0C40 d!40040T00Pà\' 0 O>Q `000 0$00C$0@0 L8 0@ 0\0C 000,U  , V:U -LM , p,L< 0KP P00Uq , P8 j 8 P`\00Ua "0O00U T08 UY P !40 SPUUJ 0K  PpX; ^0,"O>Q `0000  ^$0ˊ0i$0L 0QO< 00i 0 40Y i0C40!400400, 8s3U8U\ 0K 8J p?%G0 K8 Y0K 0O>Q `004 00 8 ^$0i0ˊ$0L0O<0 00 0 408040T0K 8p8:U -L$MPP@,  \, ,`00 0`0 F, 0 ?P ,(0@_80 ,0@K0\4 ,( 00K` FFP@0 0 ,,@  B  0@,L# "00C0\D2Qa dP0 K F@ ?6F,0 28 R[ ,P20H H <0 R600K E ?dF @K0O @@K F@p`_ ᖄ@K 蕖,)NF`@@K FP,% BFHp` @_ ,?!E<  < <@00C0,0 8R, T000T00C000,@0K 0P%,H H8 X000QJ80 a@_F0 K` E0 !P: HU T -LM Pp `PP  %P0 0P@, h$%0W 0S@T, @G0 0TC0S@DTP3 A0TTʼ0 K 0O0@K eE 0OPX `P/,>0l,0@@p0!,@<0 N<1PU`^0 0   R 0S<0^<@^0,0O`0 b s@#T**0Po 00 yPQ80@T0IS Q80Kl  CE` D`P:F9 -L M L 0 `PP  kP, , Pp 0S 02 0O帐  ? EX"`PΠ^0 \000?00S1B 02 a^ Ϡ\0.aQ00/ P  1PR\0/ `tPX 1 ^\0`00 /1Po0 0PΠ P`P]!0^ \000/ 010   B  0@0L0 : B S  ,R0  ?   0@L# 2 0 20 0  RH:U PN9F9 G9@G9 -LLM 0PSp` 0O0  08T0 LU#0O  0ORQ ?C<Ě 0@@K\ 4 84S 0 0ȟ R00p  0 4 aP0  7P 0O,  ?D00p`U( 8, 0L080 ?`0 X78@`Q.,@,`0!08`00?.8@l, 04S1 bP0 d T0USY2 p K@00,@&>^ /, `00 0 S2p K0@!>,0 06^,@ `00 0Y10,k$0` 0$0L 0O4r 0 0 080`@ 5R,8`0`@00088?.a 0 bS1Pd  0i ,80` S"05@_Q,`0 0 P000oXQ,0 $8,@`$08LÚT  n ,j,    0@L# 000\H4Q 8d@P,0 4R4 ,2P0p ppP8@P0 0` p p0 00,0 p3R ,@0T000,T00P, p X0 ,00pK0@ 0` wBP@,2 R,`0 0 P ,0 2R,,`00 ^ 0 ,,    0@40L#"000\1Q; d@ *BP ?RB,1 R2P0p N pD0 P; B ?BP K PK0O P@K 3B@p`_$PK`K PK X,,P@KX fB` FP,%`KZBpp` @_ ,?! BD  D D@ 000,0 R0D,T00HP, p X0 ,000 0,`G9G9G9G9`E9:U TG9G9H9 -L M p`,, Vc*0 0 PP> x1PP 0OȦP1 AR\000?0`0S94 1R\000 /0900 V 0`5 L#0 @,000 Q"000 O ? B L0S @00" B"0 8X=S 0  :U 0H9PH9H9 -L M, p ?AO^P``!>@ .2Qd, Q8`0/00. 0 b  B@b020!P,2 8R`0/.P @0 b  B020!P] 00`1Po pǏX,PN,0840  j0S200 OX40  S> `000/>0@@!N1 Q 0 @c00\0^  !0S  ^ PoXW, 0pl\W,0 <8,0,/>pAYU d:@D8dD8H9H9H9I9G-M$`PPjl0h (Qpdڥ!> 0! 0@$p ?> 1^ࠡD T! 0  S \ d@E? >i1^࠱D T!@  LP \l 0 \ 1( Q0 110b1Z 1(0l 1$5S!0SL\0 P3Ѝ!> 0! -LM d= P@0P 0 ? K`85堐00Ȁ Zᰐ = \00^4PP@0 !@p`W "ڤ0S0X0 Wڬ0X00X00S@TڠKKx0KPP0p 0C0 X0K`` _   Px@K000`K`CLPP\PpK 2 ^` `   P0`K@K 0 @PP: 20 ` xK 00PPN0 d @8?t@0DPK0HP8MPP@P ?ḀU00SaL  #MMMK\Pq\ 0@K 0 㛅0`T *00/묐00 T`:^00 V 0 0 zD/0<렐h00dh0   P xK00@K@KP-@ p0KP   LM@K0PɯA]M K P@K2P`ɯ0PK 0@KP @MPPk Y` K00PPN d @l> t@0 @0P帐2a eLL0DPk0HP M \  @K00@K@ KPP%0 0P堀K00M @d (>t@0K P5ɯ0PK`@K 0` @PP謀` h0K00PPM d @=t@0K DP0HPKPPp 01X` X0 0  ]P U>`娀@1( `j K P = 0S:0S: \g  P@K00PJP `PX oL`D 08%@0L 0`V YE K00fJPP 0D6 0K(0@_ 堐K0 K `PP P`01(   `K`0P b= 0S:@0S=*@5L 0`K(0e렀K@_0pK` p PPa \ @K00PPL 嬐00VD` d @*= t@ @0DP90HP꬐0`( 0)0@_ K0 P zPPP @<@00覛01(  Q >   J8 0~K4 V& <렐 0S+ 0S:0S* S>0R-LK ?@K  0 K0ؐ00 0АK000  0S:0  P a^3iI98I9- M Ѝ -L$MP< Pp$ 80  000 8 00R00S 0K0 0 R 0U 000O 0 R U0D0 0 R 0W( 000O 0 R W0  @ \0P@ 0 0 R 00 0 000 O 0 R00  $ H 00 0\%1RR 0帀0P@0 Qo0@%,p"0@ Po1x=`0d 0@;4@K00 @@HP@@0Qx40 P (8@T <P0$ @ 4-JZ4I4xJ,5Sʰ0G@ W0   uW 0000fU0RU 0000CTdI9 -LgMNKTQ`UP|a *p\q 4 0BRS p 0S XA0S R P@ >K\$p`,0<4 D@ 0 pSpq  0K0 TPLX!1RHpATa45S:05XqS*NK `PPS?K 0`P 0P@ 0 R 0~K0K\ؙ\岙 L#I000  0LI0K0>K\庙pAXa85 0 R 0^K000p^K000P `P:~K@ 00@.K@`Kpq8Kt 0KPSo`t0尀 p0UOp0 t $x! t!t1 僑R00X0p@K /0SutLQt PC@KBZ 0S1( ? 0p0 `aQ  d!P 0S!0(0 0p0p`P U pհ000  0PRoK p 0S㰀1( ? 0p0 0 S0p (0P UP@K p 0S㰀1X ? 00 p0K 0 SpA 0 X0PU 0 R 0]K000TaVT+0\ g@ 0PK  p`PtS/ PKpA pt00QO0@H KP㰀tQ 0S tAKℑ00``lhh@K 0 RXtPt Z`@ 0T PT 0SJ 1p0.Kl1hA0PE`0O TdS`Q5 0S da.K1p0l1hA0( `QUpQ0 0S ^K000`aVDpQ0QZ @aT pհpq^KT0`Q3/nK 0| p尀Č| 0S" ^K000 0 R |qg /0|00 / 0 |ah00fh0K0dq WNKpP i9 p 0 S# 0S:0S*pa LS>R-0` .K a0000Q가 0S:0 }K0uda VhNKpP '9 0S" 0S:X0SU*pa LS>R-`0 .K a00B00Q; 0S:0 3d!^K1( 0O$ 0S!0(0 1p0p` U pp P01R/1 0S:0S :p0@>K 0|a pdఀ|a pKS>0 pALR-NK ?  K00@가 0S:0 1( nK0Od!Sp1X@KnKd 008@K Kp` 000tQ p P%|qP1 aP`pa R|q @ pp 0 R 000pNK00 b|Qxa p尀P|Q Y0t 1X ta1X 冑>KFXqW0K0 tQR000X0p` p尀x0K03pa~KP 18NKp` PPS?K 0! 0P@ 0 RW 0K0Wpa0@\呖\40S L1iP L1D@ LELF Vp1P 7 p 0 S# 0S:0S*pq LS>R-0 .K q00@00a@가 0S:0 0.K00-K0K\q 0PS( /& 0S :0S:(0Sh0S 0S 0(pS   0 R 0 0`00Z 0S:0 0TaS鰀X0S0TS,3iI9 M-L`M0 00 0 K@00`\@ `@ 0T`P@0 H@ T` t0TpXTp 0KP KLQT0p`KOP@K T7PpK@00@0 DD X@ F< 80 $ 4 p `P,00,0 0@<@<@ 80D6Q800P@KL R-@0K@ KPKD 0@K0 0S:0 A-P8@T`p T ?>00c0Q3@T TX0X  0S  R1 018Ġd:@D8dD8p@-8`PL\ =-P=-=-=-=-=-=-=-0 Rp!>0  ARp" @0O0 \p @0#O1A-8pL\  >-H>->-x>->->->->- 00!> ,A "`P?HA0?`P@0A-8pL\ >-?->-L?->->->->- 00!> ,A "`P?HA0?`P@0-8Lp\ ?-?-?-4@-?-?-?-?-0 R!>0 R! "A"!?`P0HA01 ?0`P@0 -LII9 -h1LM`Q`!00p*[P@<15 %0S7 " p-R 5$  =S3$0T $0T R $0Q @0(0$ ,SP@p40S@ [|0$ 0Q@ [P $0 LM&w0 0 y@  {T$0N 0X | | 0S@[T0KY ؕZa⍐T[Kl ㊐, 0 R $0 p =R R  5 0 S $055005 HR R@K0Y 嗕ZaM0Y 匕ZaA @D K^P@ d ɠP"=S$0 #5 0 0 P@I, ㅖ0H0 +, @< uv0 0 x@ XzT )0 @0$0 0  0$00$0%  E$0@3$000  R@($03$0@bJ9(J9pJ9 -LM<@T[ YP  0 _PP p0 040 ͗P0@o%,"0@ P4oଗx帗`0d 0@d2,@K00  @)?P@ ,A =Z0@0x北,0 P 㢘 0 R0 000@00,@ #ZJ9 -L4MH $0PL DP P H 20T0 uP0L TPPv_@P TyTP@ K|0TbxH` 2pTO[P`4DK$:>P@yD0PPPw L3Ph L3Ph0` SD 80:80D@H(5 (0 kH H,P 40@#TL%800 S40 f0Pd 1 0DKTz>P@ +D0P忎D]@80` V5$%R ,0`VP ,0`V$%P0L40 T0`H8 K0 8p ,0 YTH L0D4@D0@ BhdG-J9\%T0R 0 R80Rh0 S8P0!RTcd: -LTM|0< 0RD0 0 ` \ \ ;\PP ;[P7 V t@0\ @@^P xU <$0 0X0 0vPP\@v00 Kt_w0PshP @P 4P P h\ \ 4@K@PK@_ 0Ϡ:/=PP45h P\% R  T] )  1sP|0@@4P TtX\ \0v 7x@^ ʔ@ǔ< Bxo?DP 1s 50 Q 5 X@T4P 80TZ$%R ,0HZP ,0Z$%@< D  0S 0S0<@ 0 h4 sdgF8hdTJ9J9(J9E-0 LS03R %5p00P5,5S ڬ4S9Ӭ4հ4S@0Ӱ400tA/SpPo5@"p%$\ZH0L0SO/͎G-HMO<@C@C80@?K4,$@( @@\ 0Q: `$ ?(Pp 0O/ 0 @? 0O@<0o 8@Ǐ 4ɯ`0 ,0 (0  $@ 0 =0 5\#HЍT-80\%R0$Ğ4 0T -L M$0 Rp `@ -P@ҭ Z 00#00? PP@Ѡ H堒|0 r 0[0Q lt@aVLㄒげ~$0 :$0  -$0L Pp   WP@`@0 S@`V WP@P D q0 0 t@ u -LM,  0 8 4 \P0d o140008@_,!4<@_,!&.80X, 0$0C@00ˊ,400,P^TK9 p-LM40@SP0 0l0S  +U`V p  0[t0S0 0uU -LM r@@ -RP` =S=T8 K8 4P , 0@  V8` $0 #=0T00S<K <0P`ST  q  0t0S  `t @ =SP`{ 4Z-PN9 K9 -LM4 p`8 I8 PU4,0KPß S@T  0"h0偏 T,0 ᐠ,002 0`pJP@ ,,UT kP0@o%,"0@ PoJxV`0d 0@-0@K00 @9P@ ,T0;8@+@x#00 P 90;04p1 ,0K#P@A 0S@@l0P0S 0S1 SP 0S@@l0P0S 0Sl0P0s ,0P $000\%0R ,08 0,5Sʰ 0p00t0 0S0l0P0\Sl,uT80080PiiN9:iiT@-@ 2T0, T:F@ 0000 0S00l0P00 -LM, p0 40@⪑4 QL+- 808 0 S408 h0`,Pd 5, 0; PP D0 RI :80 X4`V,dT ? l$,,4` h0``; `0COPPh L5PsP5,5S,pS.V?,&0pW :494P4 SHŐ 021HX940P040 : p-L Mp@P0Td``  pH@`< 80`@=phK eD:i4K9*@K4850 aX!RH P P t00@P P P0,K00P`t0 Po 0 S 0S:0S* 0S t 0@ 0 R0000蠈L x, 80` SH0P`400` ePH0X YP`t\\n4H0 0SU ,+8X00V0SJ000PUXQ0 0S 0S 0;0PX0Sy L@TV T0@0K@\0@t@X t b0P@0XP\Q  0`P1 R 0, $R0000 B,8,b7,0H@Pj<@ Tp@@K4P C) 0S) 0S:^0S[*4 LS> 0@KR-`0Kp KK0`K@0@pK0@; 0S:0 2t  0S :0 S^ t TX 0t0 DK9\:TK9 -LMp40S 0S W`lP@ 80380@TlP@ 8 1P0S+ U@Xl 0S!0UV KPVl0`S YIV 0S00 80A X p0S 0S 0S 80 00SP803803;80380VY7VlP` 0Sz6P  |00Sy $0v r -tK9gK9 p-LMP` P@0$Si@peii -L M@P0  00 0R@@ -LlMp Pp  @t0 p T㐠0|  04S@ T@ h@K@ UlPKp 0PP@\l [ | 0(SO 0 1p0't 0St  0S @0pX W Y | ,0R@P 1h0 0S 1p p0R0S@0p @ 1( ?R 1$ 0 1( 0 R 0 10 0L Sl0 x Z  00 T xP660 0 40p  7x 80 M x0P l`1ɯ @00V00S& \# 0pǏP@| $0 0SR 0Sx |0P,!0 0Q p@0F@Sl0 @ x\ 5|(  #' t0|0  ( 'x@80t 680`@0P` x`n0x ,00,08P@ x5Usp v6Pj@0 1XɯTgg3i -L,MP,0 P œ0@ @K0ZZ@ 0 pD D0S~ @@$0@' "p X QDYLD 8Pc@KD 0S @ S/@00S@D0K ,0` 00 K,@ P 0@H0 ,@ ;D@4< @\D@ 8 @H $@ PH 0 &p0  &0 &P0KP@0KPo7, E",'$`PP0 K00K0D@ 0PT, QH  008@S@K0s@ Ypyi -,0 L 0E0 0 :iii-X0X  00P0\ P0^Pii -0LMxxpP@`0 0P 0T P0U  GMP 3iii -hp@L `P90 0!R 0U R00 R 0@@0V ii0S R00  -LMP@`Q 0SN 0S 0S0 lQ 0SN 0P $0pP! 0 00 0 R0(p 0 p00 00000  0S 0-PL@D> 0P06M -LTM ` 0&p  d h  ,0 l ` 00\0 p8 X 0: S 0 @d kP@pt  P0$  00CS ` <P@h 0RR<0 4 D0 @0 tQ 0 004 D0 Ph0S 2 4AT Q @_ 0S 0Si0SePH P 0SL 0@; DP \ 0\T@,PB,0K /00P@yP4Q;;S 8 @ ,0P `0S 2 R40S P  P0( R00000cCQD Q080 < 4 P P0( 0R  R 0L0 0L00 PRP P \ 0HQ0㐐AH 0,Pih RRt0S 0S0h#70P00S`   <0d   jP@*4P+ 0C R    0@$;D0P 0P ?0/;?00 X0+S   Xl fk060hQ 8 <P0QP 8 ;;S 8L@0a02`:K9(gK90gPh H0 S00. P (0 S000000@P 0S 0S:0S* n 0 RP0P0((    Q00Ŕ0000@000,D2ph70Q00S0?00h R \ h0R0P00S tQ\p ,0S# P0 K0P@ X R t0Sl  j06000`00 W`   ; J`l  j00 K60P0P@XQ t R l  fP0@6 0K l fP0600d   iP@0S P0 K0P@ X `0R0  0;0 l ej06t0Sm 0 d hP@ ;;SL0`00S6 P0 K0P@ 0 ' d0^# 0Sp00^ 0 0 R00p  R JX`P  Xl j0600 SJ` 0S:0 5P@ 4 R@ 80 s@ 0@D 80 Q08  00b4 <0  NP %2; ;L@DK 0 `@@bP*D0S'\ P P`XW0P (Q  R 0.SR 0.SH0P 0PW -L8M0`\@ p@: \@7 P@0< K4\08 pPPaP@@P0( R)0[*0[S""[0R0 0R@ R G@00P@ K0P@ @P T @PG@..PL9- -LM@ KP 0 0 0- @DP L@bKP00 4 0 0 -( L0S 00 e 0-LMP@ KP  0S 0Sl0P0S !GF0000 0- D0@L PP0sv0鴴: p-LMP0 @B 0  P 0su 000Hp @_ 0S0( 0p00F0@4@'H@p鴴:0 0S00D d< X R  0S 000 p-L M0< `Rp K'0 R= 0 00 0 R  00 0 O0 0 R  00 0( O\0P@ 0 0 R 0  00O0000 00 0 00 \  0@0 0 : -L M p`@2 40ST-4-4-T-T-4-T-T-T-P0$ $PW 0Sh0d `0X 0S  0S 0p  St00 4;J  -LMp0P$K`z0 R 0 00 0 R $00 $0 O\ 0 R $00 $0( O\@0  0 R"0  "00O0000  0 * 00 0S00p00 0 0 R00t000 0 R00(0p0H0 0S0000 0 R000 0(0 0 R000D0,0 0 R000(000 0 R000@040 0 R00 00080 0 R00$0H0<0 0 R00d0X0D0 0 R00l0P0@040S; SP04 $  L 0S 00[D040T 00h/4[8$0\l0 00 $00\ $0\0@0  0 KK: -LM@P0S` p0s 0s0s$0sH0sL0s@0sD0s3 P0$   0Sp00R ᧊P R 0Sd0X0 3 R 0SD0 D0X00p00D Q  0 R008#d0#X R q P0$  0P|0s4 00K R000040Sx uSn 40p0P\4,0S:00 S*(0sQ P0$ K  0S00p  Q *P \0  0]bP00s000(0s P0$  0 0 00(0 0Pq P0$   0Du  s 00sP0$  S0st0s_jd0C 0Sd0X05D 8#8S0 0Sd0X0#8#888X0d0 0 R$X00%$d00Ћg -@P 0p R00p  LQ` ᚉP+Q 40S  $ 0 R00tiP   0:0*0000008  0  @z O -LM`p q4 @   w 0Sp00Q PPP  0St000 0  0Sp0,0 ,  0Sh0ɯ0,004 S \4  4 PP 40 4  0 R00tpp 0 R00p@@PP64 0PP,4 PPPi00, SR000,\ 0S 0;00 R 0S 0;04 0u 0 R0000 t  0 R0,0, p [P 40 J0@Q QI 0Sp00TO 0St00WQ {PJC 0Stpp7 0S  p@@-pL9E p-LM040S 0 R00 d X R  0 R00 d X R `T BBpB 0  0u` {qt vq -$"LEM0`,0 4 Rpy P P0RpW  ]PcP1 RW 0Sd X 10S aW  a0BT1 ,0S H,e000000000 0P 0 0C000C0000Bv qw  qMOK # 09P 9a4a0a+a|dgL9xg -TLMM`0 P,0  0H1 HQ9 H1L 0RD0R `DH!0SH L 0S L10   R 0S 0R H!  0SH1  p00S@( HP@L@@YD!000@!81\PD0 0C0 RD  00C0D!00008}@0: S Y@D 0 RD00L H"6T!R \  P@Y6 T1SL00C0HT!0R0C0 L 0 RL  00C0L!000H 0 RH  00C0H!H0 00<1 0P@~u ,o@<>8>00 0 0 00NK J9P@>8 ~]|dgL9L9L9L9L9d:M9 -LOM0,0 `#0Q p 0 KKI>KPpP1P 0S 0 0  p   0 R  0S00t000Pp Pp  0 P_> ]>2 ,0S ,咱0000@P1400 00000000 0PpdP0( 2RSOK0L1  0@! U/K  < PpE 0 R0000 0 00 PR0000tT1P ,s 0Pp3T]PpMOK TP 0'pW y l P10 o0 0C000C00000000P=T]  0S00t00t07|dgxg M9|:d: -LMPp@` Vv |0S ==00S Bu l== IP 0 R00D!d Aq _P- 0lQ0  PPV020 , B 00*  R0C 0,& 101,(0Z"p @(P;  $* ,PN9M9M9M9 -L M Pp``$It0V:  , 6 $@K@P$0$`P@t`0 S2  0,0 00D 00$/$~;  N9G98N9H9 -L M P`A \00\0SE(s,6倢0 0 6,@K@`0S-,0(P`sAp Q ;  ' 0,&0 00 00 Q,& 10C1X0,|< R,; * (\N9|N9N9 -RLp`$P@ $P`sA0Qd JP 0l1 P0PCLP @/P; 1 PN9N9H9N9 -0LM ; "`E9 -LM 0 Y 0 0Y 00 |ڔK x0K P` p0 1 B XP0KU0 ( p x K06KP`Rp@K P2WQ Up w 0NK 0P`5P"P0  00xK  6``2 6t3O PDj0H`P` R0G0 0Q . @KTPI:Q &0p0W@xK26@@ 80p:80 0WU  04C0  00 0xK26@K@P0p KP2  16TP:U?" 0K 0P` P P0 0 堀Q  6``` 6 3tO000DPi0H`B  6 @K@P`Q00 6 T 6t3O 0EK 0xP`_Ph0KPP 6``1 &0t2O 0K0 PDi0H`P` p0 X 0X0 0  XA 0(PU 6 @K@-P`0(0 K0 0P`0 堀 (0006 ``0 &0 2tO 0DPK0 \  P` l`P tAt Q`l x!U:h1d$k0@hP0S:0S:PP R `Ppt0l0 `x,0 S h,0j 0$ l!t ljl 0tlp |dg,O9 -LlM0 ` 06t0  h 0` d0 @l@ , p @4 0d `Lh@h0@ PP<0 X@ \ h x  4P0$  00CS4` PPl 0@RR@0 8@ H0 D0 x\ 0 008 H0 4 l0PS 2 4A0S*p@L@ pP Rt t0 BOK|  @K  KYP@`Q0 0R@`pd0S0@ 0Pp@d ` pi0V`0MKS >K>Kp @Pl!id%K0P0@00S 0`P/VUh1 0@ J H F D B @ > A?(K <|dg8P9PP9`P9 -L M@0K RK/P 0J000Kb0K/P)000J000 -LM@$K_` 0K pP$0 0 L0S, `0) 0#60C S............00$J0000000000 0  -L0S X 0S 4X TX L0 X P9P9P9 -LM Pp`&@00 6(@K/@ P@ X(&P0 (00( -LMPp@0 0"&1S40:SS- 0$KS80080 \$@  0P 00 (&P` 0 0(0 0 '(P`t:g p-@ MLPPP` 0DPײ4 00P@βph#D:P9iP9hi p-1LMt1t`B&Pd1dA;&P P?LL K$PPC ^PP200 R 0000  2PKc\0 aL0S  ,$0+p@@L\? 0ya  00C0$1c&'p b3ifgccdgP9P9T8g -LtMp Kl @^PP$, < R  IPP  ]P3 U < $< R $0Q @0(0$ ,PPf`40S}|0" 0QsmlP $0 LM8B0 0DPP & F$0L 0VP &&U 0K("` a[L0S`$NZ @[0KY `Za[!0S 3PS1 0  tt@`? 0K`@aj[ HPN&J&D K*kP 3 S< 030#  U` A0 0"DPP  E( E0 hPP-03 [b:Q9 -L M<@T5' O%P  0 >+P7`@(p@D%c,V0Rc$c6 6,@K @ P@`$@bL0, S5P3 d,l % %y0Q9 -L,M$0H  2 H  0*P@ K0CP@0,(  ? /DK;D PPdD0$P@PP[ 2`+c0 c@b+|0GOa.6 0P 6@Ɔ&VvbL0 S b($b 6@T(6 S DK/ PP&D,0PycD 6@TH0@ 8 K4 00 8` , %D ضhdT.HQ9 -L$M|0R 0p<0 0` 'PP &P3 V 09*PP$00@0  0BPP0 Kd0pC4K ;4P 8P  PP40@PePP ;`8  c6`8+40Pc4` 8 @04P @S<8 3S 2# S 0 c@a+,0BD Oa.D0 6P0& 6ƈVD@ƈaL0 SD# Da ($&a &6( _ 6@T,6 S 4K/ PP*&4,0Pb4 4P 6@T8 0 <  $ *<0(0$ 80<`68#1$0&0,0( |0,'`4P ?@ 0R A {C80S `8 `0 2 dghd -LMp=P@+ R<` R% 40 S|00X?< Q0A@#,___$0 :$0 "'P303 -PL  b^$P@L p ?0 0 )B@ C -LM 21#pR](6L ƞ0R$S d0P P U0SE RPASS!: Sa7 RPQ0 S6 0&U  0@0d@  P0``U 0$@,0W ,0 Z MXZ HX | PQ PS`Q9 0-40LS@P0 0l0S 0S  e"0S 00  A0P0" -LM r̠PܐY@8 K`'8` 00 , 4P Q#U 8` `>  0nA0S `CBT 0S80 0 3P`ѵ労%.:PN9 K9 -LM4 8  8 PU4,0K PŸ @T֮0`"h@\,0 `,0 0p@ p P@ ,"T (PH_,F0B_$_660@K @,P@W$_L00 S5P@3x@ `0 ! '0807!( 0S- 14 ,0KMP@ ,"8 00 0!d0S,0 0S005050d0,P0$ 00080000 ,!080  80P(iiN9hi,ii: p-LM`0\0 \@@ TP (0&\Fp0  KP @p00 R Qd 0R !0F0pp 0000 d00- -LMpP ;pp@7 `+P_U 6p -L MP, 6Y pƕ ^0`/0 &,@0P_,0S  6pV0Y0X00S ^ -0#LRL R0SR T0 SL `0 Qd0 HSpQ9Q9- 0괴: p-LMPt0!` 0 |P@ 000Hq0( 04@:"@p鴴:0   0 0S  -L M@   0  04 $ -L Mp0P(K`20\ 00 (00\ (0\0@0 H!0 0000@ 0:#:0 10 00 (0H0q0 ,( 0 40 0 <8 0  D  0100D0 d0@040S; SP04 $  L0T@$K44 8$0: -LM@P0S` p0s 0s0s$0sH0sL0s@0sD0s" P0$  0R ePM 000 0D0 100 0 00 00D Q 0 0  qn P0$ W 0P"0s[ 40SV SSL 0pP(0s> P0$ 8 0R eP \0 0=P00s000(0s P0$  0 0 00(0 0"Pq P0$  000sP0$  S0s0s -@P0 LRp` IeP$ R 40S   eP    0:0000   80 0   UO -Pq@p@`0  v`SL  eP  QR0`00R@ 0S 0;0Q 0S 0;0TV dP -@L40SpP` 0 00   U  Pp0! B! -P p40LS`P P P0RGV  e:P:@1!R/ 00' !000 00P 0! B!V  ,> P =====xg -L\MP@H D `P P0RpX \ `  =H0T ZHP = oDmMg \ P0R0 0"0   P X 9PD L 0T0 8!R 00T0 0 0d0  X =0: S 1H0 T P S0LP0 0L! !L L0 0{Ph 0 D D0S<88Q00 0 `0T  0@P @ P #$0cuiP  T000 000 0 R( (0,0P, cNPh p @ DP0SL00<m0Pp0`:T9eT9x:0eU9,U9t i 0-LMl@hP0TdT 0LL@H@@PJ8 400P@A,eD: i0e4e`U9lU9t i0 s  p-LM0`s2 0CS0.( R,0,0,0 @T P( 0!!( 0 ( !!H 0x@Tph 0!6/ptU9 M-LM0 0, `P_ 0`P6pǏ T @PXOWM ,p1 @ PP` (0* 0 0CSSlh.lh.i.i.h.lh.40S0Q1,0S40S0Q 0,!6}/0  !!( 0 ( !! 0 x @T P,\0 X0@&p?XP`ʔW(E,0|U9U9U9 -L$M0, 0@40 Xp`< 0 1s@:4`p X<0 ^ , 0PP (0 X  < 0  !!( 0 (  !!Q00000 ,&&0 @7, 0@S,0'^"0, P-PP 0  !!( 0A (  !!  , !(0 6(0 !!U cP0140 \p` 1S @:`40pX X  &&:80 @ ,T0PP0 $ (00!!( 0 ( !!QQ 0!!( 0 ( !!!0 w,PPP"-PU|[ 0!!( 0&( !!Q, 0 ,0@S,8 06P710  !!( 0@ (  !!lQ U@P@ (08 ,@0  !!( 0 (  !!=.hx 8P801|4U9U9 - LPh? -d0L@pT`  PU(0@T0e -L@@\p`#$^ PP 1Q  Q R \P^Z0P P U0!R00R0SP UP 0-L MP@0K K/@@ @ @@:P0  S Gt?0 , !( I(, !/0 -L M ŸŒ p, WP@`w 1Wt 1Wq UoV  ,0pc @ PjVa#@T 0X1 @T`5 $KPD@T 0X @T1 0@@ @ @ R0 0 PT KT 0 00/0u00`0T000040/w0b0<%X<%:::U9000 -LM@0Sʯt/p0 u R 0 0 0  (hKv0C0:U9M0Ѝ -LMp4, 00 (4 _40 ,00|18  b2 04 `P@0 0 ^< p0#20# W@@ T @:0Pp`WL4  0h08,0 <| 0 @ p& 08 0 "P 04 L 0D042 8 L4 05bV9 0-LMP+ P0 4 0h@ 40 s20 V9 -L@M000 0R, 00 3 @01001P@pT 40ST (0!~ !!(0 0(0!!000 Re ,  0l"0Yt%W` (0P0!!( 0C ( !!( p/00S8.V X  0Hc P000, 0 pv=00+V, 0 }V000 ,0tu, 0k `  0```*P@  , 0V000 d=p0  0, G0H001t @O0 @41041@4 i3iV9$V90V9 -LMD R * < @ 0   DKP 0@8P0SD0Q  S 40R0 0  (0S  DKDK000( L Q00RP W0SNP L@ $0  0l ` #6P`1`!0CS00Lp Q   0Ka0  H 00@P 0V0R00S0 P PUPPU R 0 0,0cp @_0 P0Q  0! 0 fp XP@ĐKT D0 K}P0 1@ TZ0(^00S  0Sw 0(R00S0 8 P0@000̠ ,00 @0K40 b 000P0@ ĐK 0 0 0 S  \ @P`1sS@ TZD0uX  DKa PP P04 0R0 p 0p  0S W 0SI @000R   08 D0 Œ0@P 0DKd9p h0R0  60 ^ S,DK 0D0u+0  ! (( !@1X01P` 0C( RVV 0DKV h0p R0000 00m,0  ! (A( !0@ 0 cH000C0t 0(P < F,c@P 400C400P0 !( 0&(  !+ ` 0!!0( &( !! , !(0 A0(0!!DK 08? U Q`  ` 004 ``PU~ 5 @01001V0 1@0140  40S 000 nD00 8 Œ@0P (00  ! (C( !0 DKp h0RrQ 5+(00  ! (C( !0DK D0rB* (0 0  ! ((, ! !6\ (0 0```'P 6 S+@0!!0( H ( !!b(00!!( 0 ( !! 00 (0 ( R tr(00  !( ( !*DK0 0<00< SrP` @| 0@@& Q00V@@T1 | (0' r*0 , !( (, ! DK0V P1LAp h0R 0$ 000 rp 10 1  101*0 (00  !( ( !@ "*0@ 0 cH0 q:0>0 S  $ -L MRP`@A $$0  "=  XF 0o]0$0 0-@L$6P0$P@*@Q0:@- 0 00 0 80 0  0 0 (0 06P@4 i -0P@LT`p 00"  @TV 0 R@X $0m@U50S SL0 Q* Q$0`0SpPꬆg4 i : -h0LM KRK L0+ C'|o54 iiV9 -LM0S4 `0CP{:vp0`ZC%Z0>0>0Sp1x#  n0X< `80  40,K<  P8   W00 P00S 0~p Wz3XP8@e,T@! \ 8 Pd0` @000 l0 NDP0000,h0 00Kx H0 0P8 R  D:G8 -LM1` 0 P@p@  @0W `@^ K0 n @`P `@@P0ps8e i6i':V9 -LM>\0ǠȠŇ@`P'0 ` p P`P000U 0 0 00 0P(4 PP W9@W9lW9 -P`LMY/p  '%P@ (0%Ơ 0!!( 0 ( !!0h kX0P`@:P`YX >h#XW9 -PLM`@ * pKt KPdJT: 0 #Q:b 0QQc05$ 50P ;#得6iiW9 -.L$M 80 0 8 0(0K#̌4 @# 40`P `@@PZ8` ,4\T \1,0  bp 0^`/ P  04!@T( 0!!( 0 ( !!40 S0 08 @:pj,0 0Vx,88 \0 h p0S ),0 0 ,p:W96i4 i 0.  0 -L M0@p` P000 k0 BP0000 . .$0K PPP l0 $PW BG8 -L$MA0 0(K!@40 P0 p`@ P9PPL1, 00X c`p* P  0 @T( 0!!( 0 ( !!8 0@ 0@:`pHX0`Y4pW,, `9L040D Q R(,0 a0  i':W93i 0 6 p-LM΁X0@^0PK@!@ '`P `@Pp i -LMPN4A@Tp`0l,K, T0   \ 0,j0 i'W90 -`LZ 0S ?# i i@b: i i. 0=., iW9 -LMp@T 0R 0i@ 0TP`P @TPPU L  @ 0P00 0S Sk i i i:W9 i -LM@P@ `p@T 0|U @iX ` 0SP0P 00Q00$k0 0C 0 i i ig9 i3i, i 0-8@PL ((  0P000h  i i i -LMPU 0S 0 0`0UpU @S 0SK 0S' @0 R 0` 0S0@  0V@@@`PUPU 0S 0SP00S0  0UP@T@P 0@T 0S 0S  0R ` 0 h0@S0@  0V@@p`X@T R0SP0J0S0  0UP;@T@pP0 -LpR 0Sc0R` @T` PRd R 0S 0S 0S p0 0Q 0S!@ T0 0R0 0P 0S0@  0U@@@PPU*@ P 0R 00  Sp00S0@  0W@@@pPU R0 00Q 0p 0S0@  0W@@p`@T@P{P `R[ R 0SR@Tu 0Sr T 0S  X0 0R0 0P o0S0  0UP`@T%P@` 0 00T Sp0M0S0`  0W```p>@Tx 8t4@0Q 0p '0S0P  0WPPpP@TP` -LM `R 0SPXPU  0SY   @pT p@TPXPU  0S@\PTp 0Spp 0RppU @@T p-LM`@PP  0@Q : RP T0 0P \PPpP  0 Q: RPP  0 Q: RP 0S 0S0SQ  0PR 0P  R 0P 0S 0S0SQ  0PR 0P  R 0P P0 Q0P 0R4 $0 $0cc0S  0R 1P 0R 1 0-LP@@T0 0-L@P 0!0PS 0h0 p-LMP@ `0QV php p-LM01PU+ g`Pt@T P10P1tY0T0pK`P  X0,P0 0tt? @nP `4X0 P LV@TP8P0@$ܑ(b i4 if:W9:H ii,X9 -LM@T0<<h((t  P1t@0CP1hiH i i4 i0T 7> $ 0D0 -$0  CHL0"& -$0  CHL0"&  -dd!L M\ X!X T!TA P!PQPq L!LLa D!0xH<@P000000` 000000000000[0t0PU Xt@ 0 @床 0X@P届x tX0 P婊To0 iXX9ixX9iX9iX9i4:X9 iiX9ċeD:X9iX9H iY9i -Lp`^(0 S$b ,0 @P0L0 S h0 0h00  `0`40  ( R 0S(m HH -LM@p` @(0 Sb$@ ,0 @P0L0S!]h00h0 p `0`a40  (0S 0S(i HH -LDMP*<  8 <@8 P0 *, 40 , 0 @ D 0_SVK G0` @0004%Zd0 ;P0000, 4@0 0 @Pp d0U $40P00 x G, $0\p T  0R ,@00 0RL$000,00@ ,04P$ (40404(  4(040 04040`0408R8<<@@D0D`P0L H  0 MH`Lh00h0 p @0@40l \00^00 Sl $ 0 600S 0 ;$ 0R@%0W (04S^ ,0 bPK0 P0KPw Qu40r808 Sn<0<Sj@0@SfP0DSbD0S_LQ 0SY0U 1 U!000NQ/!40S000 4@00S$00 0$040l ^00P00 Sl $ 0!600 ;;0P y ,0 0 a,@00 R*0 ;`@:PP 0P00 G8:0 ii:iiD i0@- 1x@P \  ^:\ $0S 0000h0S \ 0^5:$0 ^%:\ 0x0\ $0S\00x00 0^:ii -LM @T`pP 0D @4:4 Q0#03QP U 0U 0S: 0-@ TJ3>0 dPtuLe00 :P# -LM$0@~B@N@N@ -L4M00 40 0@\@K@ P*0 40\h\ , KCP, V,$0 D V* 04  Q0#03QP D0 0R 0S:Dx4 Z  @PK0@400  D`@pK00K KP Q, 0S:0$ R:X $0R *0S!* R 0S!$0 S: 0S* R 0S!, %*Q $ 00\*\0 5@pK00K  PR,0 R/*X $@pK0 00K P0D 0S*, , R 0S, %*0S05,0 5:$@pK0 00K P4`Z0J0 0  @ 9 0 Q0] Q[:D RQ 0SD 5$50 5:J,D 0F 0RD $0 ( -LM@p`0 P000 Pa0 8P000(0K PP 0 (P9G8 -L M04`p V `1Wp!V`!, K00 PP,0@y 0 R0%0%0 0 T0,0 0S*$Wa: 0Rc` (0S$ 0(6C0D0SN4 $ 0S  V@ 0S:,00 0x0S0x0h00Ch0  0l0, 0hl0 ,@ 0 (0 r $ - $ (0 $ 00( cc40(040 $  $,@ 0Vx0S0x0| 6i: P0-L@P L0S40 ( 00S0@T0(c -LMp0`\8`5@P0 0 P  -LMP$ Kp`@8P* $ 0S $0S(0SLQW# 0 S xp0P 0$$0U @p h000Ch0$O@PTU0 Sx 00h00Ch00$ 0$ -L. -L M P` @008#0W  p/P 0 004 00( `0,` V0 4 p 0S @0S? "S 2@ L0DpS$(P 00Sh0(0h0(0  @0@R` V0l l  v/ 0ppg`@L0SU(P 00SK40p 040Dph0(0h0(0  @0@L R 0D0S  0pp3L D0S R R 4 <004080$ 0ڼ4 <0 80 $ 0 ͼ}#G80Y9dY9 -LM`0p40 P@h@$U, ,@PT( ( $0,L H8040<  @0FT0D  PF T F0T0(@TY9Y9Y9Z98Z9 -LM@ 0`p Pq0 W P@   ?C00cSP  P@P ?C00cS <$|Z9Z9Z9Z9VUUUZ9,9Z9 -p ML`8@0P(,0!0 004 0P|V' (0.9 Q Q/ @(0  $!0B@@T  R R RR '0( 0"2@@@T ~ P  R / P HR@Z9 G8Z9([9`[9[9 i[9[9[9 i i\90\9H\9t\9 -X0X L1?0c1Q< 8 80 ?RhW:gfffi :fg 0-LM@P K%1Q 500CS l.\.....\.0S Q  +a51"% !\|0S @\0P+a 51"%P 0S0L Q 0@S000 ꬆg:3i -L R0ԑ00đ00 R010201000ꬆg4 i :NN -L,MP@00 4 S` 008Q<0 }, KPpc,0 $080 0Qi $0 @S 2Q*<\pC>20 0pQ P000`!)T0 +P000PK00$ 80< 0P' $00 >2>Q0\00 5:40p$0 , R ,00C,0,(0,U+<0S pp0PK_0 0,0 80 G8 -L$M`4 :#:S$@>0. Q< "&0@ PD  H *0 KP 0D0 8 0@PL@  1 0<S-*$<0Q*0 S^ 0S[$04 <S1$ (0 Q 0V)0K*)K j%Vp:00L00 S  0<S:H*4@ DL V8 (*80S0)0K 00 HaP 0S)KZ )0[ S  )Kjp%V:0 , 000c X P ) K D  -LM 0  S 0` p @ 40S0@0S0 (X 0WPU`pW >0~pW  0h:#:S 0Q0S:SQ::K q   `PS8 6 $0 0&P 0SR  R ,0( 0C,0  ,pT  0 ` 0`K AP000$qP r ,0 0R,0 $ 40SS SPT P: QS@@S. 0   000  : 0K 0  PH 10S     0@ |0 8P40 J,0( 0C,0 : M,S VʥU]  R  /$0R+*  & -LM`P @75 0S2 *S"*`R 0T)@PbT >0N@T 0UT$p  00  #)( KP(0 $ @D P<)X -LM` P  0RN ``R >0. RD 0VAX>:SV::$@0p P000 Q0 -)P0000 0SP (0K PPQ0 (Pa)0 Y)G8 -LM0S *"*R 0Q bQ >0Q 0\ $ 0@-@ *"*R  P b.P  P \ $@" -L *"*R 0Q& bQ >0Q 0\^ `/`/`///// 0 $T$ 0 $ 0 0-LM*"*R 0\.@b\ >0\$ 0T!0 H,&R$P 4d 6R:`0S*#0  0pP 004 i -LM ʠ,ʠ\ 0R lR >0. R 0^ $ 0HP  -0LS    $0` P P #  -L $~ -L,M00 R0, P4 8 0@00 0S ,0>0>000  #20#0 Y030"8S8 p`004 $&80! 0 0, < P@<R0Q6 `0 @000d"O0 'P000@, $2 H)&R R 46S  @ ,  0o',0 0P@,'\ 0 40S 0 @ T 0 < t <\ Trp 40S   |0@ 0 P 4 00 T|0 0 y, :#:S 0*G84 i M-LpPKhM0p KK0S@#&jDvp@K00 0> hKW@0V:@0@ l0 0 lPK0 0 0 P0K 0P@BlPP(0)@T@Tl0K`V6@_K03Z !000010! l@T0!!( 0 ( !! ElxpPK |0 M-L0P@W  @ PHWVVp@-@^P 0S 00p`0^; S 0S1 0S 0`\00 S0  0Q   ^ 0S 0S0\@ 0^@ @ @@@``0 R 0S 0S 0\`00 S0  0Q   0S 0\@ 0^@ @ @@p@-@`PR 0SN0RK \ `  RG  R 0S  0S 0S PP 0S 0R`S 00PS0  0^    0R0 0S00S0  0Q   R00p 0`S00 S0  0Q    R@  R 0S7 R 0S R 0S 0\`S00PS0  0^   0R00S 00S0  0Q  0`S 00 S0  0Q   - LRP p ^p@W@Tp 0Sp pZ  0`S `0S p@W@Tp 0Sp p \@R` 0S` ` 0R``T 00S p-LM0@S`P @P0 0S T0 0@ P PP P;pp 0-@LTP vP@ @T00 p-LM@PT` _P`@ @Tpp 0S 0S0SQ  0PR 0P  R 0P 0S  0S 0SQ  0PR 0P  R 0P P0 Q0 P@-$$@ ^  0R\@ 0R@ -LM @, 0 "X0@0 ZYڴ2@@@0S T h"Y0 X2 a0@"6!@AdA4  8 y0YDQ< <0 b40Zj801c4T0@j X8 0f4 "*p@0&08`  0>00 00 >000 0P0t0 8  0, \ (00`\0T 0R^PA0 pW 0gS*ow@`0S:>0 N@ T *$PK0S J $T:|ᦴPh5*DD@ᓴ0>0>0 0$:ff,]9D i6iX]9|]9 -LM␢0^@xRxŸ80ShD 0pnS`nL> 0^ 0 ^@ 0R:0^@60 0 R   0S 0C^P0@P0UTv 0R( 0R0S*0B60 0 B0CR0  R  B0^P @P0U 0R*60 0 0R0  R  B@0^P @P0U: ii]9]9 -LKP -LM@P\# ^/T%*p`V ^ 0S\\ 1`1 @0 0XCvTw 0@P<0~w4m{w(3v4 i]9$^9:iiD^9|^9^9^9_9 - LM dw0\ , xx0` @,pP 000 pJw( 00\Awo>w:,_9ih_9_9_9 -LM0@Kd40 )XğX PPso0 <`S@_8` p``Vp U.T+ @Pso0 S`@_@TP WV3D`Q0Q PoOVU@DKY 0s , 0 Q00S (0Q 2"D0Q 2 Q pPW Wlu 1"@Tk R0000 04   B (0 $00C$0U (0 00` 008 08` 00K4p,0 0WI(,0p$ @0  !( ( !U 0  !( ( !8 RY 0  !( ( ! 00 01@TQq 1@TATeNP:7R0 R0 igg4 ig i3i ig_9 -L@\Pp`U  ,00,0P0  !( ( ! 00 00  !( ( ! 00C 0, 0 0, -(0LP4@ T 0  !( ( !0  !( ( !T 00C 0, 0 0, (0 r R0 |20  0  !( ( !,r00C0(0 i R 2a 000 0 !( ((  !  B 00@S 0  00C 0 R000!!( 0,( !!P<00] U00R0S 0̠ W0U0V00S (0T 0 TV U0P0UA  V 0!6 P0 U00R0S  0 0  0 0 -LM0PUp`" \ \ WF (0?(0P!L R% @0!!( 0c ( !!0PU籩硩0 !( 0 (  !0  !( ( !p1W D(0  0p   0!6   0-L0LP@L|00 0, 0E$0 0@0sD0h&>/ i -LDM80@ ;pBf <Z80P#:0#UhKhKPWPUPPU@0Z00 0!!( 0 ( !!PU X 80 Pi(0 @ Z00S 0 !( 0 (  !0 !( 0@ (  !$g -LM KH彧D0 #Q :b 0Qc*0 6ii p-d LM\@D0PQL` ,j@C,0/(`GBpco0 a3i i_9D i:hh 0@-\@0/,C2bS03S<0<<0bQ/BR@ H@04 iVUUU -1LM 1 D : '/1@B1 0Y1h!@Q`a?C SXD00D00q/R Po0O:0S@VUP DPSo0 S`@_@P WV<p t ,0R0Sl8CHR0 Q 3i i4 i i i_9VUUUgggD i - LM0pL|H0,`V# 0,JV 80@ 0B6C0 P@|U``,0X@XTBD@< 40@^A4`V 3i i4 i i i iD i i`8 -LM p W  Q `W`  868&0sOQ6~F0 `@ R00^0S  Y / pWg 10 1D PZ(6 RMS00 400C40   !!(0 6(0 !!($10$1 01001YUp( Dp00p024ğ1^0 1 D0@ 0S h p0S  pl h0R 0  !!( 0 (  !! D0X00 \ PY @0KT q 00  X W~ 0S@0KT@ 0 @ntßX41P0410 `P@0 K0KwXP`F WB (0<@0!!( 0 ( !!( VP VƦU^ (00PYὦ᭦0!!( 0 ( !!  qㄦPAP6Q08! W8! (0PP&PeB h0K @0 0!6 g K P 0  !!( 0 (  !!00 G   ? 0!68 0P  0!6( 0  ( `(10(1,10,1P}zgg4 i -2LM"P@ @t_Up00@ 0dSB1Q d0S6P1d0S@D 0 ^cPelh0Pk ,2@T YX P(  Z @ YX0S400C40 !!(0 6(0!!( `Y 0P& Xሥ<1H0<1 0!6 &P Q0!!( 0 ( !!IA `0!!( 0 ( !!( Ip U00R00 S nXxLPti1018]TTP@Qgg4 i i i i -LM@, 00 ,( 0 S4 #!p0aW4A8@ 80R!p0`W4 R0 < R@0RD 0SP-@<40S40F,0 S*8PR1!SP! U 0 0c01cA(0P UT@(0#40 Q0!00000  B (0 $00C$0,00,000Z  00@@4 4 i i:i i i -`L$M Vj3Pp, 0 >0,~p'&@@  0@S V#,  R P0#03P@@T D( 0Sa < 8 4@ 0䒟T,L 1H 0H S440L  Q4 L 0 < R@0RD 0SXu?@)8Q PU 0`@T (0  (`PU80!P*, P 0@00LZ!D 0 S0@ .FcD TP01c(0 T8 0*R0# P < @ TT T U@.01ca @epP(0#40 0Q!0000 00C0(  $00C$0,0p0pp,0@T T` 0PP 8 f,0 08 o i4 i:i i i -LMo@T> aqPQ0000 0!!( 0(( !! , !(0 8(0!!00i00d0@_0$ 0R@0(0 < @TiG i i4 i : -@0LM@T 0( T  j@4:_9 p-LB MLP@  , `  0`\TP`PXL `0`0<La`Pa 0`xp\` 0`8$ a`($a! 1`<0!,148!t0dx |0htld0dp4 i`9 `9T`9`9`9`94a9pa9a9a9a98b9tb9b9b9c9@c9hc9c9c9 ic9 0- LM0PS0P 0PdP0P!\0PPPZx@Tp 0@ \ PgaP L0 P_a0h0gfg if4 i bd98d9fHi@d9Hd9iPd9 p-LM@`TP 0U- @T0P\@00 0S 0  00 00 @0D4P H$l Q0`Dd`d00d0p0<S 0  00@T 0S\f4 i@-0\ P p@@4S DP \Q DQH4H40H4H4DSDd00Cd0f4 i -X0LM\  0R \ @ TT000@f p-d0ML` @P0 K@ @ZP0,d(4p4gftd9-X0^ P ($\,40\DP ^f -EMLPM0,0 |$ tpR0S S P@,P `V FK@0D @P4 L$ p t H P@dd00C@S񟗑^/_/X`/X`/`/X`/,^/40S|0# @=|3 ,0S p,Hp,PP@ @\ Op P\k00@d40S|00 0040S+  x\ UBK@$@0PP@ 40S \\}<zf0 PP@ 0 b@\ pPP@  xT} @yB~KpGpGG>K0C+P@I mP1` P@d0SLBKAG>KA0C+P@ 0` Y( PU! WpG 4 O#J6; 0Z P@An7$R P`@/DTU WpG Y|@"80@d |4 |dg8:ccd9d9dgLe9d9f4 i -L|M<@0XpP 0 0P@40S S @0X 00 %$ 2!b10S pP 0OP$K4 4#RZE P  0 0 Q$fP @ RCN@ 0 "g0P C@\0PP@W0QC0X _ #0!000h00h0t!P0080` 1K_`O$K40@ !J"V `T 0 09XP 00d0 ff9e0 'XP 0K0 kP@^p KP$;, PP@PP0 4P$Lddgtb@:d94 ipgd9d9e90e9Xe9 p-LM0@( +($00PMP 000p(0; (P` $$4R@40S# 0@ P 00 t$h00bh0@1P WL0(,$0Y09W\p@ ddg4 ifle9 -LMtp$K4#&:@kP`! ($@Đ@b0O&#J46$;\ @ \@P 0Oi8 0+<08 P}i ide9 -L,M< @@ `d^D @DD 0RL 0 @_<00PH 夛H 億 <L$@D? 8 哪4K 8K,0KP40s Z<Ld  ?Ὺ80P@f"pdi`T^Pa@ 0K8 @D`4t0L 2Wp|0"H0V@84 唠Dp@p/ -,1LM@ t K `Vq\  bOm  P\h 00 0 @4@|0 \4W $0ą PP  @\ \  $}accf93if94f9@f9 -LM0$`>0^P U0:0 l $0S(: 0S$:06>0. U$ & @0 b$Kp @@P$0 0c#& $ a8Fb  e$0 0e#&BTf9p@-$0Q:0!a61c"QPo * 000"F!V:Up -L100 P l0XP (0J0!!( 0 ( !! , !(0 0(0!!-    (00Q p 00S0 0P00S P  ^^  30tS 0!!( 0 ( !!b—( *(   R0St@tP`0 p\0K`P `pVPU Y p-LMP 0R 0Rp]@8 @0`<P` P0Spg9 -LM -LM@H 000 0p`P W 4 1 s @:Pp` W400\ 0P, 0W 0  040 (00  !!( 0 (  !!0,00 1 0p`P P 1S @:Pp` W W 0 @  ~\0  , ( (00!!( 0 ( !!, !\ 00!!( 0 ( !!,!0/0G\, 7 \ ,K 02P@,0 !( 0@ (   !,壖,01 ,(00  !!( 0 (  !!,} 1,g9g9 -L4M@00# T p` Ẁ"0 /00S0S RT P00SX 0X 0R0v T 0 SX0pP0 00S*pe0崡@@0K`P KH  4 Lp D 0 8p , `PK 0S?0HK  00P@/ U8 W00W00SbP R00Q0#02SXT0 0C0 S U 1X0 a 0HK  0 <PP TUX g93i -0 `VL@0 P UDp0000    3i -L M0p` 0S0S0000P p-L MP@1a@0TH U( P0S% $@T@T 01 P0S j,@Tph@0  $Q(0(0( 0<00 R   0,,0S0@ iii0S@-+@,  0 000@[g9l:h: RQ-L 0P0000 P 00S000~Zg9 RQ-L P P 00S00000S_Zh9 -L@M\TK K < 4 <#:0K [0*":("000?Z@h9 0-PLMU^ KK @<4 Ġ<̌,ʠ#:0KK@ P 0[S*0":(0"$000Zhh9 -LMd2@P@Pp 3S,0S00S40S80S| 0  QT 0`Sm0Sl 0  0Pa 0R,0  0S0sO 0SN R 0S0S0S 0 4 ,\ ,48! <#R:  P, 00P @0  0,^,, P , #)0<P 0 10く/0ii -LM0@,0 @0  0  000 h01!p 1!pZW.PW'UPE"00C0PP*p 48<#hO\ ,,00@@dP c1`PX!UPE000P:Pp 48<#h \ d,,00@@5Pm P p ::::i -L4M⠒ 0 , P L SP`0S/40S 0S 0S0s ,0S00S40s HKH`KL0K@K cPr H00 ,PKjP P0S10P0 ,0 S ,9H R 40<0L0 L0,0sSp 00S40S80S 0 0@@P0,0S 00S 40S80SQ  l0` 0cl R+<4< 4l :0 l ,0 *1|dgh9p -LM⸡0p`DKP`KA(0 P gd K`P P 84K40[S2 Kd@KxK 1P 0 1\@0[d 0@0K@["tp0  K@ KT0 P \P 0S \00\0^$K K\PpQ|UL5T <5T5` (K`` P K0[ pS (K@K K 1 0 1\K/\Pp 0P WY \\00CS\0H4T? !<4T 44T2 r 10aR001#0p 10bP001#0003T 3TU @(,2.emUy @,2 q8#0000q#0000O|g!2R/W2TO 2TX1X2T p2Tx2T d2TW X p L2  R): p (2  R*0S $ 00SP 5#$0$  R 5R00%"48<#P a|1T @1D1XL1T\1T* 1PL1T N:@10SJW  0dh 1T-{T_ H[Wu 0Q0 T0Q0Q*00Q 0|dgliHLi0UiViiileiHgildiHfiHii"i !i i ixFixi %i i i9i9Ri Ii Qi Si Ti :i Gi Mi >iDi9Ni0WiHPi Oi Ji(Ki -9LCMpWP0, `(1 ( 5 -0S SS`0PH0SVG Q@ HPXPP ,蜠K E 0[S -0S h@ 0 SR8 RV4 H0S |0SH|0[Sn q@(0000q$(00 00PP( Pd00d 7P 0 0Y0 (ǟ,0 S ,4P0005S Y P d0 SK5$#Ġ0Č07K7K4x@Kl p0 lK0J/KK0KtP P 0S0 0F0, dKm\K0HKd0KcKcƟ@K.44HKHK GK3K0P IP@  zmP 80S0C80@T 80S0C80ş J/KSPL 00S 00,105 H0K Pj  şP.DD0HK CKH0KGK0P IP@7  7mP 80S0C80C@T( 80S0C80 J/K P 0S0 00,10C4 R-) 00 (tRIIOKDHK dKP 8ğ(0  P~KP( I J/KP 00S 00,3 R G( 00RvI\@KD\ßP HK( dK0 PBKP( E gI92 R 00 Y hK lP 000 `~ ZMP0 42 R 0H KRP^ 1 R0(1 0 8R 1R@VA  P`7m 000(0 d1()  5 0`00|00 R` 0S  0S`B U 0 R Q0 R 0[S0[0S[Q5#$0$)K%"48<#Q PS/|dgxb:i9G8G8g̋gG8i9i9j9lj90ij9j9 p-LM@ P2R0 `0S R Q0000S ph LP0`00 0*00 `Q,k9 p-LMP@}`# @PT00 0S S P0S SS00WR0S0@ R \00C\0 0@ 0 Z 0S0C 0 phFfH :Q0ik9k9 0-LQP 0 @R T0hK i -LMM$0YZ,0 0P X1  4Q x4Q -`4 ,0S X, 20S^0S[F/0SSV0SSRQO3XS O3X0P p@/`Kx   KU00  3  R0TK\0K;hP 0@ X4 !xK U0h0  d  P` 0@QP@0pS0S 12XKOK0)v2Xq  SK 0T1 `V OK0 S `VT\ oT< PU p ` 0S0C 0 00 R 0PV PpPF0ST PU p ` 0S0C 0 00 0@0S00PVPpP_FN\f l9@-|0\ 0S \ Q @ 0 0R 0 0^@0 0\f 0-hP@LP 0S P 6m0 0@0 S00 0\f -p0LM@T 0S @T P P R0600 h\f -LIMp`0,0 00P 0SvP,6 #P`g 0 0PU 0SPU6 100,0 S ,/0SU P 0 0 0R 0OK`0`0{MKtA0K<0A1T (K 000S: l R0600 P 0S0C 0 ZxES/K L700SP` V uhP 00 0 `|dg0l91i -LJMp0P 0 ) 0`0CS 0  0S /u: R000  R 0CS  NKJK00<0 K 0-K t6E|dg@l92i -pL@P 6 I`V70 0 @T6@  -LM@P6P RP0S0S 00S0 0-@LTP 0S@T00S gPP 0SP0S00  "40  "80  "<0  "@-`p000 @0:P^0) S^0S \PP\00A000P0#" 00  0#" 00  P0S\bflb -LM0@S S  FgPP P 0P P P0P PG8 -LM@PPP  0-P0L@T P0 gP0@T000i-P* 003P: 00 ? >-RALQBp`LL fPUe 0 S\D@ @\P0 S |dgDH8l9l9 -L M`4 X, 0 2PU8 S@OT1 PU0 R) 0 P@ 0X0Ÿ,Ÿ 0 0>> Y 0 0>>P@ 0 0 0>P@ 01@T p0S @T00 R YDJ P?J8 $1 R 0 0 \ P00Q00Si"QPW,p 0@ 000, PʿP, p0bSʳX0 0 R PZL0xg($i.i@bl9 -LM{, @pT`P 0S$ @TW @T 0 R @TU0 0 R`0 h0 RP:,0SW y  Pp0@b -LM@ @0T0  0 R @T0K K%d0SA  AR 0 R,Q R\0500Sh hS:00S S* S00S S:00S S* Pxgb 0- LP D @ ? 0 0900g900 00 -LM@~9   h -LpMpxPK0@X 0 x0 p`K @ 0 00   00#0 Q  +|dg̋ggm9 p-LMP\ 0S \pQ  R d00G\`@M \K GP @P ;PTT dP  dP T# T 00#0  p  qdP00 0  00  0 00   %PP ʐPPT@#bb -LM@pPPT T ~PD P1@T T sP, @T:Pa0S0 I0S 0 @ `0 PpP@ P`pI0J0 h`0S h000 I@`0S000 < `0S0   xgxbm9Hm9|m9m9m9m9 -LM␒`0PK@0x,0   Wd5%#000K@2 8K4 KK 0 u TpK@0 \0K0 4 [ K@ n@ *PbUJ@3P 5d0S0 000A_K`Da @K@KKKK 1 !0 1\ڸ0[00K [ K  OP ,0 S ,%* 'PPP/U t0 R 0TI KP ,0 R H|dgG8$n9xbPp <0S ,0S ,(@KD400  0 0   r 7@`>0S 00S R Q0000S 00  0S0C 0%  U00 0S S  0S SS000 R 0S0C 0]>}0 1GU>(  =Pp DK 40\0 r@|00 儠 删 > 0K?ZM|dgG8o90ixbo9 -LMP\@`pm:,K<4(<"4&<,0 %pK RW RN 00 0 p1W6 W- 11!1!2["[[2[UT 0S @TP00U00S 0d^!0 ^00S`n (8#P @ @0N ^"J0 0 0 1!1!1 ^ Z J0 0^Z0 (8#P @@^J0^ZX (8#P @@~0,$!PUV r @TPUVV~<8# (8#P @@ ~0,$`FD!0 ^!^00S`n (8#P @ @0N ^"J0 0 0 1!1!1 ^ Z J0 0^Z0 (8#P @@^J0^ZX (8#P @@~0,$!v~ 0q~ 0d00S S00S 00S S 00S  AE?Eo9 p9 -L@PQ@`p P 0S0S0S| 0SyQ 0S0S0S 0S P P2 zQ Q ^l \ PTVN R 40?80S0C8070 0R <0S'0 0  00 R  W8 RA00@0 P@ 00@@T p; ; 3_P  100 6PP <P@@@T10RP ~P@0S  48<#Pz00S SrPo @0 R,0 P000S]:: -QLMp@ ,  0 S  P x3 Y 0 S   0 S  R 0S Wh PUe 0S/ , YRAAZ 0 S R,002P@  0 @S? 400S; P 80S0C80100P:P 40 80S0C8000A;<5P@,@ <80S0C800A0;; V^P X `V 40 0SD 80S0C80<0`0V P` 17W 0Su`V <Y VAW,` i Pf Pc 5`5SA\80S0C8000`::  ^P` ` 0\0R00S4 Y:0:$i -LMPP 0SQ,2 0 bp@-@P`U RD R p00S SV 0S 0S ^ 0!$$ UV Q P 0 Rx0 Qp8#8#$0$  R R 5#$0$00S::0@-@P00 R# R 00P P "48<# \0 R P0 Q U 5S00000S:: R R00S S0000S -LMp@ 0R0%` J:V* 0 0QR0%` .:V PEU@ R U00SR   bMp P`U@@0 s,0K ~xPp` , 0R0%` *(0K mxPp` ( 0R0%` *?B8$iP@9080<0i -L$M4 0 8 ` 0L < S d:X YH PZ 40P80S0C80Iڜ)000IS6 P 5P @P H  0$ 0 "48<#8f )H0@\ ,2 x 0@10S(00)8Q8 R*H8pW  048< S  8pW0<0 T8 RH0Sa*0H00 fPpW L pp 048<@x 0  @ ( 0@0D@0 0$L@ 00L@0 @  0L40`(0QD0 t@ D0 0Sh@ R@T 0 00SCZ @@$ P   04 8<00 <$ 0\0  0@4<2D   L008,0@#2Q,6   0R0Q00S@T  0S@T Q  0cPT 0  0cPş000D ` VD @ 0S0@T 0"R@ 8 T8P 0S P0SsZ @0`C0(0C8#88#$(," @"(  L( H8 0VJ* 80 0 B0 8SD 00b#000C080! S P 0P U8 #H0@\ ,2 0@804 `Ĵ$ß00忴8 tPP Bs8s "Ÿ0D 0b0"00C0H R ,2 0@Ÿ@08 p㋴@Ÿ00冴Pヴ 00~0hR R:0`P[@ @PE( 0 0@8 @ D 0SLhIZ0S( 5}ZP2Wb208 HQ ,2 0@80zHP,20  0U6 KZP E,0K8 uP<080  , 0R0% *0?df`f@$if,b<ii(b8i$iH$iP@9 -PLUp `2X !@@( 0 Z P$4D 00b0 00C0p<i8i0 0   00 80<808 8<<80808 < -LM㘳㔳0aS008PU U p00C08P<0 R% Up 0R`<0S P<@0 z 0XR<0S`00\ oY 0@<bfiP$i8i(bX$i -造LE0S @`P00;80S Hp`80@@80S+00m&fiH$i -L4+(0: 0 :0hbxbbbQ0-4 $Q Q(0 `0P@ 0R// /(/0/ 0@000 0Q QX0RH0 R@0RP0R00 R80 0-pP@LP 0S P  )P @0 S00 0c>b0p9 -鸣L M0p`@A P0`P 0'S1@ 0S 0S 0S0S0S 0S (0K  #) P,0:S @p -Pr0MSk0 .oPV 00S]:XQ 4  40  R> R2  R* R < 4( <4@"4)<(#,(` ## 0P `@0P`(`$ 00S S00000S 00S S0 0 0 00SD1 R0^/>0pMcp1P@ Rn 0R0% :P 0 SR0l0P@ 00K sP 0 0R0% * V6 UV3 (pP%o=@ixbPp9PiHi`iP@9 -L$M8 4 8 p0Qg ," 0@40X<0  0 S< %D ` :V :4 0@ |PP0+!!- 0 @0S} ʀS S eS) \; R40@0  @0P84Kh << @40 0S0D=4P ,2   0 @@0S040x0004@ `:P@ 40S ,2 0@4 @ 4404 S S4P ,2 (  0 @@\ \@ R4 04P ,2  0 @@\ \40t4 40S ,2 0  0 @40cS=ʂS400S ,2 @0@@ RV X&S 40S ,2 x  0 @4H(0mP $);4 ) 4 l840S,2 p 7^400S ,2  0 @X400S ,2 8  0 @@ RA0h'4@{mP@0@440 X 1 0D SR*"kPF 1 01!1* 01101!<00P<( (6 200 0g(0 0Dn(@0~ Z0  DƟA.L` BP`0@ ` 4Pwml@ 44 0DP S : 00K qP 0 0R0% *WS ʇSf DS! Sw400S ,2 h  0 @@ R'XI %4@0lP  k4 @.400S ,2 `  0 @@\X)$4 0lP  58J4 08400S ,2 P  0 @@ RjX$4@0lP  #>)4 >400S ,2 X  0 @@0SIX#40lP  44 4S_ 0CS030S X X#40alP Z Ÿ `LP`0@ (`1 @0S40iP @ p`2P( 4@@< T @ 04  4pP4 s0 (0@  ck@0SF@0SXz400S ,2 H  0 @@\X\X!4 0kP  <}4 <1 R!4`P0@0S2 ,2  0@4)< ^ 0:0P@ Q,0K pP`4  , 0R0%` *H `P8K:@ixblp9Xiʚ;pixib̋gghip9`iP@9 -LM/R, 0 p^ 00 S0% I:X 0 ` P0 3V <+V V2 0R0% :P 3V0000`QQ@0 4 ,0S ,M 0KpPp  0R0% * 0 S0% :X dK$0\ d0Kc K\@Kl , dK0L wPS@@KHK0 H0KGKA HK 00 ^P@: 048 <:R0D0 00 H K\p 倠 |P p x 儀 h`K ,3 (3!10S dK K0 $(,<4<!4"< K0 l 2 Rjf9\@K   0K0 zoPpr  00R0% k*,Vc 0@S0% :P9 0!4 R`P Q 0KUoPp  0R0% *_ 0R0%@ /:T 0 0Ra% 0S" 0S0% :P 00020C0 `P 0K!oPp  0R0% *+ 0KoPp@  0R0%@ *<V0K0 nPp  00R0% *$0P@ \ 8|dg`ip9(#ibxbp9P@9 -L M0(  @ $(,<4<,4"l V@P (0S (135T110SPD@K0 C0KD KSNpA @a0@RS00@ SD0SA La0LRS00L S:W@A @a0@RS PA@0@ \-P+^pGPĔĄ``W Y *0.S,0V* Q:0 0, S*00S0C00  00 S000C00 00c 0Xf 0 ; f1Y -QLMP`pd V00UPT0 SRJ00SSFPES`FLSH0SBj0S>0S:0 S6?Q3 ?R0Q0E\) R0FP$ Q$ @R" Q 00S00S ;PP0pi0\0jS\ 0jSg PP -L Mp, 0p  4p 0SAR0 > 0`V @ T 0 R @T40S` pV,0 `Y0P P P  0   P  000P OP040 xg -LPRM40 020 pP 0$< 0 W8 `x U @T 0 R @TWPU0X0`P`80#2   X0#00 0PK EP<  0 <  4 R- R0' 0R0"00c,$,!$#,,  ,K!  00S 48 A 4 8 100S00,0 08 04<#$ 0P<0 <  <0 xg: -#L4M0P,0 0pT0 Pp 0R0% :Z. HK0H0KT0 0G Kc HKX0 @T9 h0 @@TW1 h 20S'Lg@HKLP0 wPePP x2 ,0S p,e@Lv@0S  P KT d2P@ r0:S,0S00S40S80S T , NP0S 0S$0S(0S X NPQ 0"0 # W $!0`eP h 00S! f@P0LHK SwP  dPP0P0 pid@LXv@0S   P K L0K iPP7 L 0R0% 0*3|dg1i(q9x$iʚ;P@9 -((LM0'Q,0   (\ 00S:p:00(L00 (( 0@℠K 0  KP` K`KPK K 0K@K,K`KPK  | 0 6@T 0  MP0 @T0[Sq RF  ` 0: 0000@S,2`6   0:( @@w 401K<1 0@P Q ,2 0@Q ,2 0C0@\ 񟗗/0$00<00T00/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0/0l0000000000000010,10D100S ,2 0@\ 3 ,0S ,0S,2  0@0S,20S,20S,20S,20S,20S,20S,2 0S,2B0S,20S,20S,20S,20S ,2t@K QKK0  tP 80S0C80 R01 Rb|K0 22)0[0S1@  TȠ |0dP*^TPK(@L0( cd 00@S*dPL ( @0 R 4@40(0@1|dg0ib1@K uKP80S0C80ž0[`S 0[@S KK bKP00  3 R K KK)NK(H(  < Pz!R 0 ! 僑 e0 00 S X3 Ra KK@ KKe0PI 4P0P K@, ! 0@& Q4 )-20SP9*dPK@K`K0KxK c0KdK0K0KKK\KK KK  !FK0@ 'P@KKK0 0KK[^ -x'1 R K KK 00[0S@@RT1 R K KKdX'= 1 R  K@ KKw 0 _00 R K KKi0[0S5#$0$.K0[0S5#$0$-K0P@ E?K fP p P  0R0%P {*L/|dg btbxb #iq9 r9Lr9r9r9$s9bXbC0ts9s9s90t9`iP@9 -&L0R@P!0 0P` a 000 aPU_0Sn 0Sd 0SZ 0SP !@( B("("48

 @ 0T  # 0@05S1#=#=`y(($i$i$i$i0i0i0i0i0i bx$i4bb(#i0$i.ih$ixbt90i$i8$iHgP@9 -LM p04`(0@S1!(P3T /+T T `V 0S,0K 8Z3T+0[+0[11,@[PZ0S (0K %Z&0[S'0[(@[1P <T -L MPp 0)S0`(4P 0 0A( Q0%(":P `@D 02P`P @0 00K( ^PP 0 0R0% *,0K( ]PP , 0R0% *'0$iP@9 -RL M`p40 @0S SP V g* }pP P`eV@1P@ AXSN SVZAP 0/0K 00(<4<"4!<^00 S: 00g0 @P,0  00g0 @P,0  0g0 @P*0  0g+0 V R*K"[P"48<4 #8V0Pˆʎ8$i$i -0L0@Sp S WS S 0@ 0S 1  W0 @0`P``0$i -L,MT T0@,0  PTh /  )0LKL lPT T0hh} 0QX 7 0(@3T NT +T-  PP; p3T0000aa 0V.3T !T +TTh0 3  )0kP@9W6WH2 ,0S 8,<TTh0 2  !W1P@ <T (tP@  00QTh0 1  )0k0SVT h 048<,Ơ0Œ= )0PKP kPT T0hhh@@K x@ [R# R Z 0STh0.  )00 ekPT T0hh1?0[0S S #K?0[0SH@K@$0 GkP|dg u90$i -LM$0K@ pW3T#0[#0[00QQTPU@T ` `[U*0 W P;V; U1`.V@(Q( R0,S  3S00! 00!R0 -L8MqP@ `PY 1 \ 3RC @,R/ )R R 0 S  0\:L0K qWVL0[0K0[ 0QR+R(@\:H0K( ^WVB0[ 0@\:T0K RW%[h00SV T0[<R0\:L0K AWVL0[0K0[ 0Q 8%|dg0u9 1 S0øѸ1<0 T*V 40  5S!@00C000 @40H@;40 Pm< CSd0PUh }<0  u0, ?0#3 00D1ixgbMb -L M0PS, p@`Q PN U 40 40T 40  P|TX!,2  ,  0  0l[0 l@`Y 9 D"0 000%G 1!S:R+ 8C8Sڼs 01P0 S @T 00,"1 1Ba 0@800D!D10 !01!10 ! }P@{ Hy0`P{A`៺P`d0S @40W@0 d@PO P@P 80< 0CR80:y9|b:Mb\blbd0GS S S5SS ʇSS S p-LM@!`\ dP P M8p3000  00  00pQ 0 0S X48pPUm0 ( py9z9 -SLMpP@` R00Q00S3R`U-  P$ W W *`X ㆱ c0X0P00S` U ိ`   -L Mp, n{0W00 4 `0`00PU @W(0 S(PV(`(@U(W ,0X 000 4F{0<0 0D D 001100 %!$1i -LM, 4 0 %{, 0R0 80 < ,080@0 2pW , R < Z%T@PT @08T#X1e1<@0X0@0 pW, R@00 0 @04 S0 0 080 <z8<ݩ @ P?L00X 80$0< ( 0538 r0 H10aR001#,0\040P !0 T@PT 1e 0( S`"X@TS0 0  Y08#X3 b@z9 -LM0XK,0 `@p 帲 hKⴲ 0RH6 0 0  0%P@ v:Tl `xK 㞲0S@ u0S.0Sş@0 6,0 S ,O  <0S hKڸ| 3\50S xKиX )ɸPƸ @00 X0ST0SP0SL0S &[4R t0S d0S`0S\0[Sx0[S S pG@K P R0 1 0 0S 0S 0S 0\0R00Sh0[ xKSpp,P`z K0P@C0S e0 00 S `s0SX xKQ e0@\M  PK T:X0ST0SP0SL0S 0 @ @002Q0@0 x K*Ÿ%\0"Ġ0 Č2 x KKX0ST0SP0SL0S  MH@KFxK@K0 H0KGKP@ 40  00 R TVe sP` 0  q0S ,0 R w0[0S5#$0$'Kp0S yPp0S0P@ 0K :PȀ@  0R0%@ x*L|dg bxb#idz9tz9z9z9z9z9${9G8d{9{9{9{9 |9`iP@9 -LM$PK 0 , 帧0S e0 00@@|3P d00S#X U 0S @00 0 pp    0@00 :0` d`K0HK@僧〧 0U H0Kc KG Kd0K\PK  㲰0S^ R 0(S@@K ` 0KKҾP @@K ⏰(` x0(0     0 Ⴐ Ru Ri  RI 0@#$(,""( :( @@! $ 0^0K K@@tZ ,2`P 0@, 0@H@0 \ 80S0C802 ,0S , P e@ 0 @@ 0P 0ܦ1 0 e @ @ զ 00S S0 0 0 00S41 R P 80S0C804T0 TD  PM=@@@K㚦G5 #$0$<5K4P XP %KT0 P@K\PK1 <1 KK吠 ; >31@3|dggiL|9xb\|9 -L|M0@,0 `0 p<K P0 堯LK 㜯0S㘠 $ 6 RƟ@0 36 ,0S ,N @ߵP 00L 3 0R0%@ t:Tj \PK e 048\[<# #3 P ` M P> \1 V L0[S% pG@K 1P| R010 XP 0ᒵ4 <K_P Z e0 00S 4 R v e0@u Pp HPU 0@T 1SIZ00e RY 0e  ᨥV- 0S R!40040 @`T` ` 0 p P2 `M 40 <0#, 0 `3T#0Z  0SiPJZ\V\00Z00S?Z !0 R00S @Pv@`<+P CEv2 R< V 0 S  4",2 0 Z\  !2!0Z e000e 1S1!0 0e  4P41 R H1 R (0 R 0 R y }[0[0S S5#$0$%K[0[0S0P@ l0K 7P  @  0R0%@ z*<\|dgxb#i|9|9|9 }9:lb bL}9x}9}9}9`iP@9 -LM  PK ,  僤e0 00@@J00P0 d00SX 0S  @00 0d@Kpp0\`K00 :0` 0 HKQNHKdKP cKGKQRS 5,#04%KKT P0 X @ mPK )K 0K 蛻P @K  W(`w0(0P 0O R R  R 0Sx 0Sl  ^R N0@#$(,"̠*"(** :( @@ڹ 40K K0@@/Y ,2`P 0@, 0@@0 \ 80S0C80ڤ1 ,0S , e@ 0 @@ 0P 0ᜣ1 0 e @@ 啣e0 R0000  B 00S Sv0 0 0r 00Sl0 R P 80S0C800P0 h`1 <1 K吐 K; 01x0렀|dggi~9xb~9d0GS S S5SS ʇSS,0 P 0SP$f 0- @ PL0h|0 -LMŸP@Q2  0 n 䁟0S00 0Sl 5Pp8| YP`H pt0p!p0`00Q0`. 0U0 0 p @ppp 0S 1li0l0D 0 ,0 0Ba0H 00 |0? dP`000i04 @P4000,>b$f8bixb:MbP~9l~9~9~9~9 0-0L PR0?P@ W R0 P00  0| T 0S0C 0  00C0{b$fi p-LMPOsU`v P@o fY !0SJ 0R60 S0 S R*0p!00S R0 L10  0| 0S0C 0 !00C0phs.0⧱ 00 < 0 ,0 0Ba|0 R 0 x0ⁱ `P\0000v <89bxb$fi09:Mb`99~999 p-L MP0`@T: S 00 0000? 00  0 | R0 d00  0| x 0S0C 0 0 00C0pphu$9T99Ȁ9$fi -LM00 0 0 @0@ @@ -PLM@ |0 0R h0 R 0P 00h;Q 0Sht000 bxb9,9 -PLM@ R000hZL9 -LpLM0P,0 `@ <KET2 l Rl@2 Rh 0S# (2 RŸ@0 N.1 ,0S ,ჰP‰ @00<0S80S40S00S5 0R0% A:P7 d@KH P%` R 0 l 僡 e0 00 S 0 R <KFe0 J@ <Kl  0@0 R 0P@ h0K S3Pp h 0R0% *(&|dg$b bxb#il9|999`iP@9 -LpM0@,0 `,2PK 呩6 R 0 0S# 6 RƟ@0 -dƟ,0 S `,> үPϯ @00,$0[S 6 R K⽯ 0[0S 0R0%` Y:VO @KPE 1P= 0 4 TPK8( LKLK0T<0K0 43K[T 8 4  <4(<"4%$Q0S !Ei0$?0D@$#3 000  04 8 <4<("4!<0PPP @ P,d0Si A TQ 0S& @Q  0 A e0 00S 3 RF K+e0 D<0K@ @u?90 $(,<4<!4"L T:0Sh  h SP1:PT0@S B2 R  0PI2 R  0= R 0S 2 R0S\ 0SX SR 0 SB K`0 K0KKS0h [0  /h K0h [2 00h0K1\K 0$(,<4X0 00P j Pbbxb`9 -LMP0 ,bP< 8 '\0Szl pR000 TP @|[T 00CS 0bl|Nh  0 TSP@ <0 R X0 0@?ꬅ9xbԅ9 -L,MP @p5l T@ D  1 ; S00D0 P` L0L00L0L0L00L0L0 80< D@H80< D@HL0 P0j W P_ L0 @T 0 R @TY @k80S P1 \00\0`0pX0 P0#P 0Y@ 8K0q  00bS00bc8 xRQ:Q0 D0S 0 <0 ,0 H KH 008+P@ 0 R 0X0 0@80< S L0 < KP<Pt0 R <X0 0LbtL0 ``8<0<<<: xb9`9 -LMT@T  qP HP 1S@T p-LMS@T L0@T2 R @T 0S L0t@T@T 0Sf L04@TtR@T 0@ @T@T 0@00@Tp0S P T @T 0@@Tp0S P00000P PU L0 dP` x1 R iX0 \` P` 01 RP UX0 `00SP  PPP00P0IPP0P 0 P0v 00Snp@T| 0S L0@TfP0 P 00S#PF TKFb$1i0ixb9 -LMP0 , 吠 pP2@T T P0~@T㗨P`X HK D(@K0H0K (@KPD3 00 \  0K 〠 PQP00P0Q80 0C80x1 ,0S l,P1 R⨨ ⤨` ᡨX0@0 `@ `V 0 R `V0 R₨X0 0VXX0\ y"Pu <0 RcX0 |dgb9xb9p9ȇ9 -LM P0, 嬐 00 HK00 @㛘` @KdpKG`KH@K喘ᐘPK (\Kc`Kd@K匘D㆘0K 夀 p =POP00QP0F1@T T P0 @T R 80S L1 ,0S @,h080?X0XP S 0S P` 0 R 0 0X00`1|0 R @KʧX00 \<0 R⸧X0 |dgb9xb 9`99 -LM "X@0`K,0 qAPQ <Td00Kx0  K0K 0K00KߗK1 KPp    000 400 80TK0 <0 00\0K0 [0K幗@0<8 @0@0 4 0 hK@ tPhU K0 ,0S t,h0 RK40H P,0 R $`0 0|dg؈9xb99 -L<8 Q q\ 000|H D000 0@0,0 R 0 Z:xbT9p, 000 0p 0000: -L@PpAh0`S h:h040S ,4 40,*1 -LHM0 PR 0S  PP40{`@KD`4 0P0 0 \ XP T` pPl0 RP X0 Q H 0S P00 ,0$0  ::\1i,fZ1i -L4M4`@0P, `p`PLP 0P ST  0S0s 0S0S 0s HK㥖0 H0KG K HK X _` VA h0 l` VU9 h 30S/P0&@HKLL0 6P#LPp3P@ H,0 LS D,w#@L5@0S  L K`P0@!   0@T;\ P>0S ,2 ( 0@00c ㅴT2P@#r0S TS,0S00S40S80S , P Pz0S 0S$0S(0S X > Ph0s T0@P 0 0a P  0@KU& !0#P@ h 00S)P b%@L0LHK 5P(#LP 0P@ 0L0 P #@L4@0S  L Ki#,`1i|dg1i1i9x1ix$ih1iʚ; -LM0PS`@p 0SP0@S6P4 P 0 R T p # V00R00S@ 0xP0\ ^P rP PI p @XbL*1i(H8 --'LM0` ,0 00 0 P \p 0@K 0P @ U 0 :R ( "P`  @ L @0K  kP8@H ,K 0qPz  1H R 40<00 l  000 !̠` !4! 0r00/ 0 :RT q- 0\*00 V'" R Kx"l5 ,0S X,0K( 'P700  P@ 0 ( 㖪h000 Kp 0 :R4 P@ 0S ,2 B 0@\ 񟗗71717171L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L71L717171 81$81<81T81l818181810S ,2 0@0S 110J0S,2  0@0S,20S,20S,20S,20S,20S,20S,2 0S,2B0S,20S,20S,20S,20S ,20S10 70 0S0 00 OD#P` A|dg91i@i 0-LM)RP@ :R@0hP 0P o S @0h@0h -L,MP@, ppL ^`P ^t:1;1;1=1x<1=1=18=1=1@=1=1=1=1=1=1>1>1=1XW 0 L0 Y k L3 ,0S , dp3pl >2PL PVP@L  cc` rP` MP0  PX 0X PX㸙00 0@S 0|2 R 0S 10 R 0S0s R 0S0S0S  P 0, 0@S1 R 0S /0w LKH0,P P '0eL0Sb @000W90TK1S S80MH@KT0@K G0KHKO  0L >S 0SHKH@KG0[SA0el)-0"~ᔗ 0團|dg9̉9lbpb1i؉9xgG8̉9@-QM@0-\ T  Ѝ8Ѝ@ `1i -LMßPp, @ S3@ `K 0;P ` T 0@S 00 1X K*2 ,0S ,0S/00S 0S 0S$0S(`V 80K0K@K0 [0 P ,KH0P e 3S[ 0 MPpR 0#(`"0Z0 81#81#$102$1 1# ! l@  000 !4! ` !00 0H R 40<᭪0 ㍚ ≚ 0( :8,0h 0,000H P ^70Y mP S0SP10M0S  0S$0S(0S90@ #,0 0 /|dg3i9i -0`1 L !0@10  !0$1 R0S @0S_u0\V*!ld!00P10!R C:p 0 p0\5*!l!00P10!R #0:0p0\*l 00 00 1 0p0 ppmxw1[w*[w$#&# -p`q @ !0>0>010  ^!0L$1]*!nx!00P10!R J 0 0 p0^=*!n!00P10!R +0 00p0!0>0^ P`eV0^*!n!00p`P pp mKx4wZ-wZ&w%#&# -LM`0@ 1 ! 01 0^$!I*(1n  00  P 10!R 4 00!00>0^ PpeW0^*!n!00pP  >0>0  cR !owv@Zv%#&# -LYM   0p0`S0  0S00g\Kc  a?K ἔPP0/SP c0S< 10 S@C/R 0t/S0@ L0 H l D pK0pp RP/0P0\0p 10@gnP?P  ?P0P)`Z\ZpK@@LP H@ l pp D QPP0KP @ 0 帀 匠 QPP0` 0 GKxPP0 0 KwPP!l1R!h1RPY`Y a?K  t@-@\  0S0  0ST 0Aq00 -LM  0 @ $ 40S0ß K0wP  T018#R 1   uP2 0@40 , D0 K@0KP  H 0@ 8  KHKK0KsxPV80pcWn`PP Q0@ T^ 0ApcW `P6Q0 0 SRW*U 0S" @W$0S U0 03  P&U!  00C0 pdW`Wʸ0S ZP 0 sx eğ P ?S@ w  3i 0-LMP4@0 (0 (K0 $0   0$K 0 a@P 0 U00\0 : 0g 0-LM@P@ K0K  0@ 0 -L$M0pSPl V > V) V - @<K@0K< 8 4@ @`P@00Q@K ゐ V <K@0K@ < @ ` @NP<K@0K< 4 0P ,` 8@ @ VY  V <K@0K< h VA e Vtt \D\PhP@P? h0L 0` f0($0`@f0 0`Q0@0  @@ T@ @0 P\T\ D\ <K@0K@ @ <K@0K< @ <K@0K@{@K sPhG1i2i88,b -LM@wP 0 g p-LMP`f PK0 p .@`@ -L M0@S K0q1 0 00q1 0 奏 p-LM0@ P0K(KP0  p0P,0oO` K腞0 p-LM@ `P]! 0!8< !u]p p-LM` P@k]! 08<1c]p p-L M(@ 1P 0 (1 `K0P 0 0S  pŎP1(01 $ !00(3P -L M@` T00D^\P(:T8 p,KW" 1!,0 $ ( 1.$  1$00$0 1$00$0 00$00$0 (00 (0 PP pP00# 0!  R0 p-LMP0@0 .P0,`KS   0S Dp=0S +0[2K᲎P|dg9 p-LMP0@0 d3,`KP  0 S Dp0S +0[2Kሎ|dg9 p-LMP0@0 2,`KP  0 S Dwp0S +0[2K`|dg$9 -L,M@DK< K04 0 DP @` $p <@ 8@ ,@ '1 -L(M` 0@p @K8 K0 , @P <` @ p8@ 4@ (@ 000000000101011<0S8000 00( 00(0H 0 @040L 8 P0<0 -LM` PD0FK0 !  P MpKP@ 0 p@UTЀK0|0S@@ @ ݍ0 -LM` P0FK0 !  P MpKP@ 0 qp@UTЀK0L0S@@ @ 㭍0 -LM`px딀KP@  0 ,00,0,0( 0CPԠK,,0U 00S DP Q @ {Pּ -LM0O K K k -LM0O K K Jk p-LM(O`$K,K4 K, P g400p -LM0 0K 0 mcN -LlM0pS l K`mP`l0 ` $40S` ,00C,0l(0,tPt0KP t H0 8 0` 4` p DP , ppl0HK0@0K hK@T1# |0K h0 TP x [l0|  hK0K@ ``sl0` K`P0X0 cPT *0^0 \:H K6`㷐  tVl  K⺌08 `l0b0\`::0 0-L M0 @P0000 0(0 :(0  (04 0(0 (0(000(0  (0, 0(0  (04K0(0 0O$ Kf0PH8 -LM`p9H P@! P P @T00PU0S WSp@W lL`FpGP  PHB00PW 7pW`F@99D9,90t3i``0t B`3`1`1c11c!0"b2c3c0acP@t3i_ N0S S0S0S  S 0SQQQQQ1Q!Q1Q!R @0S RR  0R P0Qc\R 0R\ 8#8S  0   XH8-0 R 0Q cP 0 S 0-LBP|@ 0S L| 0SPeT 0S \00LS `0000R- R 0S0 \R000Sa@\0S  0SbR0P0QcP  RR-0^0  R R0 R0Q- *0 Q*0  aR*0S b R*0S R0@-P@0 A@P `R00\00Sa@ 0zR @R00Q00S ZR 0 PP ^0b0 [/ Ah$0 hH8 -RLM@ 鴏 -RLM@ 駏 -RLM@ 随 p-L`Pp P 0 RL tǐ X0@00pFmBkF00C0zX L 㱐2b$g9`2i -\0L0TS $0S p00R0S {P3i6i -LpP`P@U U UPEP PE0R0@hpp009 -LMp8 Q@ 4 < ; P,, K00K!P4 , X3 X-4%j6+Fcj 8ؠT@!08 T d8  0@T0X00< X,008 R4@8@0 :#:RJc0n<0 0`06i2i9 -0LMPp`:0P:X@PH BP PE 0R08@8iiw yJ:2i9 -SLM@2~s H00H0( (0 -L0 h04fl1b -LP/lm1tm1|m1m1m1m1m1m1m1m1m1m1m1m1m1m1  $(,04@DH$9 0- <LM00CP@ SN|n1ho1ho1ho1ho1ho1n1n1n1Xn1Xn11? ?0 0 01 K"0 0 ,1  ,x; ,$0 S@o10o1Lo1Xo10 L  K20C0 10 UU3389 -LM\@  t\ u\\Q10` R``?J@`z, 0 V. @ ?  ?l \,0q6S @ Q q0` QJz QsY QPF @04  @TZ00e/C1"/ 0b\ ShP @1L,`8`2i9L9,Q9d9,9|99999Ћ9؋9 -QLM@|xhh` P$@H4,D h99 9,9T9|99̌9 p-LM0~n0`pfrJPP 0f0V@0*` VT( K,0K JTZ:0 P, 0L00 :6i -L9 -L900-@P 6 0 -0LHP -LM`pEPQ 0 0S @QP|%> p02SN H%%>!D @A0AS= R ;%4 0 , %00 #0BWS  z1X|1X|1X|1X|1X|1X|1X|1X|1X|1X|1X|1X|1X|1X|1y1X|1X|1X|1X|1X|1X|1X|1X|1X|1X|1X|1X|1X|1X|1X|10z1X|1Hz1X|1\z1X|1X|1X|1X|1X|1z1X|1X|1X|1z1y1z1z1X|1X|1X|1z1 {1 {1X|1X|1X|1X|1X|1X|1X|14{1H{1l{1x{1{1{1{1{1X|1X|1{1{1{1{1|1|1X|1X|1 |1,|1X|1D|1X|1d|1l|1|1 0ts0A0CS Q X@@0S $% , R|2xl2D PL4 8<40$ 1?3?3  0  0x0!pn x ell%10?30 @U0P%  0?200  024PtH8DO89999P9,99 9 99d.98P:088:O8p:O89O8O8t9@9ď9O8ȏ9h#:̏9H9ԏ9܏98999 0-@PL> `Sl h0 $$ à 0 < 0 $00@99O8 9,9 -pL`@Pu$ T 4 Z DU pP@TXD4(4P89<9D9H9@9P9 -L0 Z\@`%Z' !00St 0t  rW\PD  e/L99Џ99$9 : -O8@LMpOSP!b$ $00S 0 hdX@@  fL9@9Џ99T9@9 : -@$40$&S !PL$pdxl dVH\9d9L9Џ999 :$99t9 )P8 -LMp@`@PL 8P$1( <0D $00H@!000wwww -LMY  `Q00SpP @ZJ $0 0T@TZ S@* $0 0@T T: -LM\  Q@@Tp` PYJ@ ( 08@#8 XPUZ TP*@ (0@8#8 PX U: -LM\  Q@@Tp` PYJA , 0@ \PUZ TP*A ,0@ P\ U: -LM@!R 00 10 lQ n0.<! -LM 0@ 00  |0 Rh 0  !!0 0)0  !!  ` 004 i3i2i p-LM0@S`P: S S00 S S R/ !R0 R R R =R 0 R R R =R=S Q `zP0  R R R 0  R R R0Spp p-LM0OThaT `!0X!00,SH1  !00(!3PP 00B!30P0 !300 30$6!@0`3PP 00B 30\0 `!`t0t @ n@4`P0P @08 0C0pD3i03iP3iH3i<3iX3i@3i\3i83iDfHf@fL3i p-LM⫄0Pdd0K`TTXx T`P H0Ta<0`u00`p !iAi43i b2i !iT3i2il9 -PLM`@P Q pK 0P 0S00S 0P S 0P0S 0-T@LP H0HP @rJL00pA0?00?0b2i2i3i 0-@1L@4 P~8040< 8 H0<0 @ 0 -Ld ~ -LMp(`@(Q@G 1 G1>(P8PPEP 01 ! q 00  00  00  00 $00 ( ,00 0 400 8 <00 D H00 (1 00 !01BK UPp10! 8PH<1X <04Y(10(1`K 0 H3i2i 0-LPMQ@(P> P dK⧀P8\00S 0@!X0T  P L  HD  @<  8$4 ( 0,, 0 (4$ 8 < D H\  d(1(100(1`08<100 -pL,M0`00 T1 0 !@1`4 4R  R  R0R0000#q W0P KL0 P pH00CH0 p 020 ]P0P L20 HPK A І@ i8!P 4 i3i@! 0 209 p-LM@`  P`p$ 0S00`3i \000J -` LMT ^LL @Q Q\ 0 @,3ifg (1 R 00`3iLfd1 -LM0P 0 !H1pAHp!Z5 `000F4 0 Q@1P0AT  0P @T` H 0טV mDMT`  0pØ3ifg4 i`3i9 -`,1LM 080@0K(PUK  PU Kp0(  PP  aPU K0@ @ P_0aP00P0GH 0-tPtL0n@Q011!!P@`` K9PPP3@0@P*0!*@!\ P@1>@0@!0*4 A 40L0C03i8bfg3i2i3i0LMn<`p4 ?P@B 40 R08 &8 P00U* Vؠ 0. K   0Z UJjF:804 0S80 d@X00K@, KP00L00  :2i6iT9>0 >0 >:M0@- 0@^0 0@T 0 P^0@ЍS0@P ! -LM8 \p$0 0 0c@0 < 唒W`D h 0x"Y, K00K y, 0S 00 Rr .: #:L4  0808@0S @4^ P>0. U:00R ^ RG 0 0c4 :#: cQ!P4 4@ 000lQ0S@@ < \ D 0 RD ,040pW0<0 `D@0W@< 00 ^P @,0<@0 S0h (8(#8Q4 "*4*64 00S 4 Kky6i  p-LMP 0   @K `PP@ jP *80 0\ @8:Q0 : @0 \0 0 p@-P@P`p. ^  R00\:\*R:^ >00 0 bS0!>0>00>000 0S0l0l -L@㬀TPp`  (0@T -L@, TPp` ,@ T -L@㬀TPp` 0  @XT -L@, TPp`1 @\ T@-^@>0.  Q:00R^  -LM@`TSp R a :@TVPbUP!W W `e L 0D@WH2iL3i -LM`0VPp R a :VP@bT@!W W `d L 0D@WH2iL3i 0-h@Ld0`P 0h1d!lh!,0R 0l1S0h3i2iDp9 -LMdaPV r @0S  2S @2S2S xptp0J St1t1t1t1 1 1 1 1 1 1 1 1p1  p1p1@p1 Pz1`VAA0S 1 R$ 1 ?#+0AB%@\ Z 11@T !mPtM hI81\ ?# $1H1@Q1@!+B%0@ P,)p1#p1 0X Or" 0|  @`mS885ils9<9@9P9`9p9|99,9H3i@3i03i83iP3iV8\3i9PV89899X3i<3iH99999Й9ܙ999 -L$MCp< #@ 000 0, !@ x3t#Pl3UPQ\@aZpH0< ZN@t T*3 R0S0"0S :S8 D H0&R| 20Sx 6Su 2"0S00D0 D  0 Pp2 RR00 D0`2PH  ZpZ 'ZX H0H0H  D0U@< 0qH  R 0 H80 \0040 < @00 ,0 08, 40.0.08S  0S00,+ 0X 00 H @< 0;0 080  <0@4 00 , H 0R6BS`$dZ080  @< 0@80K0@< 0 P 2i4 i3iW8fg2i:gț999L9 p-LM( \@SP`8 0   ($400S8@< D HxhSdH T Lꈜ98W899L9 9М99 9H9T9h9|9999̝9 -LM \@P`p  0 P`0@1 0-LM@AP^00 H  0rP -d!LM0@00 0.!0 SPA1Hpx@1@5 X/:$`N @0 PP 0 1Pi P   00.08S  0S00T  @0 R  0H 0P4 i3i92i p-LM@0P`XT" T Kw0V0P00S 0[0ppTKw0V0P00S 00pKw0V0P00S 1[0p2i9 88#4S S - xxLM'4P`0S@xt"05P`(0S00V00\00S @Q0 0CS yV00\00S'TA0SPῥ'4 SJꈹ11h11111111111@\. 0 <00 0 :#:cQ! ᢓ`*A  @Q`1h#R& 5P  ሓ`0S000S \`P  Q#  ny0086i96i6i<6i p- 88LM#ĐT0`P @0  &R%&:FFplP 3i@b-@-0  <0@0D h0 TD < L0H000L0H0 04045500556i-<<P0S P0S00 40C4H0 Q L0H00C0CL0H0550C0C556i0@-<P @+ 0Q P00RP D0 0D0 P0 "  4400C4 0Q  L H0 0CH0L 0H L0 0CL0H  %5 0C5%%5 0C5%6i -@ LM0|@  h 2i0S@ Xǟ#&R:0R*0a00  01c@W2 0D0 HQ`  D0 `6W  T  8 5S55SSH0 SL0L0S S L6!XD0`0ó D0` &U  D0`00D080@ 0`D0 00Q00S D 0S D0 10#R0 S 5D8 0`~TU X5 Y @ R4000$ $@ ZW 5Uh 5 Rd 0R0` <S 4 YZ  4$0 ) 2Q D 0S? D0 0S4W+ 5S55SSH0 SL0L0S S 4!ATD0`0ó D0` U  D0`00D0  300S p3 0 P3@q 0Sn ,3Ph ?P8 ]  "U 48  Y0 `"D 0SK `I@0F HQC h2H=H0HSU @2 Y(2 T.  8 5S55SSH0 SL0L0S S 1!aVD0`0ó D0` x!U:  D0`00D080@ 0`D0 00Q00S D 0S D0 10#R0 S 0D81 0@ 0S 0P O0 |eg)*(":1"(Q 001 0R|6ii6i6iW82i2i6if 9(9 -L0@ >#& R7:0R4*0l$0  01c!R <\ 0P \0T\ 0 D00D0   $0 2R @ ` #& R :0R*0l(0  01c!R <\ 0P \0T\ D00D0  i2i -,0L ^  083i2i -!*(L":M1Q"( 001 0R  0d* " !Q:0Q*0b !b0 P 0Xi -LM$0@Qp@20 T ?= ?0S% 8` 00#! @R00  00#!H0S  S 0 0i80Q3i2i6i 0-0LS@P 0SP200T* 00S $0 R 0T 0 R 0S 0S  R00h00 0T   0 0 0P002i6i3igg -LM 0@S000L002i -PLM` 0S 0S0000CS0. V( 10S $0 R V 1 R 0S 0S  R0000 0|   0 0 0L0s,1l6ig2i p-0LM 80 x`pP0\\@ X1 S@R0Tp@6i6ig2i3i p-LM 0<8P8@X0K@ P0@ H`[PP@P@@00nphkx6i6igg2i0 0 L6i\6i -PL0@P$ 60pS*`|\ 0 $>"*01\06S0:0@<,6d6ig6i2i 0-0 L"*("1"(P  \@! 0 SP!0!;   @002i6i2i@- 0 0 0 21 0 0s#0@$ ! 0#:8#*!#800Q! 0 S@ 0200002i@-`Pp !:H$$X 00S | $:1P 001P:#50 000!S$010 0-0@P$L 00 0S0ڀ0 R p<P ` `000@0  0@0$0)$=n|6i6iggT9 -3唓LMp00P 0, 0 p0S P U:YZ @:(s(C<, c 00"R 0"  "0"0"00a3C?6C#Z!|"00#Rea!P"0H2@D"@@2  @@Z(Ÿ( 0  P觺 0 RŸP 0$T D@啺 0@卺 00 @债 0< ePtJT:n?o`P@) E1? P 0 01  @`P 1 000R 8P@ <W 0pĀ Xf6i2iL6ix6i\6ig6ig6i3id6iggggg|9D:f(X1f0^P`0Pl Sc SW 0 4 U,  @4U 3 #6SppW 0&*000 00^>>fVE1U,&: R,IP% 8#8US#&6?N00^ U.Q !hXE&14 0 0!1jZEPᓾH0H 000 <0040 000 000 $0 偾\99l6iH6i6iP6i6i6i90X6i -``LM0pS P0  @P@^00 RX6iP0P0S  \:00Q0SX6i0@-l0@P 0S P  T :00U0S000X6i@-0@ @0L 0  0 000 00 0| |0t t0@l l00?00?X0 6i 6ip6i@6i6ih6i6iD6i6it6i@16i,1P6i6i6i`6iH6il6i6i -0L0Όn`VPp@0?0?0000?%:E%6;PK #;J jV!Z嫽`b\b9 -LMPP̠%/*Ȑ%:8#*!% vWp!R#8 001 0R  :U#E*`L0HS @000ZU@:U:2i6i 0-80L@T (PT 塾 DT0f6i,9 -X2LMP, @ @,8, 00$ 冾080 00 8 ,1 R 0S 0040 < R< 40 6R< 40 80 $Q8 0 X 0@S@T1S ?@4 Tf?p P@0C $D01!R.P I P 2222222222222DP  0PP0!?#=?00c?S @Tjڣh,@Y@ BP@CPmPFP$6i 949H9`9g9h9l9 -LMp`P1SP>U#&R!:0R*0a !bA 0 T L8%5HLн<@T V 0 *$ƽ@T@gi99 -!LM!:1`PV!& 0 01 pRPJ$JT 000P帠00 0+; 00帐 .P p@:#:S `@*:#:"*S:*21@`P0 P ,0 P gg6ig6i -0LM@8pPP% KEPU$: 8 #! R#8 001 R00*"5*7_ `  0@EP8  i6i p-0LMp4 40 1c!P+ Q)ڬ0 \0јP00l1  R0C0p`1AC\0^*PP06 @^:pcctblb@bhb?i00T ^| P$U@`P@ $@K40$ $ 00OZUzj b6iԢ9 p-LM`80l P0N@0d0>0^P Q0,0 "T 0T0P p6ibܢ90-P@P !200-P@P@0R0-P@ 0bR03 B0R0@-P@ 0bàR? B0QQ00QP:  p-QLM`P@S 0 V pp@rP`&p`0-P@P@0R0-P@ 0bR03 B0R0-P@ 0bR3 B1 010 p-QL MP@`S K0 V Ks 0K Kp@rPp` -QLM2p`S)P@WU (W # 3f g0T0e 0d0 "2R0c0 0 Z  p @rP*`ppp@-(Ƞ !8"(,ȠP@p^`b `n0 # 3\ c l0 "2R(#ȃ 0(BR00.8 c0(R0#03 8 " P@p0(R0#03.8@- a0`S@@B@-@0 -LDM@PKP@ 4!dT QP 0P KSR0S0PK0 P@[[TK$P@KK ,PT@,83K#[$8KK[[R3KL K0KKK4pK@KX d0 d@@DTd@ 0S 0d@S@d`@ p0`SL` `` \JX0@\@ZXp3QPX h h P Uh R `0d@Dh \ l l偀 0 RPh H c `c\ 8R \0`FP(*SdP\l 00 L cPe%88cP\X%X@ʷ0Pe%8P d`F\P l@00 L P\P%X@ʷ000l`X\l ` R" h0S d@\ c0 Sh0`@.L0#\ ʌ0#[[[2[P T PK $[[[4[P T P KP@c8#c0Hc8#b0Hc8#b0Hb\ h b  P T P0Kpbp@-^`@ Pb 0 2%$^ 040p0-P@cbP L0Q3:P:  -LM -LMK{0K0-P@P%@ 040 ( 40(S"4Sb40 ( 40(S"4Sb 0b -0LM @R-) C+B? S" {0  "!  x(t&\Xb1mPH8Z1wm; @(b:9 909[@9\9 -pLM0`S" @0  2 Bl0PU *   0;0VU:`2 0SPb|9 -LM`T^@PƄ ?p 0p 0,`e0@@b2i-??!0S0q1!1 R  P 000$0$ P 000d@d -LMQP( $ ( ?x , )0(;S(8* 2,8( f Kb8(ȟ00 0 UXRI)à@ȟ儨ȟ b|x@ 3`d`:\8<L a,Ơ 0 <8H,000 )P@ 9#9S*00 S0)\:00 0C0Y 000b1,0 PUZ0Q I$IT 張`0 C\Lg:0 0C0\7*Xǟ0 C\ W:0(0C *0X0 L0b1\0帆:0 0C06*Xx0 L0b1\0k:0 0C0p6*X\ 0 L0b1\0U:0 0C06*X0 L0b1\0?:0 0C05*X00l10|%xt5thşxp0 C^:P5L*iX00]0$A `P PUE `Zd1CP PUE `Z4$ <D0T@ Ơ^NP@`@0&t@ ƀ@e 0@@@ :@ :@ :@ :@,0 9@DC(P `:@PU @Z, T3 @0@H"0>0>03 ap2"& Ÿ L 0嶵0峵"' !01 x2t"@l嚵\啵_!_1_儵"2 2"2 yEv<0! 0 @=j1,5#u1d  001 @0 pJ0C ^:00C0IW0 0b10 @,ꔣ9@2i43iAi` S  800S Y00 R  048 @00 R 08< 40@Y00 R  048 @00 R  0480@P  0@P@RP0 N -L M,`K@P/R0p0(0K([pZ,K0 +KP pP -L$MP @4KD@` pR``$U-Kz4K 0 3KP `p,@K -L M0pK@` QQ$P_0K*K[0$t$h .K)`K(pK@ P'@Ke 0-$0 (0X , L,0PP 0 0,0"@0h" -0L00 p-LM0@$PK00h00P#0S `@0 `k0S#\p pW8@29 0-P@UL q#000 0h#ꋃ $9 -L`@p%PP/  Z@ 0$0  00#P` W P80<D (0;<80H H0B"@<"$0 0SE  0-@ L0P),0 StB2B2xB2xB2B2B2B2B2B2B2P0Pu0S0C007,P#P0H9 -LM0@0S S T@D 0\\ ㆁP0@DSSa` (gx9 - `L$0p04@S0P0p0CS0ԕ PL(D2(D2dD2D2LE2hE2E2E20(bp: -L`TM04,0 1P! R 3 ,0S , mPP@ 07St3x$0嶀P0 8p,00S2U02 0  P0 @R R R~ U 41P 2  t\ tP P R 0Rs ! 0lK0h"0Q2ԑ<020202020 20 2l0tKS!2020S2Ա 02ıpp t@ Pp( U$2 ! 41 R0S1Ap1 -o `1]0<0 hK y4P4 /StP 00, Q@P>< 0R{P41: 8dPx0SY`RWU@0 -"<P2 U|dg 9bQ   o?P 0g1p5U<h5U"*`5U T5UP,$5U Q Q[ 00 "  d 0@P0 00 2000峎4U x4UJ p4U PI0ES@rJ 0P90S 0" 0#$0$   BR !`F%0 0bJ10000 2 0,$,!$#, \@Z@T IP 0@@@P02 <4(<"4!<002 0#$0$ 0 S0S000x2U p2UY a ]@0D,S| 0\PKP@P#Z0[Y [$ R !EDP@ 0P@3`@K P 0 "P0" 6[#$0$&K6[S   B0U 010SU0U 0U 00U00U 00U 0|dgTb Q@c Q 9c@c c c c c c c c c c c c c pd sd ccedA c@rdAc c cmdqdgdfdhdcmc ccddQQ` -LM`eP[B H0d (08 , 0@0d p] 40" K <  00, 07K? 40<47O჆ P&0 0bP 0 PIZ ((0("4400$ 0 < 0 oc ¹098WEVl29 -L$M@4 ` ,@ pOHPP ,0K ) 0K@@@ pP@,0S@@T,4 ,0 , 0^ @@H0 h N -LMP`p $P HP@ $0K   pPPPPP $\00S 00  00  hH -L$M@`p 0@ GPPb 0KN 0@@@@ p{P@0\@@T =H 0,0K 0+ K  *K)K4K@@@ pYP@0Q@@T, [00 0+0[ 0  * [000 0)0[ 0  40S T 0 @G 0  N -L$M,`KP @p@Y0,K0 (K$pKP @@y@  -L$MP $ 2`L  >GPp8 (K$0K @@@ `P@$ R@@T00$000$ 0S (0S T0 @G 0 V  N -L M0pK@` @$PE.KD$h$t*0K0 -`K,pK+@K)K(K P PP@  -SL M@`< Q8 Fp PP0 0@T@b@b`V!J! @0L\ 0 @P*G0N^J0D@T;P -L M0`KP p@G0KP*K @(K8)K0 -K,pK+K@ @@ N -L M(`KPp ?@K}(K0 pKP @@~ -LM@}̠ 0@ @k -L M0@KP `p?BU0K/[@/K&.K)K4 Π0 -pK*K`(`KB -L Mp0@KP` ??CV0K/['Ġ/K)K8'KP 0 *Kp (pK - ML`0 PpPP@0nT `:PP` -pLPM0k`@   0+ S+:R `0S0cS0 -L 0P<K@ cP@00[2K[2K@@0J<K @ P@00w@[2K< PjPKP 嘐  =@ Pp0 P  @弐@ P@P Đ 弐`P唐@8Ȑ 尐< 4(Ḑ, $Đ ᠒ .RP 夐 $RȐ@@ @婓̐ 0 *@TP @ P pPp夐  0   000 Z@,0 S ,>{|dg0u9 -L4MĀ0pP<@K3K$0 ==RP4K-K|0 @4K`ˠ.PK` @,@K+`KP8 [70[ 0 $0S ${|dg0u9 -pL M`@ XCP0K U0! <R@0K&K(Kl 0)@Kp 'pK`@T  C0<0u -LMp0P@K`/K 0 <<R0K)K0P@0Kˠ @(@KP'PK+P@ [0[4 CRK 0< 0 S  z|dg0u9 -pL$M`@ BP,K U0% b<R,K%K$KP0 p #pKP@  04 S 0@4C0=<0u0S22 222`6pP0S.@- 04"400@p0C S Q@ 0@@ 0 ( 4S 000@ -LMK 0`l8 -2LM@p^  1@$01(00L#1!0S2`<23S2ԡ92ġ  0!0Q000h峙 g\qu0" G 2? Pp2 2* ᛙW W 啙 0\P  m鈙写 pC`0 00 0t  p   0 S @B > 0 S @/ N? 0 S @ 0 0%0 00U;:0000P 0 D0 0$p5800 000v T 0 0 T 8#8 S 0 0 T^ 0 0 [R`|2 p-LM 0, @(`P R#ԥ22<2<22\22<2<220<0( DH (8 a&0?ph 0Bs0 phR8 D+0<08 H R p0 0C(0D8 c0&Ƃ 0g00phq 0-LP!88#L`!{@T 0 ,00h{0D( 4bQD00b -L M @ 6@@22 -L M@ 0@@22 - hh&DLM$ pPl ,0 {0P@00 @2(3U 3U3 U 20 {0T2U Q2U? -2U# 2U T 000 , 0Z0  e=@ 0e/W7G>2<22U 2U 0 e/{@, 0&P0  p1UE 1U 1U0 0 "   QH10S,0' 0@%P0 ~000 0 P0 0U 000k&4400 0  Y0 Y0S0m,0 0S000LD0UM 0H0?zbQpd Q@mdtd@Asd edArdAmqdhdk~gd2Q` p-L,M`P0@0 6@ u@H pX k@K0$ 0S <K \ \ 0S tp |dgT9h9 -L0 ,p00 ,P@ ~00 ,T 0 !!g -LMPp`0 1 1\ 6@2@2п2п2\ \ %1C 0 0c30 00C = 2  1\ \ \ %9 K  a9 p-T0LMP`00@8 ,T00 8\pAi p-0LM@ P0`<0 \00< ,T0000 0<< \phlAi - 0L 0<,Ai - 0L 0<,Ai -00L M@K0~n0`pfCPP 0f0V@0*` mVT( K,0K JTZ:0c P, 0L00 :6iQ0[:0 -L⅍P9 -Lx9 0Q 0Rg@ -0L@Mt@宎l0d@ \@ A!0\@0 0  "!g9Bigg0Bi -1LM ?ops)J`0Y10  "!QU PP  0@PU 00#!?o0cSp 008 401oBiBiggAi Bi -LM@X60DS 00#!40 0$ !!9BiG-0M  "!ḁ帡帑!R  80 QPR Q R  101 R R1<1 R\ ` h0 @0P@ P$ 0 0(0p 9) 0 $0 (0p `@P !R 80 QR \@0@ 0 0!!ЍggAiBiBi -@@LM4 /( 8 0 Ai -LM0,"0S{ 0`  "!r@P0   080 Rn0  "!`00#! 0    090 RR0  "!`00#! 0   000 R60  "!`00#! 0   000 R0  "!`00#!  1 L0 0!!|yvsbBi BiAix -LMP@Pp*  0 0#!0,  R <L50@Ta4 t0 Yp 84P@@|,0 0!!rp(bg g99 -LM4 0@!!H0\!000005y 0!!gM  0Ѝ0 0AiBiBi -LM0@  "!@0!!$ $0 1hBi BiAi 0-L0LP 0P0@  "!@0  "!Bi 0-< L0P@!!@0  "!0BiH- P00 01 0 00! BiBiAi0 S- L( ( 40  C @$9pgD900  -LM0@S00 -LM0@S000 S  P- L 004,0P 兊8gT9 P-0L  04\00S m8gx9,0Q0 Rp0 04g@ p-LM0l00P`ᗋ\!0@0T!;Sy0 U0 @2@2D"4 0@TT0y/ phy-0 4 8  < @ D O H L P R }$08@8B ;$9gD9 -LM04@H 0\T P T@0  -LM04@H 0\X P X@0  -_Q_ѥ=L2M1, ,HRY``V_Y_ѥ=21HR ,_,=D"21R, H 1`T8 ?Y 8 8 pVW0p   08 VQ0 ⊠P `U 4 Pp @0 PU4v00$ ,0f_Y0 080 $9 0-LP @@0@`0@@0 -0 `@TL\0_T00S21 CRp07PP_T2G07 P4g -(1L`P 0R 6 R0 r+ _U21F <_U21 C  _U21%B CA)T@  0br    _U21$IR   0R4g -2LM( _P0@4g21 _P00F 4g21 _P$00I 4g -d 2p_P1@L CϠ0`P  21 _T Ch4g21 _PH00R 4g -1LM@ t0_T r21<O _T21P0 xX$x22222220`P_T21<O y_T21 0 q o@`P`P`4gL9 -LM@4P0a0400P 0Pp0 604\0 04?0\0 040\0 0@4A0\ 0@804\ 0@<04\ 004@ \叆,9(b9 - 0L@ 04,(b -L쀟M004 0\08p0L DL `0pP80SL@1p@cL@` 8p0@ 04,gP P0p40 \(b: p-LMP0`04 0\0<@ @0@<@0@ 04,dP P0@40 \p(b 0-L 1PP@ @@004, @0<004\0(b p-d0LM` 004,@P pPXP(b -LMLQL1 @D@q<@0 N1@iD01@pH0Lp D080=1@<0 0 04,0`04 ?0\0 0@400\ 0@8040\0 <0@ `40\m"\(bigig:92Tb p-P\!7LM!I@1<2a112N!!1c#!!?aL6c@T d00  R00C0  R` R^ d 0S00C0  R^pp004@ ,Pd00  R00C0  R0@ 04,ePCYѭh(b p-L M0PQ`0 )0Q p0S 0 R 0K0 0P@0 TP x @pp,0Q0S0S @b@:p@ 0-LtM4@P8 0 0 00B 00hoIb 2 -P0L@4P`8 Sʴ8S 0 h38pS pk{0 T0  3 0T00 P43iAi -LMT0P`0@F.0PP h颅F>X0p垅PpTX0 p |4! 0P\ 充P0TX XP0) ?P` q\P0TX XPTPH04 0004 d80*0x0 0PbUP#U@U0 PT0,PE\U@U5SP0T,,P0T0,\PT0,TPU0x0h^ -0L`P0 0  ^Of Pq0T @,000SNP0T,,@C 0`S0 P 0T,\0@00P:P  ,P 1 P0LT ,P0T0 \P0,TT0 P: PT \ ^,Pp0S00m1 P1LT ,@ P0T ,P0T0 \p \9 -LM@0S 5 -P0PLT ,P0@T ,P0`T ,00pPT0 \P@T0 \PT0 \|0 0 |0  -`D0@0V|pLPD0@@|@ @0 T736"  @TD00CD02 Tx@P0T ,P0T0 \P T,0   P0T,"5 0 0 0-0LS@P P10S D00h0h0E910S0S 0-P0T@,L,Ps0S  x0S  R Q 0hI0S00#0Q00S 0h -P0L0@`V% pP 2H2@2H2x0V00 ?s 0 1 P/@ ݀0b9b0 -LMh@Te Th $0Sh0TT"))@h0$ $0Sh0 h -LM@ P 0h -0P ,@L0`@$@T@p@| 0-L@00P8$]~P0hw -LM@P 0h -LM0P 0`G@\LOTpP00 P43iAi -LMPh0d8p2/ p P` \hh•p0p2@ l@  jh•l 1\ @0@ P Ph2lp"pb ↙}P~Pp d)hPOCPH < 0"c 9 !999D3 59 0-LPL|P@H8S8S p2 S0h2lpBH-CHH p-LMP@| 0U0`0  UD 00C0ph꤀  = -LMh2@ld ,P1h” 0l0d \,h2ld ,h” 1 l0d \h2ld ,0 h”0l0d \h”ld ,0 th2ld ,h”d0 l0d \h2ld ,h”,0 0ld \' -LMh2@ld ,h0h” 0l0d \D8h2ld ,h”$0 0ld \' -P1AL@`@ \@@`E0 p\0  B0C5AL8  <\0A 0 8/0C(  0B5 8< \0 $*;#30 \0x0 -PLp @`,0. 1 \JUKRLOML0@ P P@@@Dt :@D<t hu@0 \ ,0; \8 , x0 -LAMPD@Xp00`".(1 ) ( 0`0@48@%0PIK L0 X 0 0 00PB0C@0 0`0 0R 0,0  @  0B0  00 00X,P0 p D0D 0SD0@D@ @00@0b 00 # 0c$0, X S|(b,Bi8D9 -`,0L(0(@dϠ>1 0(P\ p 0S n@  D00 $  0/00-.p10,p0p -LM`00p@0".PP0   pi ( PD@U40 0(0K00  ($ 0Bb,BibD0, S0D0D D @00H @0P P 0Q 0Q0Q Q Q@09@0Q@099@099  0bA A A CiA |CiAA @A -@0L8  8!8<|< @g< <0S0<0 Q0 0 0S00Q 0S \ 0S 0!R 1s 0< 80<00<bb -L<MPP0L(0i/0`V 40 hzx"hsxL@00 0\p 0  h`xLp@T0p L@tTp\T0 0LP\b@,:\:83,9tCi0AxCid::lCi@: -$"LM0Sh0PUd pp`j|z` z@`l ` ` @` ` k k t yugqQ6 D0L0D0P ,L0@P ,L0PP ,p`LP0P \L@P 0\LP 0\L@P0 \D0L0D0P ,L0@P ,L0PP ,p`b 0- L0S0PU0L0P ,@@ @  @ @ IL0HIPPT G,@@@ @LL@KK J J @H0b -LML00 K $ PP@0  "!0 L0 ,L0 @ ,L0  ,L0  ,L0  ,L0  ,L0  ,L0  ,L0  ,L0  ,L0  ,|+ 0t+;Sv hhLP 0\L@0T P\W$,[$"$P LsL0 ,L0  ,L0  ,L0 C/,L0 0 ,L0 4 ,L0 8 ,L0 .,L0 < ,L0 @ ,L0 D ,L0 O/,L0 T ,L0 \ ,L0 d ,L0| l ,L0x X ,L0t ` ,L0p h ,L0l p ,L0h  ,L0d  ,L0`  ,L0\ ,,l8X p0 T0 P 0L0 pL0,L0H ( ,L0D , ,L0@ 0 ,L0< 4 ,L08 8 ,L04 < ,L0'0  ,D0Lx7,  57\L0P4 ,L@0P64 \LP0 0\6L@ 6+R00P \LP 6\L@P$ 8\LP( h6\L@P, 6\LP ,6\L@P$ 8\LP( 9\L@P, 6\L( 5P\0E\L 5\LP 5\L h5\LPC/P5\LP 85\&"L 0P\ LH 0\LPL 0\LP 0\LP0 \L0 \LP0 \L00 \LP04 \L08 \LP0< \L0@ \LP0D \L0T \LP0\ \L|0d \LPt0X \Lp0` \LPl0h \L d00 \LP `00 \L \00 \LPd 00$ \L` 00( \LP\ 00, \L0C/\LP0.\L0O/\LPx0l \Lh0p \ LPX00F/\X L`00I/\LH0 \L@D0( \L@0, \L@<00 \L804 \L@408 \L00< \L@ ,0 \P0 T00@ L00P00 0@43iAilCixCi Bi@!D! `7:tCi b :L0 \L@0 \L0 \L@0 \L0 \L@0 \L0 \L@0 \L0 \L@0@ \L0 \P LPX!dE!p1'! !;!d0S P L 0P\0 0 !qQL0$ LP 0\uL0H" ,\2P~  l"!pwxis 0- @LP,0@0 \ ,0; \ 0h 0-.@LP9\0.\w r ,0= \0hc -LP`ႀ p.9\.0\L.`0\0b/\.,00.\.,00.\.,00.\Bf/,0@@D t f/@0\WpG.9\.0\.`0\@0f/\.,00.\.,00.\.,00.\@f/,0@Dt f/00f/\b/,.,00.\' -LP`₀ p.9\.0\.`0\0b/\.,00.\.,00.\.,00.\DBf/,0@@D&t Bf/@0\f/@0\WpG.9\.0\.`0\f/,@0f/\.,00.\.,00.\ 0b/\.,00.\@f/,0@@Dt f/,@@0f/\.,00.\' p-LM@P`0 K@!p p-LM@P`0 @pA-`@0 S pP  0R 18S8Pp  0T0 T  R1 0 TR4bb -42LM @`PP~ 0  "![Uh UQ U: U" 'U 0!!q0S'S  !PAP L y^0Pq0SڂSL8AP Ln( cH0p0SS@P LY N30p0S S @ >#PL =0P@0[SLSPL .P,0 $pzbpCi b b: 0 pCi R[040R0(0R>ӂ?00 L:b -LM,@0D 0  $ -LM?@00,D 0 T -0L嘉P 0-DL@P.p0000 4 0h1 0`1l!0h3,94>3 0-XAPPPTL 0S@T0$0S UTU -L MP00 4X1,n0040 U? VR 1 R?XaV' @Vp 0 P$0(0T0X0@TXAT 8`,KΠK 0$@ K(` S$@PpTWd *P 0  `0```0 Xa f\nbRdA3A3D: p-LMXA`TP 0S@Tp$0S T0S $0 $00{oX: -LMXAT 0S@T$0S pT 0- 0L@t P0T 00P -LM0Q p8P9 @1@S  xaT0!l@d9o!T01STJF04aS ,0S T<#oQ 0S oQooT%o0 oW 1@S  0!p0T@`n1T 01ST (nPnDnn69P99:9::p9 :(:8:9X!R0S`0(0S0S -`0L(sm: -LM(0@S d10Sd1 `0_Y `Xp\ `0 D 0`R:@P0Qw\,P400 P] 0D40H0 P0P `H(0X P?@ 0S 0 T0S  (0     0X1S 0S`00`0L  M  N O P0  C 040  d10CSd1  040 000, H0n\, 0@PD0H} 040 ,\l: 0-(0LS@: `0- 0 `0# 0`0XPP `0 0D  bQ:@00\P4H00 ,400 d10CSd1 0 040 0Pzl: p-L M @0@P4@P p 0X1S3 0S0 0 -  0PP0C P0L L QL5 1SP0  8M  4N 0O ,P0  C& p -L M `XPQpK 0SH  T0S Q\ \0^࠱ RQ3 V+Y `400$ @TXp\`400  ` B 0`AT   -TXp\`'40 0 @K3 -L M pX!RD 0SA `@V T0S T\ \0X@`VT \0S P`400$ @040 P `X`T`i`400$e p 0T@X@`A400$K3 - 0L40 ( 0-XAPTL T0S 0@T08 XTU00P00 SP' 2 -LpM`K@p p08GF/V_ 8 PX( $ p$ 000[3 -LM 4`0p " @ KP @KL K~?K";P< @0D "H0 0 P0 P " L0P R0X0 TH0D$PL0X L PE PK "D$X0NT S񟗶O3PQ3PQ3PQ3PQ3PQ3PQ3PQ3PQ3PQ3Q3N3N3PQ3@S3T\L 0PK 0D^PP$PK 0@D$PK 0 D@ D$PK 0 D H$LT T\&L#11@QPK 0D$1T0\$ T B  R{K(B (L0H0P0D$ 2P.K(PK 00D$(L0H0P0@D$("L0P00H0 D@ D$L0(P00H H0D H$L A("$ P  (" XK2PLTQ  @KT\APK 0D$PK 0@D$@D0S; 0hP$ 0@$@DF?@ 0hP$ 0@$@;D@ S 0Sh P @Th 0 1h .  l0 00Sl@T 0s0@l0Td )Pl h0 0 @@$!l0h 0$1l@ 0$0S 0$d?PQp〠@@ 0UT \ PV d\ 0X0l TXl0PdZ 000$ 00 `p4 80 < @  R, :0Q4 R 0Sn 000$0 00000@0p 00 00 80S! 0SJ 000$0=0@00@0p00 0<00 23j<Q  0S% QB < @R 000$00S80phG/000 `02 H0 0!L0 D hG/00080Q, D <0d h0 DQD<: h QP  D0S DQ  00$*00@$*00 @ D$*00H $D P0p<0ShG/000H RH @ : @0RT0 4 HQ H R  00$*00@$*00 @ D$*00H $H0TpL0SL0D0: dSX L R L0Sn  00$*00@$*00 @ D$*00H $LX p,80h Qd0 0, h d0 +@Q 0S 000$0 <0<00p;00;00T0 000$p 00$ 00@$*00@D $D  00$ 00@$@D 00$w 00$ 00@$*00@D $D  00$ 00@$@D 00$ 00$ 00@$*00@D $D  00$ 00@$@Do 00$db(: 8  00$ 00@$@DD<@ 0p00$ 000@$@DDpD@@@ 8  00$ 000@$@D0Dp<@D0@0 00$ 000@$@DpCz 000$00S 0pQ, A 0` \ \0 S S,p `QR @Q 0 , ,  , R# 000$p 0` R 00$*00@$*00 @ D$ 00P0  H$ 0L@p 00$ 000@$@D 0p@ 000$,⁡ 0p}\ 0R,0x 00$*00@$*00 @ D$ 00P0  H$,0Lს 0@pD 00$ 000@$, @₡D 0p@' 000$0Sp0pS0pSp$ 000$pP@54@T,00 S,0 : 000$p 0$00000@0p00 00000000T@\ gd@@a -V/L Mr` , 0 4 >d2 Q  Xp@2 0S0"Qv St , R2 RVXZ PU X@ PT@  T0X140 0, 00 R( d H P d @00@\ : PP \  X 0X P0 04 0 40  0 \  PP \ 0X00X P b,P@@Q UPbU@tbb@P1sw@Pt {PpDPm {PixcRbl:P9p:,9 -쐟LM`ࠟ @pF? R 0R$ Q PU P 1S`VV$p$@{P0 {P0 RT  0 R 0Rl8 -LM `#0PU 0S; S XPUb030 0 S04 40@40PU Ö†Æ ?00 P(1P l?φ40 40Pφ 40P@ aPVU&11@F? R 0R Q pW P 1SpW Q0 K:P WU Y 0R P 0R 0R 0 P@2"32#"t32x#"30#3– 0T2 $PP> 30CS D2D"3#<2<"t3x#424"3#0 "0S MP0 3 4003 4000#4 040 )a2 $pPT1T!3#L1L!t3#@aPVU$$@Mn0KifzPZ0 `zPT0 RpNN0 R= 0R:```4 `4 0| S `: :l8 < l t X  | " :"̟""ء" :< :X :t : : : 0-3Ls@  Q PP 0# 040 3 400# 00 4 p-LMP@T`8  T@ p5@E 3SwgC 0" -QL,M@P`p?38K 400 P03 <0K40@ K0  0P@80<  4$@T3@ p400 # 040 !`` : : -@LPp`3 $@T`V@3 $@Tڤ3 $PP003 -L0M34pK P00 4\ 0`28K 40@0LM>0@lP0 l @0ŒQΌÌ QÌ  0P  0 0Z: -0L* -LM@P`p 0 ` p 0 @ @0 -0L MЍ p-LMP $0$00. $0$0  $0  $0|x`@$ @0S}Tp$0$  N' -LM@$0 $0 -L -L$MX1PT!@  HE[00 0P@ 6[0S00 \0pS1J1 Q`0@4p0@@0à, < 0<K8 4@ 0 b>8  X0 L0H08pW`F(PEZ鈝98::<:<3cD3303 -LM$0@ E/ -LM$0P@Plpl`@ \0 Dn0S0  R  hZO,B9L93: 0-PL0S!@  0P-0 !?C1 H-$00 0R0#S 0S @ @.`::: -LM$0@P 0h#0h 0-0L P@0,00 \0hHY: -LM0 @Q@ 0( Q0 ,00 \0000 P43iAi -L MP@ h@0< 0P 0P`t@\\1 PHf tp!0pPLV <( 0@\hY p\mno0@KJ0 , @ 0$ (P =PD H7YLPHP@Q 

( @\400 D0H P0<0P0@@0 \_<0@( ,<0@?( x`\@Xp0d   +X0 S@DRX0S0X0< <0 < 0H0D0::: 0-<0@LP , 0<0@( ,<@0@0( \<@ 0\<0@ ,   0 *$: 0-U< 0 04p\0@4 0\5040 \004 , 004 , 004 ,@OBMlc: -h1LM \1+R pW`Vp`@P2, 0 4 08  MK5V L@ B E> AG =@TPZ@51 04 8,o-43iAi 0-LM@seZ 0s0 Z0 X0\ 0 P`0hd P s(.0S j8H0H H D00.8 :3:3P338333؋g<:3<3g -L -L -sLPB -2aLMqP@4`KT01@T4 @1R@ T$ @1R @TZ@TT1@T0(@VUUU -P0 0S  0S 0S01c 0-0L 0S 0 S 0SQ0@A0@ c cE PD00l/"b0cQ0 0`cQ -LM@tXh -LM0@S eRRP0 00S 00 Rژ0: -LMP 㱾Z0PS @@^p`V@@ Th W^ PpUZ 0V 0pS0`圀0V o鄾VP0Ӡ09P000W0X0A&P 0S W rm0ŻV QW 000h0Ba'QJUPpW@:p@@p圀꜀8::gfff p-LM@P0`S 0S 00 PpN00 -@Lp`P@PUPV0P0  0-@PLhP~'000!0h -Lpa0`@S@P`PP0S d@ VT_@D0Sd T` -H0LM @10`/P h$b - LM0S0 @T0YS\hL0T,@ 8 #8~4P6 LT\b@B 0-LMP @0& ~@0@0 P 4Jh0 5K$ 0-X0038,9c8y4 0-LM@PP0U& 0StL0  H\0\  @˾H 0P0T 0 I ,3 :`3 -LM@0&L0S0P0t 0L0 -0LMS@  S00P0w&HQ 0hHGHE0P0P>0 -L@Pp`P PTU=@ p-LM`\PYP P@0dS:ph0dS: p-LM`G6@ TPPU $   00 00 @ Td 0 0PPPp:A-,rM@`TR"00c@L0l01@Ѝ؁A0~0Ll1p@ A0c!10bS c 1 !\0 !R 0\ , 2q@?C0c ` 1 p0?00B0c !00aS c 1 !\0 !R 0\ \ q?C@0c ` !00?00cCiLgVUUU 0-LP㣻@0h霻 -LMPPP 㒻p 㳿P@@TV,K T`@ V!P10SV ``VT0\ `S, ( X, (0@@', (0T``0\ d0Sh,0| l0llp(0 t0l@l,@ ( H忿`00X0aBa#<0@H嬿 00 0a#Ci:MbcQp1@-QF X1Q00 <1Q R 0SQ @T`VpWPRS Q TVW0SS0SSh 0l0 p 0t0 x 0|0 0d0h00l  p00t x00|  00d  %W A W@$W R R | 0\q 0 Q  -LdM40 | 5| , )a 0YN40%0 03@  P-XK  P0S S PP0'\00DeG ,3,0S0\1\!|WG3  7072  7@077@w 2a.@y>H_ 00%0P6G2 @x@KL2 3 ,L" 0/x0Kl KP @|G8200|0L0j30 `1" 0- P { "1 ,0S ,'|F |10x0K ?r Kl0 KP |Fx@K $!0U x0K?r Kl0 KP |,F$!$0`!yΊ _0@@%0FP0`@#Hh Pf 8`p@y> 0P0%`|pF|dg:4:<:DP:<l:c:D3p3:9:::fdb<:\: -@L{`,P P80, ;8040 47 '*::WEV -pL@P`$((0"4 40\0$L0@ D0  0S0003 - HH$tL M' `0 Dx) PP, ǐ0{ 2Vu 22V* 1V  0, v),, e@ ,0e/_O|1V 0e/ H1V6 :<10S  0pZ0P, 707 , -P, % 0S0000V 707B00  $44000 |8, 00 "   0,0 0S007cmdedAsd rdAhdk~gd3 - 88@L#D M$`(P, " , 0*0  0 ,00ŽI(`唠PPd@ pFQX,*0% ,(uPP@PP@ c -LEM0C0S\, p01  8 8#D0$0(P` %P 0 S 4 (@P $0ᏇpX4! 0 0O]K  @P0 8QU <^  2 ,0S ,g"4 0@@0 p\\1!0 5 YEYV_VO'00000@0`004!0( S 0!011!eP< P 1S 333 3h3B B@@4!0( S 1 ! b0 S 0!.pY0 h000LK,0Dc/K/K<{KKTALHD}{ c|dgc:cc:0:,9L:h:t::: -L`PP@ P x@P0pW YU ,( 6Ht[@00;00000Evv%00:: p-L$M%@0PSp8`K 7 @0 U00K10K002K8 KT0,0 f P <lA2[2[  cA_A0u:,:T: p-LMP@8`4 P+ 00 00000 0 (0 S0$0@00 @ ,00( 40 ,0, ,00 40 0pp@344 0- 0P @LK 0hx' -L,M`12l140,0 p ^<` 6^y6 00r@ 5 P   ,  0,00,0  oM 003@|xş@@,rP000 o0@ ,@0S000 20<0 0<0 0@ 0S 0 00(8 0 0` %4% 4!@4 0 0@h 8@ 0O 0$0Y 0 5`%`@$ 0D<0HP0 400  @ 3 P0* 080Ƞ,Ƞ0  D L,0 0,00f ㊹,0   0  #,0 0,08 4@00 P_ 0 ``8@ Q ! 0(P\`5$0Sڰ0K 0 9`)` @ P2 P+0.8@400 0S\0#1 00 $ 0 1  P ,P 0$ , 003@ 08 0Ƞ,Ƞ0 : 0 ``0S0 0 4`$`0 0` `` P,@0040 0P@0 0 @@T0(8 Tʚ0S@ 0$00S  0 t?->4'|::::4: -LMp12l14` ^P 0@~RH20 Ph 00 ` 0@@B 0T R P000@00 T2 0 .?000@T$  `0@ $000$ bQڰ0 000bxT 0  000 >00$ DdU @ 0p@>0@000.C  0 >~=':T:x:::: p-LM `@PK\0 000 0 4 p0phZ p-LM@`K PB0(0000  ph 0A -LM02ct$Y1 pP4` 0 S 444|444<444@444!=0,00,0@ 0PCt00 k00!L00 0@ 0S 000@  @q @0 000C000,   0S\0#10 U0 00S  0  D 0" 0 00 0 @=00  p=0000 0M3D=3 0004 dY 0  0@=@000 @+z@ 0hPA00 00! 0} 00   0000@d@ 0:P@00 00!T d@ 0&P@00 00!] d@ 0 P\@00 00!Y d':4:4<:L:\:h::::0:-0800#R000  0003 4  34 S0<04 0@00000 -LMđ0勯Kp _K,0 @  0S @ ?(K ?Kd1 @2 Xa0( K\0< 8R P(K0m ,0 S ,  09 S 0#" 'P0!" P0"" P3XX SS  ?K^  ?( K @" |dg :NEFX' -L M<`Kp@ P0<0K0 60K@?4 K7@KSK00 5 KP3[= -LM 00 0 @R 0S (0 0 0S -LMp\W`pP @WĠeT 0@T8<VP z<,cLc99P9p: 0-LMP@T U0K d)0@S0T0T L$<)'*000,0a0lc:04`0 0lpp@4(00  0- PRL R1<@T  0RT0  MT0p0Sl0 0 0-0LS@P0Pxx 00 S P <0 T  \0 0hh 02bh4b԰: - QLM`P6q0<@T/ 0R 0 0p0S0p00pP`u Tv9Wr @ 0@@@ @P<1 x1P^9HP XV9<0l@p0DP9\0S> 0X00 $14 8 @Z(: T!t0@12c10 0!/B!0  00 Q 00 0> j  0(P@T:<47(:Ci0:CiP:,9c:c64:$74\:d: -LMd@P``p"00  0 0  0Ci9;gcCi - (Lp(P"!$RO01SK RJ RF1<`VB @T p!20#p0 0lP" 0p0h 0P W 0 !,0 !, 00 0'PpZ\0 T 0K<0 _cx)4+4԰:+ -,1 L R gp@ 1Rp H0Hp0V d^P` 0PP ^0  0Pp0W 0  0P,0c: -LM@㿧p0  0p00$ (0  -PLM 0 0 PW P-L`@ 0PU R@B $ph02T@D԰: p-LMpP!/ PU,  \ h 0 \2pd0,R 0 K P@@ ,`0h "0 T@Dp԰: -LM2"0!Q2@< 0 -LM2@p( R U)1<`V W 2s 20 2ih42 02p  lPp`i,3p3 2:::: -LM2@Pp5 q+ Q41<`V! U 2022 S04 0 R0|0@ #PP  hD3P0U2pP 3\2Ci.4@:l:: q-LP@p QW1< RQ 㖦p R l0U Ruቦ2;02R倦p`V. l02 u 1< )  u 1<  hmu 1< Z  0 2G -p0LS Q R h0 $  Q 1<0 S 00  p0 Sl  -qLMP` Qq<@T p0T 0 0 00<0`T 0`0 0p0S8 0p P00R00S`:Q0 0p0S0S 0-4PL0@S\00P00Ci -dLM \L@0KK <P <P  CiCiCi 0-d0L \0R@P 00$\ 800S04 CiCiCi0 cCi0  cCi44 -H0LMQ <\ 0 40@Ci -LMp\ Q  0Q  A b00@T04 -LM0@ 00 R 0tS0S00 0-00L 0@S0 4 PR0t0R0000h00 0-LM@P$KT P  0@S RP 0@S pP Q   "0 0@S0 0C0pP XW\0 b \ v \$ -QLM@ Q ?#?00cS84848484h;aQ R h<R h Q0-LP@7 " Q 000 R02<0\2R 0 ,?000 $(0Q02_P 0("P00R00S02 02"0: -LM0P@p B` L0DS`S``0 CRR0a!Z ,0 oj ,00,0 o -LM 0@4`0pP 0K  00S0S 02c1P'd*08 00s002XgbY4b:X:`: p-LM0@SP`=0S+ U#  lP`\P l0 QPUQ`pphCl0\0PZU\P  UQ 0P`000] -XPLU @ ?#<0 p` @cT0p  }@h=0S 0 S08m^00m(: p-LM\0PS`px@V0@@T tp0x@ 0-\ @RLP0Stp00 0SX0S7  - (L(" P`&0AT" P0S `0SXpW4P;`P`XpA> c0X0 -T0LM (("!X@ T  00Xc -0@LM0X@ -t0LM Ƞ Ƞ,A04S 0000 0CS0 ( c@-$ @.MЍ@c 0-LMP@@ 0@0CS00 -LM\. 0\ 02pXP 81` Q 80P d0\ \0\XP 81 PXQ 00S00}f|f~fvt -4L M^P@`p 4^ 44^ 3^ ?3^: 3^ 3^00 tpp 0 tp p3^ x3^p 00 P3^H  00  2^w G2^B )2^0S!1p ` pP`  c l }H2^dP`0 00  000 1^# 1^y0       0 0 p1^d0 S0 ! a&P`,0      00 000tpA@< S l0 K  $@ P`l@ 10< S< 0S   $L0^ :L00SW WW WW @W@WW@ W @0cW@ c W WW W-00 Ƞ Ƞ,1X0ScD0P  0(1S \0SPc -40LM@ T0 \ 0Xg p-LM|0@SPQ \`V0U\0P\P \`pU 0 (&pp\`Vp::PP 0P 0!R `0SX0S  c -0LMP' 00S P @`Pp0 KS0C$ K00 0,A(oR0: S,>   P`0R P 0$ $ G00TgXgTc\gPg -@0L R 000 0S 0S 0TgXg\g -4L,\ \ Tg\g 0- 0P @@ @  @ @RL x0T tp  0x@0R  Q 00# 0Q 0 000 -L M; S, # Rr Re R n T PPM P `@0`0VA` Ƞ ;,HnP; S) 0 @0D T  8:S00S@ 2T@ 30D8S0D8#H8T@ 008#HA0A12,R0V0 R00T2T; 00 2R 2R R;00A Rx!t Ha[0080 0-0 0(0 0#0 00 00 @00 00 < 0 <T 0 ; sT 0S 0 R R0V&0V#0 9,pK T 0S 0<0 0 ✀o  -p!LM04 S\q1Tq080 0K  8P`@`V@DPEAJ3[ S"[00b0cS  0KX8@ @08@ 040`၀?000 R # 3 R?H0`?À 4@ 0R # 3` cXc 4S @08#<@8oS: S>; S P 0 R0,R간8 -LM@Q q4r4$r4Dr4lr4<0000000000000000000000 -<00000@ L `+ p\&0S \\ 0PP*; Sh!,\1R 0P: R: S:#:A >; S= ^; x   Sp , d0R P0 R:U  hK P0S :! : p-LM0`PP@ SaP 0\  00  00  0 \p -L,M@  `^Q 0S `^ \ ^PK aQLXPpPKa @0T*<@8oS: S >; S|p2Q} @ T:XZ WePKa @p0T[* ; S1QO: Sʠ,ʠ >; S<@8oS: S <= S= 1P: 1P7 |1P4 TP*00@ ;   S 1Q P0 R:U 1 c0 @0Tp:XZ N 10 p@: S:#: >; S Pw: SZ%Zr >; SPPm0S*  : :0Q 0`c Q- LW!T: 0-0@l0P0 p00 LPU 0S9!0h6! cd:(:,9Q p-LM`0PSKX@T 0S1P!00 S P0 ޏp0`0CS0000 R0040S0S|| 02c1PL 08 00?b4b:x:: -L$M ,0 0 0, 40 0(0 @0#4 p0#0# 080 咊XZ 8@ |0t@0|08 @0,008  D 00008  H 04x00P@  0R"<0 ` 0S P?#<0<0cS 00L LU` ` P㌀T 0,S P?#<0< 0cS 00,00U`, `PD0S 00S P?#<0< 0cSt 00000U`0 `PHPf 04 S P?#<0<0cSX 004  pU`40 `P0t@ 4 P?#<0< 0cS> e9@ 0000)L OU`P ` 4L80 P?#<0<0cS @08 UP\xP30S0S 08 o00 ?PE0S P?#<0<0cS 00  H U`HP ` 0Sy P?#<0< 0cS 00  D0U`DP `0c0SD P?#<0< 0cS 00  U`P `@/|0S P?#<0<0cS 00|  L L@ U` P `| - (L(" P` 0AT P0S XpW4Pm`+P`Xpsd c -\0LM (("QX@ T 0pl X0Rd c -0! LXl p -p0LM Ƞ Ƞ,A0S 0X00:0 0CS0^ d c@-$ @.MЍ@d c 0-LMP@@ 0@0CS009 -LMPI(1Q: 1Q?1Q< 1Q0 0Q 0pl00pXP 81` Q 80P 0Q p0QXP 81 PXQ 00S00 |f}fvt~f-00 Ƞ Ƞ,1X0Sd cX R> -LMp @l0X@PP 0P 0!R `0SX0S  d c -LMp0PP쀟0AT P@ 0 A$ᔀ `P@ V !0 S0SV @  c c$8:: ( (-"L@pPP@0 T0 `04@S X`V0p 0 -L p-LMp@p`TPX 00d@Tp 0-D0 (("ALXPU 0X00 c -LM@X@ p-LMp@pPT `00X`d@Tp-00 Ƞ Ƞ,1X0S c@-$ @.MЍ@ c -L M`0V,0 :3V3V x3V Ll3V@ ;`3V% X0S\0S p@ppTP ,000 0 d@PPTU 2V 0x0 X@T 81` Q 80P x2VX@T 00S00,2Vf 2V0S SoSoo1V 1Vp@pT ^ 00  00d@TX@T. ֏P 0 P?#<00cS`  UPP00S 0S᷏08 00ꪏp@pT 00 R d@Ty 0RZX@Tn 81 P#QaWbW`Wvt}f|fW~fcW-00 Ƞ Ƞ,1X0S c -LM@P `0SX0S T0 S `0Sh$ p-LM@ `|PU0p4  p`a0 `00x pl9 c -PLM`@@ pPdP`0ph0p R0pd@\Q 000SXQW d 0R`0h0h00h0hd Pp d 00pPppWx0S px 00 W 0-`PL\0@S 000Sd pRh0h00h0h0d Sd 0p `00X0S 00 -LMp@p`Tp 0P \ 0d@TWPpQ \0 S\0 S -p@QppPP TL\` 000S U\P `d@TV  P0-L@ 0SH00pW 0(0\Q( 00$ T00cS`0BQ$0 0S 0( 0CR0d0(0d0x000(  x Pp$( 0h0i00l0d00%AQX4\4\4\4\4\4\4\4\4\4\4h4\4\4\4\4\4\4\4\4\4\4\4|4\44\4\44480 1p 0 0 0 0 5Q0 18p  %A0-L@P5Q6Ԡ4ؠ4ؠ4ؠ4ؠ4ؠ4ؠ4ؠ4ؠ4ؠ4ؠ4ؠ4ؠ4ؠ4ؠ4444 4ؠ4ؠ4ؠ4ؠ4ؠ44ؠ4ؠ4ؠ44ؠ44ؠ44ؠ4ؠ4 4ؠ4ؠ4(4ؠ4ؠ4ؠ4ؠ4ؠ40484ؠ4ؠ4ؠ4ؠ4ؠ4ؠ4@4H4P8P0 0 1p    -LM6Q@ 080w080S R0 080 -LM\Q@ 0 80:00Q 9Q;Q000 00 S0 0Ô0$Q  80 S!01000C0pQqQtQ 0800SS0 0  -LM3APQ* 4 4$4 44L4`0S! d0S `V * QA0# 0 `0V 0:0S0C0 0`$ 0 0d080D $ 0f  P$@ P `0S d0S 0`S J0QA / 0`V0 0Z `V*p QA0 0 `0Vp 0:$ ` 0( 300CRd(0D$@P $@ P 0pW* ` V* P@E0 0`0V 0:0pW:0$0@@P u !0A0-@LS044ئ44ئ44ئ4ئ4ئ4ئ4ئ4ئ4ئ4ئ4ئ44444444444ئ4Ȧ4ئ4ئ4440 S!01000C080000P0 S0 0Ô0őP P0 -LM \@`  \v V p0S[ SPPUA   0S58 0Z0R0S(  P`VP 0  P000 <0@ d(01$ P 00I$11 000P$00e$0 0 0 P 8 0Z0R0S T 0$ 0bS 0Pp `B<0@~ d(01$ Ps  cp@-R@P`( \ <0  \ \ 0 S d 1^ ## 0LSX0`0CV*@TPp^N \\Q d 032 C^*0S^*0S 0d 32^C" -X0`V`!pfWL@0S0C0= 00 00S0CP0( 0`0\ 0 WT ܶ`T ٶ`\ $0 R 0( 0CR0d0(0d0TD0 PPT 0PP  -X0`V`!pfWL@0S0C0; 00 00S0CP0' 0`0\ 0 WT `T ၶ`\ $0 R 0( 0CR0d0(0d0TD0 PPT 0PP  p-QLMPr WQ @T p` R $0 R 0( 0CR0d0(p0d00S0C@0% 0$ 0a`C V 0S0C0 T` 0Q$0 0  D0 @d( 0D3 dQp1p!Pe\0S0C0 00 00S 0C0 00 0d( $D<@,PΠ$.>@ P$T 0 0aR` 0CS00P$0 0S 0( 0CR0d0(0d0 $T0R 0cS0!`cP$0HQ DQ0(S< 0Q01 c< JQ KQvq]<( 0XST 0Q   B$ ` R $0 R (0 BS d (0d S0<"R ! B0<0( E0 d00 S0R !(0 dS2 a0 BRTpXP0$S 0 l gR@1@!aL^XT ZXPTpfQ SXQ; 0PQ  0d@(R34 nQP1P! b\0S0C0 00 00Sd $D2,e<Ġ$$4@ PcQ0S4 0 d(PS02.eR@1@!Q0AD$>.@hQ! iQ lQ0 @ZP, 10@TP\P 0S(0 S 0 @ZP! 0@TP5Q 5Q erQL DnQ}00CSx,4<4444444444444444444444D <0($ T0$  c@PK0%p@@ T@#4 o4 k44 dyQ8 4Q5630S 0Q01R CQ@l@lT$<0X@0 0$0(TH4Q9 <4Q 44Q0SS 4 \0PS!  U*0@pKS@#@ ßU3 0@fp  R #4 P T\05:4| 7 `d3Qa X3Q L3Q D3QZ44 4($3Q 3Q0 @ZP! eP@P0T2Q 2Q7 S.0 @ZP, IP@P0THPZLPp @> 0/S5h4444444444444444444444 44(40448444@4@4@4@4@4@4@4@444T4T4T4T4T4T4T4T40@TPp @TDK 0H@K@JP?D0H Pp@0D HPL70, DL P0@H0.PPPPPPPP0 PB0 P(pB|dg<:T:}$p"`:h:t:|::p!p$u$w$:l9:9 :K?u&c>J?$:0:i?h?l?p$? -LM@P`p 0@0 00P+ 0@`@ 0@@`@ 0@ 00@p@`00 0 0-PLU@ U'\P000  ^0 /R 19R00C P^\0 0 C^\00Cu:AQ$t4t4,4t4t4t4t4t4h4t4p4t4t4t4t4t4t4t4t4!R<00 ,R <0<00<0 0-<@APL0CQH44444444444444444444444444444444444444444l444444444444444444444444444!R@ ,R@<@0!R@ ,R@!R @ ,R @!R@@ ,R@@T 0S0C0 00 0$ (0@P!R@ ,R@ p-LM0PS@ !0@T0ڄ R`@ 0!0@T ڈ RD`@ 0!0@T ph؅8؆8 -0LS@` QP!0PU0PPPp01 0 !0P U"8؇8 4S!3=8S>08S< >8 ST3T#1 $t2Q h2Q `2Q L2L2H2@2Q 82Q,2,2$2$2222Q 2Q 2Q111Q 1Q1111Q 1Q ʼ1Q 1Q1Q 1Q1Q ʈ1Q 1Qx18 h1Q `1QX1T1<1< @1}<1{81y41w01u,1s1k n1!10 101;C \ c@7:::::::::::::::: c:::: ::::gL c53 -LM@PTp`x 0 S  0 P(0  0 P 00  P@<N K  0n P :@: -L M` P@>, p 00CS0(S0  \00 0T@ U P4$0Q44P8 8@  T8 @  0hB 4P00  6@$2D1c!HL <0$ 001T0$ X0($0P @0\`0d0 <0 1c80@ a00 2 Pld ` Z<2<"082 4"002 ,"0$2 "0Q0 0(02 0 1 00A S-h4444444444444Z(  0t!0p1 0h1h!0d1( 0<(0,~(0,<(0t \0  ci8@PU  \0$!0" a[<0 05  aR8@PU I(0 0(0W mD$i@5< ,4|444T44$4D444444d4L44d: 0-L@0PS  0Rc0Q 000 0 R@-@0P 10RS<8 00(8 000<8  0 E-<p$@RL1P̂,X 0`5%7,@Dt" X P P 00  0 0  00  0 0 Z 0P0@DtA A"0pBP@%,`c -LMX$`$pT`FvC%B$  v`F0v@P -L(@pP`0 PS$` WP(00(0P(00(0G-@MT (00 0h00\h0ZЍT= T1 ,P E-./0p1` U0ޕ0ޅ  eS22 R0ޕ0ޅ b BS22 R0ޕ0ޅ b BS22T T 1\h 4 8 <\h0ڽ 48<\h0ڲ(8-! !^p@-C7@<00RP`h@% 0<$ XL1H!!0"PEu R ^@@@ @@@@@ S ^@PEup(0  \B1 P0"A-(0@ @0 $00bT0C$ X>" P00c R b00$AL| 0 ^P 0 R00L|L| p`0VP0 00X000 ^ 0 R00Q0 00W0L00|G-T`p@X 2,0 1 TPh$4L|DA 0TP PL|L|@ 0TP PL|L| 0TP PL| b0c 0@cLD1|b@  X0YVP P  T PRLZ| p-LMx`@PT 0S @T (@ p  00@p00p c -LMX@$p@% bT0 apGL Bw &R$  ᎫpG0w`@T0 -LM@p a`L P @P@0T0e0CX # $ ';<0A0q 0Aq  -LM`R@Pp  0P@T -QL M, `XD0@T , Pp0 @yD0@T XSJD0@T ,0Pp0 @aD0@TXZ -LMRp`P@T0  @BT@XJ0  6@TZ -LMQ`@pD0PU`V p 0PPD0Up@-a0Sq@0!0 0!#1 0"#2 0$#44(< 0@#8 T0P@0,,!0 0!#1 0"#2 0$#44(< 0@#8 T0P@0 0 0 #1 0ll"#2 0$#44(< 0@#8T000pc cUUUU3333 c c -LM@v 0 ST0 S D@00 0 000 0,0 0S04:44$44,4,4#@-A;A'<0<  0hh0@|  4 4006 600 0000@2 2T0 gg -LLM`\@p oT X !4.0 X@$P嬐 W' 0P 8PEpbu ( 0PE#200u0   @ `0 AD! 1000C0PE00u0 PEu00@ggg -LlM`\@p ocT X (!4.0 X@$P嬐V W. 0P 8PEpbu ( 0PE#200u0   0#2000 @ l0 AD! ! 1000C0PE40u0 PEu000 @ggg -L⌡M`\@p oT X H!4.0 X@$P嬐 W5 0P 8PEpbu ( 0PE#200u0   0#2000   @ x0 AD! ! ! 1000C0PE80u0 PEu0000 @gggA-` p!PX0!1, 1!0 P@$h 2L|` 0 0L0|0 0 Q0!L 0@RR|` 0Q@00000U0CSR0L000| c c cp@-@P$0 X0a<.1 0 R$@@D0"t 0 @D0#t0ph0h  @D1t 0p 00#0q0@D0#0t c c cG-0M, 0P@,P00X0PPP` U$pA,!0pG0 wP( 0b@U0S T eR0 APh 1Z * 0! j\<%1^<,pG0w0Ѝ%0Z:$P 00Q( 0e 0 0 0A22V$00S,P`00`  `VpG! a `Bw  02 0,Z0 @ V0S 0 S fR0 J\Vڬ3 00003 !@@D\ V0S Q fR0\@D(\% U0 S0 S eR0 0 @CTŸ 1Q !2 0 c\ 1^<  pGw\ "0A\<X"0  000, 0pG!0 w= 020,P(0\ @ P* Z 0`S V jR0 P 0 PCUT| 1\ ,d1 0 c\ H1^<  VP@ PF\ U0S Q eR0\@$ R U0S 0 S eR0 A\ڈ0P 0000 !pGwT 0  000 , 0Q0 S3 c c c0 0 S$0 S000S 0<4444E-M pTJ<h@J+X< ,$P ` @h0 P. 08 PPEcu $(  04 8V@   ? R0PEu 0`FvL0 `Fv0ЍPEu 0V    RPEu@-A;A'<00<  |hx0h@  0011 @01 (01 0 Rgg -L@M@\`Pp mi1 WT0X(# U$& 08 P@Pcp!!( P0@#1<0 p 01<0  0 ` 0<L00C0@p (P0@00 pggg -L\M@\`Pp m$1 WfT0X(# U$, 0P8 @Pcp!!(P 0@#1<0 p 01<0  0#1<0  0 h 0<L00C0@p ,0@000 pggg -LpM@\`Pp m81 WT0X(# U$2 0P8 @Pcp!!(P 0@#1<0 p 01<0  0#1<0  01<0 0 h 0<L 00C0@p (0@p0 000ggg0 0 Sh0 S\0\00,0S R/0,0R.000 0 0-10S 044484G-M(T) <h@pX)'< ,$P ` @h0 P@ 0 0P8 PEcu .  04( 8V  @ ?10 R0PEup 0`Fv @D `Fv ЍPEu 0V @  RPEuA-!;!'<0< 0 P0h x@ 0011D  00!0000P0@gtg -LdMP\p@` mc,1 XT0X'#@v$- 0P8 N`c~& (p @`0N0x0~  01x0  0 0  t 0L 00C0N80~   0N~xgtggg -L␡M`\p@P mX1 XYT0X'#@u$6 0P8 NPc~% (p P@0N0x0~  01x0   00x0  00  0L 00C0N@0~     0N~xgtggg -L⼡M`\p@P m1 XT0X'#@u$? 0P8 NPc~% (p# (Q@0N0x0~  01x0   00x0  01x0  00  0L00000 00000C0NH0~       0N~xgtggg(0$8 Q!0  Q:880@-P(P  $08@Dt @\ 0 0 A\(@Dt0 p-LMP s80`@T  @Tphsg -L4M , < 4 4,< 㖢,@$0 0⣡ , 0 404@,8 0@ T,0D $0L0 K, ,0$ ,L (0P0 8T@ H X@ L pX0HW#,*,  T08 @0 < P*?< >1G0c @ @P`?>1 1@V3 0Q00AP :L pP0W:0D QX0T 0 P 0X0 T L 4 ,4  0($080804|P484 4 0-L@ sP%@sdP 0h(0-LQ@0 0R, 0 S |gRcg,0 P 0SPg -Lp `Pr0@T U 0$ R @T rV 0 RX 0( RW P rg -LMp Pr $ (0 0S 1U0@0`00 <@开p1 `|r< 尪$0( @է8088 ᠪ밁brgRc -LM@ P`UrpdP@& U ,0U 0SU0,PV 00V 0S Y00`00("X0-r)rP -LP p`r@-PU10  rU 0-@L rPP@ 0C(S"H q0:@-0S4 S/0!0@Ġ\@(00\$ 0nQ T00T 0@bS 0 S00T0P00SS00Xc -LcMq0P@$0 40@@R00}/#\B1TTT 0P0 $0S h$XTa0S0D!0000iK1 ;0@00 3m`0`2Sh@4 0P$@X0S 008 R 0  0S0 00C0t900X 80P0H: 850P0|dgxXc: : :,9(b=( :5H :h : p-LM0P\^ @L p0p@弤Q```P`` `0 ^ pP嫤P ($`Xcp:5XcEi5dXc : : : 0-L@p0PS0000 0@@0@0hpEi -LM@p0S R 0 00  0  hpEi 0-P0L8 X0  0\2S @0S" ? 00\"R P0S"@002c1  ?P0S ` 00C0 0<D /0\2S 0S@L@R`Xc: : : -Lwp`Pp@ 0Tl  R0000 0  `p \pP@TEi : Q- LC : 88#$R\\ 0R01SP0SQ 00tXcXcEi - 8LbMР8#P( `P0 Sp@jKo0Sttt 0#@P@ oT (0 S 0( Y@|dghXc!:!: 88#P0 tXcEi -L Ƞ Ƞ,4MP@p <2 QPPy(2Q 2Q 0ό1Q 0B~S001<P   0 d0T N  VS00< R V P0KH0 @0KP T TD 0 ,p L` 8` 4 00S 00<1 P0T0 V 00S X MTH K¾T H K὾PT H0Q @0QQ(0$0pXcUU@Ut}f~fEi0 0 4 S-L@P'oA`p <0 RpoQ pXcEi -LM@ oH 0S00  Q0 0 0S00hn Ei0 R=  0pXc p-LM1@s 88 #4 pS0P`$0<`80n00@n EiXc 0-0 _0LS@ P0S 0000 8X00 0S P0S ?  0 ? p-LMX`0SLP-@ʦ f1S0Pv00C0ppXchXc 0-LbM`P0PP@0  cK T fK' 0S k0 |dg!: 0-LbMPP0 @ bK0 fK 0S M0|dg$!: -LcM䀟0k_K`$0 @ fa㝣-pj`+n @0iK0cS0x 0͇1ptXT0P n $0S ,$4g|dgpXchXcEiEi8!: p-x0LM R 00p`BP `n0S phn000 0@@0m= p-LMQ@@P Q pTP P0S \ R 0`S \ `1PS 0-LbMP@0 @S0 4P0+L0SA00`"R 0fK1 Y0 S l0xi0 0`20@@ 02c 1&P v^|dgH!::T!:\!: -LM(@0$S  00韤0XcEi|!: 00C0Xc -LM  -LMPp^@`   0S & 0S ^ 0S K0 P  0R 0 0 0 0 0 00  -LMp $0K`PP@0 PP @ @` $ $0 $P$0( 4$ P@0 $$0($0 0- 0 0CSL@ 0P U R 0 0 0 00C00  $Pe㩢 0 -LM0p$0 @R (B(0P3,1P # 3?0@CP  R0 I_KPE00 $("8  00Z00",S ?00^0#03^00SV000JKKK 0jP,1S QK% Q&0Q41!P0 S0 S0 0 SR 000 S -LM0PP,0 @`0<p7 S'V W 0S 04  Z U 0S 0,4| o,  oQ  L  0;p ,04PPPP#:`#: -LMB4 , @pT0 P0D01p#: -LEMh@PKp `K?K0 ,@ 0$! KK 01V h 

1 e!\:0> 0C0 n>S -LhM ` PPpK "P@ < R RXp0 SD0Sl -LM 0@S  P 0S0  0S   -BMLM P0004P`p 0@0X0 @T@0s 3@R CKC.K A Bf08D 5P 0p08<\`4p Pp:@0 Wڐ2W" pf ?PhJ 0@0dpH0 jTC^KPE08< P@H0PHTH0@W0TH00` P 0<8P 08<P0  !14K,@ h0C.KP B180@T8<P 4{0S SxA}0T<4 s f< ތP8 v <$婏xSf 0  @0eP 0 S 00SX 0@T?`P00S@  <Fj((:D(:89':,9pn5n5':Xc,ZcuYc':':': p-LlM0 d0 @P`KP d0T@p -QLM@ 0SX(:d(: -LM 0@~  ^ 0 S 0000 p-QLMP` Q pd@V*h0!@RT:0p0d` -P80PLp0p\Pd` V@*h 1S@ T:0 Ph 01d`f㔌% 0-LM@P0K  T TdD P00C0 Q *h0\ 500  <o08!0t(:\00` -LM5 `0P\ 5 l00Sl0 H0S f@D4PD $ H@80 @ 1P@p"05P< p X0s  4XL0P@p0#PP 0PT L pF8DDf 50@050Pl@P8@L@TPT@P@Hp5 0-50L0@ 050l PBUlPPPTPLP8PDP0fԋDPd88P_LLP -LM4p^P` 00 4`*(40@ 0004 40Pᜋ -LpMp4P^@ 0` cTK K@ 0S 4 ȍ40K0 4@|dg(: -LM4@04 0( -LML P @0 @TK@ @(:P p-0L M<00@00 P4 K K` 0 [0  @0T  0D MD 0H@$pv5(:Q Q 0-50 L@ 0Ppp 00 S P0 P0U0P0CS0PYTb`w5b 0-PP@L D |0 lx0S00h | 8 0- 88 #PL*0AT 0SVPU P 0t Df !|0L0|0xP0Zc 0-D0 (("ALP~ PLf㎊xP00Zc -LM⤑|0P, @p 4 @0@R@`K0 P@ ,0 S 0,{rTP0S@P`0T!7||0pSpW)P0S WTP R@W00T00S KP`T@!T@#  m  ᧣PpP R@T|00|0 ,T#|dg(:(: 0-X0L Ƞ Ƞ,A000}0P0CS00&0Zc 0-0PSL@D0 TLd R0 0L P   0-X0L Ƞ Ƞ,A0000P0CS000Zc -LMԂ0S`P(  v2Q B2Q9 2Q (0 S (400d2Q \2Q0S|00|04 @0R0 KPp-|00K K00 S;#0 0 忋000 1QE 1Q 1QxP 81 Ql1Q% d1QQ Q@00 4@0@T@0 TpW  傋QH0D0000 K0Pp zQ Qt@00  0RpQjH0D0Pxm x0S_x g|dg}fpUtAU@(:UDUU~fvtnUU 0-LM\ @.Q@@&0@0CS000Zc -0LM Ƞ Ƞ,Q0S@p RA ` P0lS`R }0Zc 0-t ,K0e|\ F1<0 S45):$EiS8dZc,98<5xQ48 -QLM@CϠ m? R  0S T @ hv Q0- L@P Q 0|1Sm?@ p-LM1 S@P\`|P50p#` 0 ():$Ei -0 RL`p@ @*PX@ P 0p000 @WP:!E? R 1S 1S 1S mFφ> m+Fφ> mɺ -L(M0PS`Z LpX @ W*0@ 0SLK S <00p0 T:!PdP @T*0P\?@T:@T*0\%@T:L0W 1S c LKPq@QTP LK0|  @TPQ*0P \ Q:0LKpQ*0 \ Q:0,LK p -LMm? R`1S  K` T!R\13 0K <\ 0[D!2 0K HQ 0[P!2 0K K0 0 Q-L h0Q 00H0Q @0Q 0 `1 W@W@ WW -LM<@T 0(Ei Ei 0S 0(Ei Ei -L0\P1`pc?@Lc01 唈 00@0@004\ 0-LM00P@K4U >P06P 0 0 $Ei -L|M`K0 K pK@XPP< @0S<6[S4 t0S 8\X 80Kp[Ƞ 80S4^00 1S80KḀ@40Oφh P 40RφL P40Uφ0 PD):\):p):):):): 0- LP@0PP 0 P 0S 000CSPPP 00 -LMp @0 040 8 PPXY\` 0X0 Y 0\0 ` 0S4P` X0S0S S0 X0Y R 00CS񟗡 58585058550 Y0X0S S0BS񟗼555 5 5l#0d"U 0S0PUy<0Su =Qr X Rl R00c 4D0 P i4<@0 PX0SG 00`PP` PUZX 0S- 4S* 0S% SP2Y T00BS ꔏ5`5`555$0 it P 1P X S4>H0 UP =>0S4P 0 S00S=  X0S 0PUo 00S> 00S<  ivPS j F D B @ >S00Y0 %0!0S PS 00):):h9):):X8*:(*:T*:l*:L8':*:9*:*:*: -LM`p@P@@P6PUZ6N0P0CS0/0S Q&NAT P 0W1 )0 p@ @0@ -QL1  Q S 0S -L`p@PPPU@Z@P`@PPU@Z@`p -LM0@S  1S01 1SP P1 010C1P1 Q*: -LM`pP @ 0TP@@ Ƞ,Ƞ 0000 R P@@= -LM@PP`  h0!T` 00040 R Pࠁࠓ=Y0S 0r0Ss 0Rr0 R0S0w00ZR0S 0{ z0 0$S$0 -LMP@U`1p @0<0L00MQ0PNPOPRPSP L0 -L ML0Xp 0 8@8P`DD!LMNORPPQ@S`j -L MP0pN=U``GGGL0 0 10S U0d0e B0C f0g 0S0)0K h 0C4i0 j k000nmo@lp)PK)0[s@p0qr{  Մ 0P00p000 0 0PPEDd 0 P@00 0S AxZc= p-L M0PS@- 0BS`5ܚ555555(5d5T 0R0P RA R*R# T00CS000@  0PPpph9p0\# # b 0 T T 0Q0ph HD 0@@@ 0@ T R 0\`@ `@48" <S^  hi0jk 48 0h87 #80h  0@-HP@ 0, Q ^?0 -05L P <5^ mW @ @TbVp `5<5 d0SA@20!pVp`5 -LM@ a{ ] hX p-LMP  M`@ @TT 6> ~$ ~ 7& ~36> $ph!L '-: -LM 0S4F 0 0P 008 -LMP`p )P@?:.@@2"3#cc|, KP@ 0F ,6>R!d2 p/p0PTb3S 3S 3SwE(@K` P _ `t1!0p5t!1!p1!` 0`1_ !401@8 <0 x!x1pڢ 0M$ R "0Ԣ"ɑ 1  %E ,P 0 S00S# 0@T00S#00S#  T-:d55-:-:8.:.:(555855555@5i(.: -LMp@0So0Pu9D5@ NBџd#0 BR0d#D OiQ Q? -@R<0P`+pL  0   @UP@ ; ?1+(  t7nT.: 2>0-LP $@7P  0S 0RP7  P7  -LM2N0 S   6P7  P7  p-LM?`@Q00 5@ R R00RPPU pp30p3PT phJp#0\pS0S 0P@ 0` 0P@ .: -LM`?pQ@0P 5@ R- R00RPPU l30l3PT ̠A 0  @ hl#0@lS00K  00 {00S ,KA {*0[0*0K*[Z 0P@ 00 0C00 0 00@PC4 7P DP  Ŝ4rC  㮇 0@5.: -P?@LT`0p VC5X;E5 XXmIC 0@{ \3X  0@ 1S o.:P? R! -? LR@0`_ CpL R WhC,0 00 0S  1S < p-AMLA2N0P `0 P 0 C400\\  PX30X3p 9p'D5.: -LM@? R#? R 5+Q P 5;5Q 0S110C1DP5 ;%5 ņ -? LRP0p⧏5@@ uB_o @Tڼ5 @ f  7P1 7P+ H O H K 3S 5 @05%+%4Bm郫P m)B % .:/: p-LM@< ?PP1> 3PP? τ%d @oPP ̠  ` P1p 4p  550/:P/:p/: 0-? LR_? ( R $@T L0@TeK0 0-@LOPK000,  0 -P?`LP@pcA1T0 #x1T 0 0᭙4P A5@5050 R0D*0T 0T/0]%# = S =@S @ 8C83%3  O 3 D @ /i i 5i 6i( -L M `@0Pp```#A2~0 $KP{$ 1SAV/: -00%P-@%LU E A▪ PSP:P!@`PpP8P,`PpP $P ? $s1,c8s+@cLP P03  6P P03 x d P  P S , /:/:/:0:(0:H0:d3/0d3xw -LM@wd30CSd3h 0-LM\P @0?00K:EDLKK CʠKC6PKK@K0KKgP0 -LM?`pPP 00S S @ @K@K 0@ K 0 Pp0@U  [ [D 00P00S0p l0: -LMϠ P`UCĠp@ K 0Kmh 0P} K L0v @40Po]T ! 0: -LM2/ 6S00@ RA?< R 0, G0Sh0: 0- 03_(0LS $@T J0@TDI0 0-@LOPcI000,  0 -LM?D 0Rp( 00 ,0  (0S (z 04K4 [30[ d1R`hU&h@ P0K< 50 0 r0S0KΠ =0!U @P`|dg0: 0/QbE 0-@MLP 0@K 0| 0@0d @(1[#4S=  <0,@  0@K <0@@y 0@p H0@g 0x@^  0@U0 04@N  0  " 0-LMP@ 0P6(Ϡ  ^0  0P%  H0P 0 0P  0P< H0P~ 0P (0" -LM 0S0 0HP 00갳8 -LMp0P`3 P@0 t+l#?⺯@t#LxSYuD39@..3SP@  r!3 `/`~0`< " 0S;930@TpP 0 S00S" 0@T=P :΅08j?0k /0@  ,`K,`K0`Q :΅0J!?@@[ l `0P;10p5|!|1t!p1t!t1o! d!40`18 <0 L!L1p# 0?F$ R "0"F` ,0  n=  @00S"t00S"o e pK鰳8050:T5-:<9 0:0:``085855555 5x5 5i0:0: -LM(0PS0`ɦ ?P 9P4P/85=d3p0CSd35@O YFᄛ[d3 0CS d3< NnljiQ Q? 0-L P@; 1P+  U 0! p-LMO0 SP$ , ` pP7  nP 7 0-_0 @SL   0P7  PP7 -LM?4 Q@0`p5@ R' RRbPT #ak04  o4 P?00Kp/00s[ 00S=  ,Kqt[2[0 0 AS0 /Pp,08#x0g00 BPP! | 0@  ` ppLt<@DP  X<00S >0P@ 51: -LM`?@PQ0p ;U UUi; 0@  pU t5U;5  P1S0P@ ,1:P? R P-L@# ? 0`R_ ;pZE#R h;,0 00 0S #1S X -LMp00P$K1 o< 2 @1T2K2[@@02KLs0 0 0@xrP  P   @_0SD30D30K2Kks@ 0 @'5 -LM@3S 5+Q P 5;5Q 0S110C1DP5 ;%5 : -LM`:Op00&7P{ @7Pu 0@] 1:.0 4b?  2 R95  0L/?? TPP  Di:/>? CPP  O   P%@ %5P;5:iң:.0 @ d x0 @L 0E@D^ φ00sH1:d1:1:51:a -LMP@`pK:1T4 '1T 0 0Z4P 7:5@505%@ 0 R0"#<1T 41T/0%9 = S# =@S @ 8C83%3  0(K' [(0[40 y\3 \ 0(Kl' [(0[40 @ .i i 5i 6i( p-L M` 0@Pd9_0 K@ 1S9pz1: -@Ll00%P-%U2PRP9P 0`PpP(P`PpPP03{scu(s0cP P03 P JP qP02 x:| d4P [PRm ,%g 1:2:$2:H2:l2:2: 0-LM?@0TA KPK0K 0?00K00K0K0K@K@KK@KPPP[ -L M?@TA K0K ?00K00K00KK@K@KK@KP0 [0[4 p-L M?@\AdBT0 K  p@0 0K00KPK`KK@KKKP00 0-LMQP@ ?0@00KAĠ0EKK@KPK0KKK0KP0 0-LM?0@P K0K 00KK@K@K@K@K@K0PS0y02: -LM0p5`,? <5 ??\ !?@?\ RU@ P5<5% ?@垓;;1"  g0S ;;!0U@P5: -L M?@ \K @00K 00KKKKKKK(P-: -LM 0S4 0 0P 00Zc -LMPp@ RPR!1 @1/@p3/1/3tss( KP (`20@V(/PM 0 SA00S" 50`V$@K7`EP  f0 0@5t!0 p1!` 0pk 70  y7 00S"00S"  4Z-:H5H5-:.:555$5Y0: -@L`if0S0PA75p@ Kᓄ0037  YQ Q? -@R<0P`+pL  0  @P@ ; 1+(  Y7T.: 2>0-LP $@7P  0S 0P7  P7 -LM2N0 S   P7  P7 -LM`0p,0 0PS0 5@ R- R00R@@T \360\3PU ̠|A0  @(\#0$k\C,0K 0, n  04 S,0 0P@  0@ ,00 0J6 7P DP ጏ 96  uz 0@5.: -P?@LT`0p 65X;E5 XXm6 0@B \X  0@ Q 1S r.:P? R -LM? iRp̀  Pok``m0O 0OoP @0  p-AMLA2N0P `0V P  0 C40 \\  PP30P3p yp'(52: -LM@? R5+Q P 5;5Q 0S110C1DP5 ;%5 y -LM? PR0p5@@ =5" Wo gd@QTڼ5`   HR7P- (7P' $ 8# 4" 0 ,2S 5@05%+%4iN P i4 .:/: p-LM@ = ?PP-> {oPP ̠ L Pp p 5P/:p/: -P?pLP@`X4\1TE P1T 0 0Ὄ4P 45@%% = S =@S @ 8C830%3  `S `3 `F @ ?5050 R0% i i -LM0/pW2 `@0P``1940(K P ( 1S&4/: -00%P-@%LU` 7ⱝPPP7P@`PpP8P,`PpP$P$sO,c8sI@cjP P02  TP P02 x d>P PR , /:/:/:0:(0:H0: 0-LMP"D@0K 0KK@KPKKKKK0 0-LM8QP#@0?00K@!Ġ0%K K@KPKK0KK0K0 -L(Mp8KP@~,0[+ [4ST<K@ Kw!P` !0F< ?0 Ġ(̌"Č!̌  P`T0 Ġ(̌L"ČD#̌L8#D !L 0 @P`6@<P Ġ4(̌<"Č!4L.< ̌DL8#D 0%L @qP` <h  eq) L <h ( 2:2:3:L3:t3:3:3: -LM05P <5Ϡ000  m/B0T00p` @  ?0488W p" P ` jT@5O<5  8  #8 5 -LM @P*.OP c h|-: -LM 0S4! 0 0QP 00ꈴ8 -LMpBP KP  2 `0@VM2S 2S 0P!?f  {gPP  2O@`ᭌP $ `1!0@5t!1!p1!` 0p~ӌ0  1 YP 0 S00S" 0`V00S"00S"  4嵾3:-:.: 4:44:.: 6L 660: p-LM`@P 0Shb\PLPD ^0< ph+8ph}-:dg6: -@L|12`Shpf0P0S 5@ |~00d1Ng02Q Q? -@R<0Pp+`L  0 @P@ ; 1+(  '7!T.: .>0-LP $@7P  0S 0P7  P7  -LM.N0 S   P7  P7  -LM`0p,0 0PS0 5@ R- R00R@@T 3203PU ̠A0  @_#04墽C,0K , R h 0 4,0 $,0 S0P@ 00K@0 ,  }0 "7P DP Έ l0  t 0@(6.: -P?@LT`0p P05X;E5 XXmC0 0@u \-X  0@ 1S >.: p-AMLA.N0P `0 P  0/"-C4? 0@ \X  >P303p' ߼Fp\ 6`4: -LM@? R5+Q P 5;5Q 0S110C1DP5 ;%5 s -L M0p5P@` /@υ 0@/ 005  00 @ 7Pp ]7P 2S %@ %5;5iv/ P  d.:/: p-LM@? ?PP?  oPP ̠ L Pbp} 5pv (6P/:p/: -P?`LP@pW(/X1TD L1T 0 094P /5@7%$ = S =@S @ 8C82E%2  ?  I2 ?  @ ?505%0 R0 i i -LM0/pW. `@0P``讻.0(K P ( K1S./: -0 5P=5U@LPPP7P`PpPP`PpPPrbzrcP P02 U OP vP02 x? d9P `PRr ,*l $/:/:/:0:(0:H0: 0-LM @P0PP 0@  PP 0S 0 8 -LIMpᜂ `m0 P PP?MOKP ʏ0$S Pz ,@P(0!R@T2SX :02 @TP4P 0@S 0T2s !PpW"{rv 2so -Yp J_KNK 0PIK@L? `ß`3(KJKO @|\ KǏ<8,#44 < QKD1 m\.>"P ]2"0@5t!2"p1!` 0`y=2  O- 0 0 00A SA ARa0A7ASWA? 2@0 T0ڢO"P 2@ ""0PT "r 2stpWiP 0 S00S"0@T00S" ,  00S0"2-TPP 0 S ,(0!0"(1220S SY 庹|帹00S0 0S 84:4:*.:l66p6*4:4:5:45: 9d5: -PL,hp`00@S 5@ ᡇy00, %o,* -LM@? R5+Q P 5;5Q 0S110C1DP5 ;%5 p - !LMOPp `0?  P  ||  Jw0S3030K# p ['#6 -0 5P=5U@LPPP7P`PpPP`PpPPsFcr@baP P02 ȸ  ¸KP P02 x岸 d嬸5P ӾPR ,坸 嗸5:5:/:0:(0:H0: -`?PLP@p0+0T 0T 0 0ᝃ4P z+ @ *@ W5050 R0- i i p@-0? R( p`@0P``p@ ½Pp X i+?? 㱽Pp G O0  pD%@ %5;5p?υP? PȽPp  /:p/:P/:L!6.:$65: -@R<0P`+pL  0 K @P@ ; j1+(  7噷T.: 0-0_@ L07P  0S 0~P 7  JP7  0-O0 SL$ , P 0aP 7  -P7  -LM`0,0 O0pSP0,5@) R2 RR$ $3S% U $2`|0$3 S0$3/00A0  @CpϾ[ 4$#,0K x? ,00C,0 , R Db,0 S0P@ 00K@0 ,  ) 7P DP 2 )  n 0@5:L!66: -LMP?@pT`0 )5V;E5 VV  0@ 埶V )M(K 0 P(0S00P@ 1S ) `.:Q Q? -RLM R0K R  ǽAq- $0A0 0!q "[c -LM 0S4 0 0<P 00꘵8 -LMp@8`' PP#=P2x#|CV`2/P3C0 KPP000400 4 ?x080@0<0 `Uk80se <0sb @0s_ (,`K 0PPJዃ׵ W t@k1tp!51p!!t11.n!!4018  <0 !1pT  0Po1$ R "0M"vBuᐃ P<\0 d3( ;叵 (0h3刵4P  0S 0S 0PU0S@0S80S0S<d`P 9-:p>686:;688:4696L;6p?6(@6@6=6=6P>62:.:6:6: -@d3LSP.ntP07]0Z;(l3p0CSl345@ }1ᨆ7u0d3(0 㻹c -PL M@`P hP`^EtF(K lÔ?00(0K%K#pK!K'K&KlÄ$PK"`Kl3P0CSl3 -PLM@p` hS`pUFG,K l@00,0K)PK*PK+K'K%K(`Kl&pKl3P0CSl3 -PLMK hC KT0  P00[ -PLM@p` hS`UGF,K l@00,0K&PK+K)K'K*pK(`Kl%PK埽l3P0CSl3 -LM@`hS.Ubp'p0/y 0 5 L  |7P= S7P5 m} u m 0H0S D0SP 5@05%+%'Pe'D /:.: p-LMhCPT p5 H. @4`%0@  -Tph-'Q Qh -LM┡h3 S`( tp5 U  <5    (0S (寓0K U)[ 0)KRU@ P5<5  0 0S ΁?0 00U@P5 |dg@6: p-LMh3`SP4l#8 l#4D0 P&4<H0 P MD0|  `Y冹l30CSl3pLl ,$`e p476P/:p/: -@R<0P`+pL  0  @P@ ; 1+(  V7T.: ?0-LP $@7P  0S 00ϹP(7  Pع7  -LMO0 S  , 0尹P(7  |P幹7  -LM@h3S"(3S 5+Q P 5;5Q 0S110C1DP5 ;%5 i p-!L!M_0@ `0 @;\< l1L0 H   sl30l3坸l3@0CSl3T\30 \3p} 850A Q 3T<66P6: -PLhC`Ttp #%5X;E5" XXm%B 0@H X l3H0l3嬹l30CSl3  0@ M 1S :.: -L$M`ph3S@tP RA R00RPPU h0l0h0ĻP(T AD0  @ոl30l3l30CSl3Ǿl3D0l3Tl30CSl3Ếٿh 08吱hP,0K  04 C, > R 0P@  \00K@0 ,  Pk$0 C7P DP  }0Z$  h 0@476.: -`Lh3PS@pW>$X1T0 #H1T t 0N|4Pp +$5@pO5050 Rt 0T 0T..05 - R @R @8 K0 @ 2i i 5i 6i( -L M `@0Pp```Ȱ#0 $KP($ 1S# /:t -5@=P5LUPHDP9HP L`PpPDP8`PpP0P0(3锷0s8cꎷDsLcP H堶P0H0걾 pi꫾ \cP D劶PDPꜾ $Tꖾ N/:0:(0:H0: 0-Lh3.^S(3(0S0h,$@T L.0@T0 0-0Lh#RP.N 5@00"000,000,  0Ph37S0 P-L@" h3t`S.^ #p,(#R PTh",0 00 0S (#1S Al32.0l3Y -LM@2Zl30CSl3h 0-PLM@P h3 SQ 0 @       K0  [0[Ă p-PLM@`P h3SQ p @ FĠ0 K K`K     0SH08 #\ 08S0 S ,_c -LMPp@ PR!1 @/@( K(P ;(P島0@U52S 2S 2S\/"0@;H!h0D1t!@!p1>`!5`0p 1 Pfel1dPnn0P " 㦳(zP 0 S00S" 0PU00S"00S"  0֮-:-:.: M6I6N6lP60: -@L!`p`00PS 5@ o00! X!Q Q0 -@R<0Pp+`L  0 @]P@ ; G1+(  |7vT.: ?0-LP $@7P  0S 0ZP7  &Pc7 -LMO0 S   <P7  PE7 -LMP0,0 0`S0p 5@ R- R00R@@T 303PV ˠ j %H0S D0SP 5@05%+%P鵨8, ' //:..: p-LMhCPT pLD <`*00@  !T ph!.'Q Qh -LMh3`Sp`t5 X  <5  o$  RU@ P  |0S-v P  0@pU@P5<5 Y   H@ o 5 &* p-LMh3`SP4l#8 l#4D0 㦭P&4<H0 㟭P M̠D0x  ` 7l30CSl3p (է` p@d6P/:p/: -@R<0P`+pL  0 O @P@ ; n1+(  7坧T.: ?0-LP $@7P  0S 00偮P7  MP劮7 -LMO0 S  , 0cP7  /Pl7 -LM@h3S"(3S 5+Q P 5;5Q 0S110C1DP5 ;%5 s^ p-!!LM_@ `0 @@;T<d+ H  @/l30l3Yl3@0CSl3T\30 \3p9 40 H<@ c66: -PLhC`Ttp 5X;E5" XXmB 0@ 彦X l3H0l3il30CSl3ϳ  0@ 1S C.: -LM`ph3SPt RA R00R@@T h0l0h0偰P(U ̠AD0  @咭l3 0l3弬l30CSl3ᄳl3D0l3l30CSl3wᖴh 04Mh@00K 岭 00 Q00S,KA }Q+0[0P@  0@00 @0C00 0 0( N7P DP jr  S] 0@@d6.: -`Lh3PS@pVT1T0 #D1T t 0 q4P 5@Z5050 Rt0T 0T..0v5 - R @R @+ U# @ 2i i 5i 6i( -L M `@0Pp```凥0 $KP$ 1S{/:t -5@=P5LUPDP9HP L`PpPDP8`PpP0P0(3S0s8cMDsLcP H_P0H0p p(j \"ꫬP DIPDP[ $U  /:0:(0:H0: 0-Lh3.^S(3(0S0h!$@T  #0@T0 0-0Lh#RP.N 5@00"000!000,  0Ph37S0ݦ P-L@" h3t`S.^ p!(#R Ph,0 00 0S (#1S Ll32.0l3N -LM@2Nl30CSl3h鰱 p-PLM@`P hQ pV pU UPpU] U 0ll hP`P`0U  XU Q_0UP6: 8B7F p-PLM@P` h3SQ pUUphU] U 0h h(`P`0U   U Q_0UP886:B7F -LM 0S4' 0 0P 00P8 -LMP`p `P@ KūP@ أ 1!P!1 pt1t!pp1`@h!h1@@=0PT :P> 0 S200S1+ $0@T 00PPP0  Jh0 100S|0 00Sh0  Pt-:-:''' '&D.H.\.'./:.:7:]'T6''(.: -LŸ2 RP0p  0  0SXb0SL?(; B@łOMqc!@00CS02 0S A ` 00C! 0Pa0 S AP?AP#xAP d1 㩧ꉪX 'P007 0 qX P00 ע ТYP P00 h忢 T幢KwiX.\']',7:X'..,'$'(''(0:H0:/:0:/:/: -0L'lMSp  !0`B!@%=?ZDP U@@T,0 @ }D evDsD0    剩嶨P0顰0, LX0SQD7:P8.(.h7:..$''\67: -LM?pH0 \`,0 H \(A0S Q00C!0 K0 S1 @<'\00P p0pᴠᶐ,0@000 D0@ .|@  p @  AD0P@@<oE&... .$'6' -2LM 2Rp` l2R `2R '\0PH".<p 0 00@0C2@ BŸ   @Ҩ., 0@? SO 1 R 1R" ʌ1R 1R Tx1 @l1 p p 0 00 0 1R 01R0ASy6 y6(y60y6Hy6Hy68y6@y6Hy6Hy6Hy6Hy6Hy6Hy6Py6 0P= R0S? 2K"K,pKs@0 ,pK2K"Kk#& .$'6'*D( -L@M`83? Q@ (3\ 3Q d3QA  '\ C0?p0P% W@-00 00 RhC2  .lŸ ` p 5l2P@ @    BB%-(ؠ 0""K0 2K"K 1 R 10S SK,`K1 R\1Q 1Q0S2K?,`K2K "Kd!P0p2`TKPK&BV?G K5KB]PpPW 0"K0C "K S|6}6}6|6}6}6 }6|6|6|6(}60,`K2KT0000000S:=@,`KBKK&# $''6.7:(# # -t0tPL @`T0 0 q @ ʤH40P 0(00C ` 0@ &..(. p-QLMd@ P L0L 0 S ` B`p0` \&(... p-LM\@`P+  \$ \ 0 \0 P 0S|0 \p0 d 0 S App=P 0P&..(.<. p-LM 0@0 0`Px Pl0LrP- NP ܢ //0@X?s ?s|2|"`A 4?`h w@ 0B  ? DOv U 2% Ph ?  $17GG g^F YFL㑠N>X0@ڌ1!51x!t1!1 1p!0 p>F Z xT1|"2L1|/ |2@@!厠  X0+S$@ 11  !1 oyNP 0 S00S/0Xe00S/  o鱚h8:8:.:6668:07@766ī66x6t6X6)X^`8: p-LMP0@ `ᛟZ 娜A 4'wB $w?SP?S >u  p吠匠n0? p- 0LMP00`@_HP`T P@ Vp(: plp 9:49: p-LMN` @PPPU `@Zp/` -LM@OP ޠP P ;/1 0?,  T9:|9:9:9: p-NLM @PP` 0SpA `P -LM@Ꭰ4P 5A0AS 00'R\ -0PL@7Q646T6T6d6S /|L P@ L7pA 4v7p7p'wR +'1'RRP`  P thj L'R 'RK 7sH f(9::: -@L^ Pp`jA 4uB uoG -LMpR@`0 RRi !V 0P@ ʠ PT `  B  0@, `5;5Ai ::l -L`KMp0R,0 @ 0 RR,0 S ,xR ˠB0@  @@~O?K /0Ÿ c:<1  24 "0n/ `8!  e' 0PP   PRP@   ?>0 c P,0 S X,$uE @@ 7p  !4  07KKp$ .4 01 \  V 0-0 @L$8P0 $  0$0h   0-0 @L$8P0 $  0$0h 0-8L@0P~ 5 ( "(  0hDPغ66666666666666666840,($ L;:T;:\;:d;:l;:t;:h9|;: -LMPK 0@[0 0[ ͠0  i x [ P<Phh0`p/`p0C-  0C- <0  -L`@0@ cTdTDP@p  @mTP w 8;: p-LM`PuV@ V@@|0 L\R@ IT@  8, @ ph 0-L@PDT T 00CS 0h -LM`S0@1 @T@z0>S @O cTdT  "bP7p0'OpFB-0( NwH p 0;~@p] !0@TPpڀÖPS 1 >ePV1> 0 [PFQP\9PD2^ P8A?  @嶖P Q 5QN n   ,5;5%@ %7 S  |l  骝 `bꤝ LDZܷ8"VS;:;:;:Ԛ6D<:,<:L<:l<: 0- @PP5L=05U |  x P?S ?S50h꧖G_ꢖB_#_D0x8 B-0-0@L( PN?? ℘[0CQ  X 00HSAQ B00HSB x 0h@k -LM`?(K$K(KB]T@L0p 'K(P#K @&@K%@K"pK!@K6 -RL?-Mp?́   o骎`0d @ 0P0@H0 @@ χO$B oj<: 0-LM0 @00P<@0yTT@T@ o0L00jD0000D0GP h^0 40Ps40hA5# I48: :,9<:p6 =: p-LM00@@PB0`SD00D0 0@@0bph0 0-00@L@P)0S R000H0 0  0h -@ML40@ @,@40S hhesp:6,=: -`LL0PS"DpD@ 0T  R0000 0  PL0S y`D@T4 : -LM@0<@0D0 -0`0CLPpS?6d666666 0 S00 0P S0C40rP@  0$0R  0 4P  0 S00 0I AP g/ 00 0 0  00  00  @ 0 S00 0 S0C4"P@ 00@PPQe 5PP 0 $2/P00P00 gD p-LMH@PT0`Q4& U 000SHPp@T 0 R @Tp000SH@ pPp p-LM0PR `@$0 $R Z RR 9R3 4P 00 K`V 8C@8Ÿ<8N0 @@<p0$  ^``00 @8Č0`` `@u1R 1RH 0\$  ; 04 <Z(1R0  R 1R KL   R # 00S0##400R R   R  00S0C4H\0`H 0\$q  j6 L=: _c_c_c P-0L 0 Q9gH8 -PUp`L e }4P@ U 1R@P.0SPP4 p-LMPK`@- 0` 5oP4p 0-@4PPL 80S0e00h46Bp -LM@e p-4P`? <08SP 00@Ps s0l0ML@P \00l m0n@o@P80X q@r@pPP@'N0<0J0<@0P SV8eo4 8N0@@<P@ <@@>8eW4 \-` cP@o6 -L MP `0 Ƞ(,@0 , @P`p0Z ,)( < 0R)< 0 Q0  "< 00S RP K R D -LhMؠ0@(0 PPK` (0xK(0 ᫤@ᨤ@ @e _3Pp0T  @@ (0 S (j|dgd=:=:Pe3 -QLM@p* 0S' 0S$ p`P~U~P#0 P 0f0  0 SR*000 0SR: 00 Q 0S3 : AQ0A Q0A <0<  $0 0 gg 0-LP@T 0P 0T0C?0D RR1*00 RR1:000 -LM , Pe2@T e % 2\ᔀ `ep 00 ?0`0 ``p @0, 0R0@ 3 -Lp` PU030#\Z0 @pT0 +%4X0P 0p -L M P 0U`e , 00 ,?2@T e $ 72\ ep 0 0 @P P 00,0000P0P@000 @ 2 -LM00 `00 0 80 V(8Pe , 40 )1@Te ! 1\ p(e 80 000 ,00000400 `@000 @ N2 -LM 0`Sp(PU! $K <P`e52 @$0T0  -P`e&2$00@TPU0 0sP 0AQP0000 p-L M`@P{P 0 KP  0R 0  0$0  $00 p -LM0`P4 epB1 P@0 0P 0,p` ( 0  0 00PU0e@01 0-@LP0 P(0  00P000h -LM@00  0e0C 0hx1 P 0 RP\ P 0 RP\ -LM("HP0 T 00 -LM("HP0 T 00 0-P0L00@T80  (Pc00 -LM,0@0(00 001 0-L'M@PL@ K @ ѕ0 PS h0|dg=: 0-(0@00P L00P,00 0,0 00 -,0 0(,00 L000 -00, 0 0 0 0  , 0-00 00, 0 0  , 0Q0-0R00\00^00 0-0L0 @PP,00,00,0 0-@PL0$00$ @  @R00@y0 -LM0@S 00P 6]000=: p-LMP@(`V $0S00S 0R*1 00 0S0  1 V 0S 0Sph`pp[  -LM00@ P00H p-LMH@P `0S ph000 0@@0 -L$M4p̠` ß 0 @@@2\00 b4PP 408 PP 8< @0P PUp(@K(08$ (0K0' K&0K 04$0KPP4EPPZLWL0PP0TT0XS P@o8H pPD PU|PHX0͠ pP pPPP@h-N01P*K 2K[(- V(? 1 SH0 x@5t!0 p1! x`ןE(T02;<!8D "P 8@ @0Ph f=:=:9`c\6=:>:$>:@>:`>:|>:>:6>:* ig>:666 - L >: -LM5@+-Q* 2S 0 S 0S1! 10C1hIgP 5;5Q 0S110C1DP5 ;%5 = -LMx`Pp5@;5EtPWCυA @0 1\Sifa@0 t@ 0-Lx@P0h -0LMRP`,0 xp, RR2S S02͠AHX0  @ PPT\HX+ 0Q22"S02,0KP,0S S0P@ A5@ :*P ,00 0X, *'p@0D \ pQ  Z<0P@ 6>:5:6: 0-Lβ P@; 1P+  ჶ 0O -PL@`p0T 0T x 0O4P  @ 2@ j505'0 Rx i i -LM `@0P`p`4囄5 ;%5@Di/: - LMx@5@ 5@05%+%h 0-LM@ T0P( T0LDHH  L0S(tP0W0'6 ?: 0-x0%P-%Ut @RL0駳tP -LMpzsP`Us 0 0$  0Q< $P< <800S`P 40PP<00S<0   Zz ` <4<8  4  @h h0@K4@ , @P 0 AgP $000S$ 0040$0$40H`(00(0 啂686?: sr-LP`p  0 $@T uv u 80U 0@Tv H0VW WhP e aD?:p?:?: p-rqLMP`  0 $ R uv0@ u 80U T pv H0VT404040@g2?: -QLM@8 0C?. B"0d a?:@: - 0L0\ s0 00 0-$@0 TLP,00 P0 P0@T0 0-$@LTP P0 0@T0 0-$@0 TLP,00  P0 0@T0 0-$@LTP P0 0@T0 -TPL0@& 00 1 ` ^{'i$8 80$8T 8X0@8$0T 8$8 4  X0  hvt8@: 0-X L0P@H `  0 @0  P=$8T 8$8T <8T @ $8T@40 }T00X0 00l@X0 8^}^0 X00X0 U)\ <#3  `0 + ;8#(0$8T 8X0@ `0  ,  R,,$8T0 6:0@: 0-P(0L0=X0@08X0$T0 4TP0 0h) p-LMTP 5* 0` p8 $48@T0$ 4@@ ph R0h0 d00Sd0 P0d@3ppp p-LMX0@![Y$80 T8}`$8T0 4P ` cVL0S X0  p8$;T8 X0lXZ^ -LP  -TP 00LR`p @$<0 T ,00@Eh, \00Q0S p-LMT`,0P0@ 0@ 0@@Sg0t Tt0g@`S `p0S 0-X0L @TP \0  v k _ U`0   B 1   \00L  00hQX 0@ X h00<0L 00QX 0@ X h00<0L0 0Q`0LX  0h0X 0+ Q`0X L 0h0X 0+ Q`0L( 0QL0& Q\0L0& Q\0L0# xQ\0~L0# oQ\0sL0"gQiLTER -LMX0@lT]0S 0 ?C5A0P 0S0Q  0-X0@ L08T0 $4T0P8$ 4X0Q0    ; S 0@0 40+0   P00@@@T  (RL#R!&R$0RA0R#& -LMTp@ 0`00,@8T0 $4T0P8 $4P,0 0,0T0$84 00 0,   00300 000/ 000008T0 $4T0@8$ 4X0@@ `0 <P   006    0060000 0S  <A00000  006 0060 0060@006 000 00608T0 $48PT0$ 4 -LP 8 p-LM@P`  |(0tL0 P8 T`0 X0h  $8T4 00 \0pph8T@:8 0-(0PL@ F 0ES |77H7<7 L0"S 00 L0"S&p L0"S 8T0 $408$;T 80% 8T0 $4V>8$0T 8!a0 -LMTp@ 0`00,@8T0 $4T0P8 $4P,0 0,0T0$84 00 0,   00300 0 00000$8T0 4& 8T0 $4T0@8$ 4@ 006 0060 0060@006  0060T08$ 4@00000000006 0-@L8T0$ 48T0P $4$0 S8T0 80 -LP 8 p-LM@P`  tm~(0lL0 P8 T`0X0 $8T4 00 \0pph8T@:8 0-(0PL@ 7 0ES 7 77p7 L0"S 00 L0"S p L0"S 8T0 $408$;T 80% T0 -LMTp@ 0`,@00 8T0$4 P8T0$4T08 $ P4,0 0,0T0@8$4 00 0,   00300 0 0000000000000000066 -LP X8 p-LM@P`  t}(0lL0 P8 T`0X0 $8T4 00 \0pph.X8T@:L8 0-(0PL@ 7 0ES  7$ 77 7 L0"S 00 L0"SDp L0"S 8T0 $408$;T 80% N0 -LMTp@ 0`00,@8T0 $4T0P8 $4P,0 0,0T0$84 00 0,   00300 0 000008T0 $48@T0$ 4@@@DT 7` 7` 7` 7 7` 7` 7` 7` 7` 7` 7` 70 7` 7` 7` 7@ 7` 7` 7` 7L 7006000600060006006 -LM@8$T 08 -LP |8 p-LM@P`  t|(0lL0 P8 T`0X0 $8T4 00 \0pph4|8T@:p8 0-(0PL@ 7 0ES 7 7 7p 7 L0"S 00 L0"SJp L0"S 8T0 $408$;T 80% T0 -LMTp@ 0`00,@8T0 $4T0P8 $4P,0 0,0T0$84 00 0,   00300 0 00000T08$ 4000  00000000000066 -LKP Ļ8 p-LM@P`<  t{(0lL0 P8 T`0X0 $8T4 00 \0pphiĻ8T@:8 0-(0PL@ 7 0ES 78777 L0"S 00 L0"Sp L0"S 8T0 $408$;T 80% 0 -LMTp@ 0`00,@8T0 $4T0P8 $4P,0 0,0T0$84 00 0,   00300 0 00000T08$ 4000  00000000000066 -LP 8 p-LMP`@t  {(0$L018P0 0T@?>C2@0 0 X  8@ RE R T0$8 40 \ph]$8T0 4`X0  8T0 $4T@8$0 88T0 $4 -0$8 T8$08T 8P0X0 T0 $840 S  @ )0$8 T8P08T@:8 Q-L Q  -LM@8 $T04@+Qm &Qk X0` ` 0A$S%H7X7X7X7X7X7X7H7X7X7H7X7X7X7X7X7X7X7X7X7X7X7X7X7X7X7X7X7X7X7X7X7X7X7X7X7T7)&Q,*0T$8 88T0 $4 p 0$8T 8@0&S 8T0$ 4*98$T 8$8T0 4P, $08T 8,0 T 0-@L8T0 $408$9T 8PD$8T0 4 P }U0 p-LM(0@`PH 0BS \7|7(7$7 L0"S p'+p L0"Sp L0"S 8T0 $408$;T 80% 0 8T0$ 408$9T 8p p-LMT`0 P0 ,08T0 $4T0@8$ 4 ,00,0 00300 00000pX000 0 000 00000000 00600000S p8T0 $4T0@8$ 4@ 00<000006 -LM 0T@園P  @%#,00R0S ? B:Z p-LM@P` y(0L0 P8 T@00X0( `R phy $8T4 00 \0pphB:ؼ8B: 0-(0L@P0  L0"S0ESP77,7d70%,00p00wC: -LM@8$T 1<8 0- 0@ L|PP  0?.C5BBT@ 00S$ P88pC: p-LM@P`0S  x( |L 0PT`8000X0 $8T4 00 \0pphbx8T@:8tC: -(0L@pPA L0 S?0BS@777T70% ` V 80T$ 8 0$8T 8}8$T0 4 b 5ZvC: -$0Tp @0 `0 ,@L8T0 $4T0P8 $4P,0 0,0T0$84 00 0,   00300 0 000008T0 $48@T0$ 4@  006 0060 0060@006  0060 P x P8$T0X 4000000060008$T0 4 pC:8 -LP ,8 p-LM PL5 3S@`* L5 3S?  _w(0L0 T`8 0P X0 $8T4 00 \0pph\,0P0? 0P0 ,8T@: 88 0-(0PL@ 7 0ES T"7t"7 "7"7 L0"S 0im0 L0"Sp L0"S 8T0 $408$;T 80% :0 -LMT` 0P00,T08 $@4 ,0 0,0T0p8$4 00 0,  00300 0008T0 $48@T0$ 4@ 000 00000000 000066 -LM@8T0$ 408$0T 8 -LP \8 p-LM@P`  txv(0lL0 P8 T`0X0 $8T4 00 \0pph\8T@:P8 0-(0PL@ 7 0ES %7%7%7D&7 L0"S 00 L0"Sp L0"S 8T0 $408$;T 80% _0 -LeP 逽8 p-LM@P`V  tu(0lL0 P8 T`0X0 $8T4 00 \0pphꀽ8T@:t8 0-(0PL@ 7 0ES '7'7|'74(7 L0"S 00 L0"Sp L0"S 8T0 $408$;T 80% 0 -TP0 @0 ,0L8 T0$p4T08 $4,0 0,0T0`8$4 00 0,   00300 0 00000 00000000 000066 -LM@k$8T 088$T 1<8 -LP 鼽8 p-LM@P`  t+u(0lL0 P8 T`0X0 $8T4 00 \0pph꼽8T@:8 0-(0PL@ 7 0ES *7+7*7x+7 L0"S 0AE0 L0"Sp L0"S 8T0 $408$;T 80% 0 -LMTp@ 0`00,@8T0 $4T0P8 $4P,0 0,0T0$84 00 0,   00300 0 00000T08$ 400000000@000066 -LP 8 p-LM@P`  xgt(0pL0 P8 T`00X0 $8T4 00 \0pph8T@:8 0-(0PL@ 7 0ES .7(.7-7.7 L0"S 0|0 L0"Sp L0"S 8T0 $408$;T 80% M0 -LMTp@ 0`00,@8T0 $4T0P8 $4P,0 0,0T0$84 00 0,   00300 0 00000T08$ 4 00000000 000066 p-LM 0`0@Ps 0?.AB"s(0L0 P8 TP00X0T0 $840  \ \0 `0  ph&,phs$8T04`D:D:8D: 0-(0PL@ 7 0ES P17p171717 L0"S 00 L0"S1p L0"S 8T0 $408$;T 80% ;{0 -LP (8 p-LM@P`r  s 0?>C2@0( L 0P80T` 0h0X  $8T4 00 \0pph(8T@:8 0-(0PL@ 7 0ES X37x37$3737 L0"S 0(,0 L0"Sp L0"S 8T0 $408$;T 80% 0 -LMTp@ 0`00,@8T0 $4T0P8 $4P,0 0,0T0$84 00 0,   00300 0 00000T0$8 400000000006 0006 -LM@u@0 S 8T0$485T$8#8 88T0 $486T$8#8 88T0 $487T$8#8 88T0 $4 0 08$T 8 -LkP 頾8 p-LM@P`\  xr(0pL0 P8 T`00X0 $8T4 00 \0pph꠾8T@:8 0-0BPL@ S 7777\7787 L0"S 0 L0"Sp L0"S 8T0 $408$;T 80% -LMTp@ 0`00,@8T0 $4T0P8 $4P,0 0,0T0$84 00 0,   00300 000D 00000$8T0 4( 8T0 $48@T0$ 4@  0060 @  006000600600068$T0 4     -L}P 8 p-LMP@`n  q(0L0 P8 T`0 X0h 8T0 $4X   0\\0 pphL'AL' 0A8T@:8 0-0BPL@ S ;7;7h;7<7 L0"S 0 L0"Sp L0"S 8T0 $408$;T 80% -LMTp@ 0`,@00 8T0$4 P8T0$4$08TP 4,0 0,0T0@8$4 00 0,   00300 0 00000 00000000 000066 -LP 08 p-LMP`@  >p(0L0 P8 T@0 X0h T0 $840  \T0 8$4 0\ ; \ @0\ : \ \0 `0  php$8T04`08T@:$8 0-(0PL@ 7 0ES 0?7P?7>7?7 L0"S 0260 L0"Sp L0"S 8T0 $408$;T 80% 0 -LMTp@ 0`,@00 8T0$4 P8T0$4T08 $ P4,0@0,0$8T0 4  00300 0 000000S$ S000 00 0, 00006 0006S00 000T0$84 00<000 - LN5 Ó0 ?0 0 夈P 006: p-LM`@P6o0 R %( L 0P80TP0 0h X0( Rp pho $8T4 00 \0pphoF:bcF:l8`8B: -1`LQPp@V(0Q 0GS 4C7C7C7D7 L0"S 15L0,S 5 `8 T0$48@T0$ 4@@ d0h 0Sd0P0d@p L0"S0%  nbc7|8F: -LMT0T`SPJ 000,8(!T0$4T0@8$!4p,00,00S ,0 00 inT0$8 4 0008T0 $4T0@8$ 4@ 000 00000000000066 h,:@BG:N7 p-LLMd@KP`L 0+H0 70( 4K P D0    p 0- PL004@@@0 0-LPM`@KPL 0$0 04K0 p-LLMdPK`@L L0L 0S<0#0H0 0( 4KPD0[#Sp0 p-LLMdPK@`L{ 80\0(0 04K ;(0 (04KH P 80 4[0p0 -LLMP `@8    @TlKp L> 0P0 +00 5KO @{x- p-LLM@0PS@ Q S 0R d`KL 0T4K0 (T;0H (0 BTP@@p@@p 0-0LS P* 3 @/00@ D((0 -L M`F 0S ,2*@RP jP0@00TppWPd T@ 3T PX(P@,p P p, 0P0 P1p, Y0@S0PCj!TXPXP04P0P04P0T  0 KjoG:H:0H:PH:pH: -pL` 08j4jP@Q UP)jU@t$j0 `j Pj Q @j,hj0j jH:t:P9p:,9:: :H: 80R00  ( ,100 !0 $1(!(!9G:G:G: p-LM80@080 KP80  80080">P<80080p400 40 ` HPP @ip Pp iH:I: -L@D0P0P i000DPHp 0 P aP<0`V"0 00`00  <0`V pi,I:DI: 0-@0PSL  0u0S< Vi0000L0 R dI:T0[`0I -LLM^p0`@0$N(lKˠPˠDL @ ;40 00 505K11LcQ aR#^T@ R P6 @? R Ve0P00(@?>11LcQ aR#^T@5; 0 400@PDT 0Q l0 400?>11LcQ aR#^T@:#:Pp'@?>11LcQ aR#^T@003P0H@?>11LcQ aR#^T@00?>11LcQ aR#^T@ 0BSP rࠓ@U?>11LcQ aR#^T@0P06 @?>11LcQ aR#^T@:#:Pp'@?>11LcQ aR#^T@003P0H@?>11LcQ aR#^T@ʍI:I: -80L`Q Pp@?>11LcQ aR#^T@0P0`@?>11LcQ aR#^T@8#8P0X@?>11LcQ aR#^T@pPP@?>11LcQ aR#^t@P pH@?>11LcQ aR#^T@p P@@?>11LcQ aR#^t@ p8@?>11LcQ aR#^@0P 00@?>11LcQ aR#^T@0p0 @?>11LcQ aR#^t@ Pp @?>11Lc QR#a^T:@#:04!Rp7p7t7t7t7P`@?>11LcQ aR#^T@4P0X@?>11LcQ aR#^T@pPP@?>11LcQ aR#^t@P pH@?>11LcQ aR#^T@p P@@?>11LcQ aR#^t@P p8@?>11LcQ aR#^T@p P0@?>11LcQ aR#^t@ p(@?>11LcQ aR#^@0P0 @?>11LcQ aR#^T@0P0@?>11LcQ aR#^T@40 P @?>11LcQ aR#^T@0bPp@?>11LcQ aR#^T@0P0`@?>11LcQ aR#^T@8#8P0X@?>11LcQ aR#^T@pPP@?>11LcQ aR#^t@P pH@?>11LcQ aR#^T@p P@@?>11LcQ aR#^t@P p8@?>11LcQ aR#^T@p P0@?>11LcQ aR#^t@0P p0 @?>11L cQaR#T^@P?I: 0-L@P0S@ @0:P -LLM@pPl`KL8 000 Pp  )05KQpP L0W  ?cU<0X0Q00SL0005K0' p-LLMdPK`@Loh@K$ 81 0C# #Ƞ#gKfKhKe0KR #<1#̠##DdKcKb@Ka0KPp KlK-0l 8R*p00S@,@P L0p 0p00l00  @^|dgDJ:LJ:0$9XJ:؅7hJ: -LMp`l PD:0@h0p@t@l`P@00 0`0x0 @: h  747 -LMP@ 00 q`Z0  0 40S0,0 iE0 44 0-P@Ll:0(0 0,0o0hr 0-@L'0p 0RP0h0h -00 ^ 1 <1D RD0  ! !: -R0 0c BSR48 R p-@P`x BRpR0 BRRR` `!  O- Y I* Xb$\(  O-`Q* @@ P@ @Pp$DL%T\ @pP$HH @ PpD%\TP ` RPb#\in4_cksum: out of mbufs p pgQMW@PФP``$($,Q@Qx       x         @Q@ Q x        Q0@cA@0  0  0  Q@A 0Q@Х@PP484<  0  )?) 0  )?)^18#811 d R R q000 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 200 R 2 R 2 R 2 R  2P00 R@A0P0A Rbs_notimpl_%s: args at %p-(O Z@mmap@r_1@r_2@r_4@r_8@w_1@w_2@w_4@w_8@rm_1@rm_2@rm_4@rm_8@wm_1@wm_2@wm_4@wm_8@rr_1@rr_2@rr_4@rr_8@wr_1@wr_2@wr_4@wr_8@sm_1@sm_2@sm_4@sm_8@sr_1@sr_2@sr_4@sr_8@|c_1@yc_2@vc_4@sc_8Hcc2-@@Pr?0RW` <77$707` B`p Bp` B`RE0C`R9`ԑ7777777ȑ7` B`p Bp` B`p Bp` B`p Bp` B` B`p @R B`p R BRR `x7777` B`p Bp` B`p RpPP2-B@P00O0RW` 4777(7` B`p Bp` B`RE0C`R9`̓7x7777777` B`p Bp` B`p Bp` B`p Bp` B` B`p`p@R B`p`pR BRR `p777|7` B`p Bp` B`p RpP2-D@P?O0RL` 7777` B`p Bp` B`R:08`R/`긕7d7p7|77777` B`p Bp` B`p Bp` B`p Bp` B` B@R BR BRR `07T7H7<7` B`p Bp` B`p RpP% $0000% $00000& $0000 -L R l\000Х000 R 0 4 8 <0 R  R000Х000 -L R l\000Ѥ000 R 00#40#40#40 R  R000Ѥ000R 0 R0#400#8 80 RR 0 R 4800 R## 8##,0R0@-0#88@$HHP%XX,ȠȌ8 R0R0@-0P8$#H$8#0@8%#X%8#0P 8,#, 8#08.#.8#0 R0RC-R :08PHpX hx R R:x08PH R R:080 R R:0 R0#40R}A-R:#H#8##H$%h%X%%h&''x''(,,,,.Q R R :#h#X#%h&$$x$'( R R:0 R#X#H#$X%0 R:0@ R480Hcc0-2P? @P4@54?3P0p-2`? h@@PPP`5P65?3`pp-2`? @@ZJJJJJJJJJJJJJJJJJJ }J xJ sJ nJ iJ dJ _J ZJ UJ PJKJFJAJ=Q:Q:Q:Q:Q:Q:Q}:Qx:Qs:Qn:Qi:Qd:Q_:QZ:QU:QP:QK:QF: QA: Q<: Q7: Q2: Q-: Q(: Q#: Q: Q: Q:Q:Q :Q:QA ? QA ? QA > QA > QA = QA = QA < QA < QA ; QA ; QA : QA : QA 9 QA 9 QA 8 QA 8 QA 7 QA 7 QA 6 QA 6 QA 5 QA 5 QA 4 QA 4 QA 3 QA 3 QA 2 QA 2 QA 1 QA 1 QA 0 QA 0 \aBC`B0QA 0 Q@-: R (2 R R -PPPP RrPP B PP R  R00 B R000Ѥ000l\000Ѥ000 R \6 R B0-.40P<$DL%T \,Ġ̌8 R0 .Ġ̌ RA R B0-.80P8$HH%X X,ȠȌ8 R0 .ȠȌ RA R B0-.<0P4$LD%\ T,̠Č8 R0 .̠Č RA R'0 R- RP1P P1P RrP1P  B P1P B  R010 1  B R0q0`0q0`0q0`\0q0`0q0`0q0` R 0\6 R B0-81, Ġ%̌T$\D#L0P  R0 Ġ01#̌  R R B0-81, Ƞ%ȌX$XH#H0P  R0 Ƞ01#Ȍ  R R B0-81, ̠%Č\$TL#D0P  R0 ̠01#Č  RggN  0O   ! -- -i?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~?Ѫ?????????????????????????????յݯ????  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~U'\'d','P<%t''P<%''R'P<%$'d n;0&AvQkkXaMq^h,`@yFgKrޔԘJk*OņךUfϊDx%K]?!HpcwucB0 mL5&/ᾢ5̈9.WUGz+2ўfD~T; ʌ)k<(yv;VdNtے lH]nCĨ917Ӌ2CYnڌdҜI%ϯʎGooJr\$8WsQ#|!>ݖa B|qؐ_jiX':'8+3"p3-"< IxPzY e1ƄÂ)wZ{m:,Pieee80211_node_attach  0  ^/  f  ^/  ^/ ^/ f ^/ ^/PP59595959595959595969 69969 69(69869D69L69T69\69d69h69p69t69x69|69ieee80211_newstateP79TX79U`79Sl79Rx7979F79I79V79E7979G7979B7979X7979D7979 79779@89589892896 89(8980890889@899H89P894X89`89h89 p893x89h89@89898989"89 89!8989:898918989H89@89J89K99A 9999C99 $99,99@,99h89p89f499g<99`D99aL99bT99c\99dd99el99ix99j999999@@@ @@ !" 1:7 25@608 943 @ A BC D@EFGHIJ K RSTU V X`abcdefgh ij:998n93990 99G(D 99$99!9908990d994099`99RD99UL99p99T99|99 P!:59X99R9999997996ؽ979799 99%9+97299l97996997L8996 R90,99@99X99!T:9:96\:95h$9t87x :9d:9p:9l8R9R`:97|W97:9A :9H$:9C(:9J,:9K0:94:98:9@<:9I!9@:9ED:9EH:9L:9P:9T:959X:97X :7\:9#:`:9$:0'd:9h:9!l:9p:9.t:9x:97B8K97*|:9":O:9\"9`:9J:9h`87v:9l897X:9z:9:9:9:9(97:9B:97l96:9|969E:96Pf96 :90:9G$:9::97H8Z:9E\:9:^:V:9w:9:97:9Kgpqrstuvwxyzo@+++<+ccƄ||ww{{ kkֱooTőP00`gg}++Vb׵櫫MvvEʏ@ɉ}}YYGG 쭭AgԳ_꯯E#Srr[·uᮓ=j&&LZ66lA??~Õ\44hQ4qqsثS11b?* RǕe##F^Ý(07 / 6$=&i''NͲuu t,,X.4-6nnZZ[RRM;;vaַγ}{))R>q//^SShѹ,` @ȱy[[jjFˍپgK99rJJLLXXJυkл*媪OCCMMU33fEEPPD<KKܽa ppB>>|ĵqffHHaa_55jWWйiX':'8볘+3"iip٩3-"< I·UUx((PzߥY  ڿe1BBhhAA)w--Z˰{TTֻm:,ccƥ||ww{{ kkֽooޱőT00`PggΩ++V}׵bMvvʏEɉ@}}YYGG AԳg_Eꜜ#Srr[u=&&Lj66lZ??~ÃO44h\Q4qqثs11bS*? ǕR##FeÝ^0(7 / $6=&''Niuu ,,Xt4.6-nnܲZZ[RR;;vMַa}))R{>//^qSSѹh, @`y[[jjԾˍFg99rKJJLLXXυJлk*OCCMM33fUEEPP<!KKݽa܋ pp>>|Bqff̪HHaa£55j_WWiІX:''8+"3iiһ٩p3-<" ·IUU((PxߥzY e1BBhhиAAÙ)--Zw{TTm,:cƥc||ww{{ kֽkoޱoőT0`P0gΩg+V}+׵b׫MvvʏEʂɉ@}}YYGG AԳgԢ_Eꯜ#Srr[u·=&Lj&6lZ6?~A?̃O4h\4Q4qqثs1bS1*? ǕR#Fe#Ý^0(7 / $6=&'Ni'Ͳuu  ,Xt,4.6-nܲnZZ[RR;vM;ַaֳ}γ)R{)>/^q/SSѹh, @` yȱ[[jԾjˍF˾gپ9rK9JJLLXXυJлk*OCCMM3fU3EEPP!KKaܽ pp>|B>qĵf̪fHHa£a5j_5WWiйX:''8+"3iһi٩pَ3-<" ·IUU(Px(ߥzߌY  eڿ1BBhиhAA)-Zw-{˰TTmֻ,:ƥcc||ww{{ ֽkkޱooT`P00ΩggV}++bM櫫vvE@}}YYGG A쭭g_E꯯#Srr[u·=Lj&&lZ66~A??Oh\44Q4qqsbS11*? RFe##^0(7 / $6=&Ni''Ͳuu Xt,,4.6-ܲnnZZ[RRvM;;a}γR{))>^q//SSh,@` yȱ[[ԾjjFgپrK99JJLLXXJϻk*O媪CCMMfU33EEPPxD<<%K㨨QQ]@@?!pH88c߼wuBc!! 0mҁL &5/__5DD.9WU~~zG==Ȭdd]]2+ss``OODf""T~**; FF)kӸ(<y޼^^ v;dV22tN:: II Hl$$\\]½nCשּׁĦbb917yy2CnY77ڷmmd՜NNI੩شllVV%ʯeezzG鮮oպxxJo%%\r..8$WsǴQ#|tt>!KKaܽ pp|B>>qĵ̪ffHH£aaj_55WWiйX:''8+"3һiip3-<" IΪUUPx((zY  eڿ1BBиhhAA)Zw--{˰TTmֻ,:cccc||||wwww{{{{kkkkoooo0000gggg++++׫vvvvʂ}}}}YYYYGGGG𭭭Ԣrrrr&&&&6666????4444qqqq1111####''''uuuu ,,,,nnnnZZZZRRRR;;;;ֳ))))////SSSS [[[[jjjj˾9999JJJJLLLLXXXX着CCCCMMMM3333EEEEPPPP<<<>>>ffffHHHHaaaa5555WWWWiiiiَUUUU((((ߌ BBBBhhhhAAAA----TTTTPQSeA~ä^':k;EXKU0 mvv̈%LO*ŀD5&bIZg%E]u/LFk_zmYR-!tX)iIDɎjuxyk>Xq'Of ɴ:}Jc1`3QESbwdk+XhHpElޔ{R#sKrW*Uf(µ/{ņ7(0#j\+ϊyiNeվb4ъĝS.4U2u9 `@q^Qn!>=ݖ>FMT]qoP`$C@wgB谈8[yG |B| H+2pNrZlV8ծ='9-6d !\hT[:.6$g WҖO aiKwZ *C"< Nj򹨶-ȩWLuݙ`&r\;fD4~[v)C#hc1cB@" Ƅ}$J=2m)K/0R wl+pH"dGČ?,}V3"NI8ʌ6 Ԙρ(z&ڤ?:, xP_jbF~Tؐ^9.Â]|i-o%;ȧ}nc{; x&Yn쨚Oen~ϼ!ٛ6oJ |)11#?*0f57NtʂАا3JAP/MvMCTMўjL,QeF^]5st.A ZgRے3VGmaךz 7Y<'5ah,4$8_@r %⼋I<(A q9޳ ؐVda{p2t\lHBWЧQPeA~S^':k;EXK0 Umvv̈L%O*D5&bZI%gE]u/LFk_眒zmYRڃ-!tXiI)ɎDujyx>Xkq'Oᾶ f:}Jc13Q`SbEwdk+hHpXElޔ{Rs#KrWUf*(µ/{ņ7ӥ(0#j\ϊ+yiNe;b4ĊS.4U2u 9`@q^nQ!>ݖ=>ݮMFT]qoP`$֗C@̞gwB谽[8y |GB| +2HprZlN8Vծ=9-6' d\h!T[.6$:g WґO aKwZi *"4$8,@_r% I<( A9q ؜Vd{a2p\lHtWBQPA~Seä':^;kEXK0 Uvm̈v%LO*5&DbIZ%gE]/uLFk_mzRY-tX!I)iɎDujxyXk>'qᾶO f}:cJ1Q`3SbEdwk+HpXhEޔl{Rs#KrWUf*(/ņ{7ӥ(0#j\ϊ+yiNeվ4bĊ.4SU2u 9`@q^nQ!>ݖ=>ݮMFTq]oP`$֗@Cgw谽B8[y|G B| +2HpZlNrV8=-6'9 d\h![T6$:. gWҖOa wZiK *"$8,4_@r %<(I A9q ޳؜Vd{a2plHt\BWQP~SeAä:^';kEXK U0mvv%LO*&D5bIZ%gE]u/LFk_zmYR-X!tI)iDujxyk>X'qOf }:cJ1`3QbESwdk+pXhHElR{#srKWf*U(/µ{ӥ70(#j\+ϧyNieվb4Ċ4S.U2ኤu 9@`^qQn>!=ݮ>MF摵Tq]o`P$֗齉C@gwٰB8[yȡG ||B 2H+plNrZV8=ծ6'9- dh!\T[$:.6 g WҖOa ZiKw *h8,4$_@r %(I>>>KKKKyyyy xxxxZZZZݨ33331111YYYY''''____````QQQQJJJJ ----zzzzɜ;;;;MMMM****뻻<<<m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxqg jgrn<:ORQhك["(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDl؞]|6*)bp0ZY9Y/1 g&3gXhJd . ۤOHGɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~[ 1Ѭߘr/Ḗ~&jE|,G$l iciNWqX~=t XrX͋qJT{YZ90`*#`(yA8۸y:`l>w'K1/x`\`U%U攫UbHW@cj9U*4\̴ATr|*oc]ũ+1t>\3֯\$lS2zw(H;Kkē!(f a!`|H2]]]u#&܈e>#Ŭom9BD . Ji^Bh!la gӫҠQjh/T(3Ql n;zP;*~ev9>YfCoEå}^;uos D@jVbNw?6r=B$7H ۛIrS{y%P;LylO`@ž\^c$johSl>9oR;Qm,0DE ^J3(fK.WtE9_ ӹyU 2`yr,@%g̣饎"2u<kaP/R=2`#H{1S>W\o.ViB~(2gsUO'[iXʻ]=!lJ[-ySeEIҐK3~ˤAb Lw6~д+MەqՓkю%ǯ/[{AI~-%^q h"W6d$ cUYCxSZ٢[} Źv&ϕbhAJsN-GJ{RQ)S?Wƛv`+t恵oWk *!ec.4dV]-SGjnpzKD). u#&İn}ߧI`fqilRdVឱ¥6)L u@Y>:䚘T?eB[k?ҡ08-M]% L&pc^?kh >\D}W7: P tAu8/;21>8TNmO Bo ,y|$ryVw.?rU$qk.P̈́GXzt}K:zfC cdG27;C$CMQe*P:qUN1w_V5kǣ;< $Y,n<pEㆱo ^*>Zw=Ne)։>%fRxL.jxS<- N=+6&9`y#RnfE{7(2åZl!Xeh;/ۭ}*/n[(!pa)uGa0a4c\s9pL ު˼,b`\ndi#PZe2Zh@*<1! T_~}=b7w-_h)5ǡޖXxWcr"ÃF T0.SHُ(1mX4a(s<|J]d]B> EꫪOlOBBǵj;Oe!AyMjGKPb=bF&[$ti GV[ Htb#*BXU >ap?#r3A~_;"lY7|`t˧@n2w΄PU5ai Z .zD4Egɞs͈Uy_g@Cge48>q(= m!>J=+hZ=@&L4)i Av.khq$j 3ԷCaP.9FE$tO!@MpE/f m1'A9UG%ښ ʫ%xP()Sچ, mbhiHפh'?Oz|Ϊ_7әxB*k@5 ٫9N;VmK1f&tn:2C[Ah xN جV@E'H::SU kKмgUXc)3VJ*%1?~^|1)p/'\,(H"m?H܆AyG@n]Q_2Տd5A4x{%`*`lc´2Of#k>3b $;" r(-Exb}doITH}'>AcG t.no:7`L knU{7,gm;e' )̒9 i{f} ϑ^و/$[Qy{;v.97yY̗&-1.Bh;+jLu.x7BjQ满PcKkؽ%=YBD n *Ngd_ڈ鿾dW{x`M``FѰ8Ew63kBqA_^;Z4ٷ,Q+:Ֆ}}>(-}|%rZLZq)GW;()f(.y_xU`uD^mm%adâW<'*:m?!cf&(3uU4V<wQ( gQ̫_QM08bX7 z{>d!Q2Ow~㶨F=)iSHd$m-if! FEdlX [@X̻k~jEY:D 5>ʹrdfGof,ҏ"W##v215VbuZ6ns҈bIPLVq z2E{Sb%ҽ5iq"|˶+v>S@`8G% 8vFšw``u N˅؍芰z~L\HjiԐ\-% ?2aN[wߏWr:j?$.Dsp"8 1).lN!(Ew8fTl 4)P|ɵՄ? Gy@0 /kz%?/?!M@`Iɟ'Կ@uИcnafŽ"o;h(Yy#P_w@CV/|-ҢɡHl4ma/T"2*kT:V"AӢ@f/9/Mҹ-?JDvR7,YQoz Zh{.T"5Y/mKdPIf-徐"3;䎴]4K@E?1.eUʱծ-mԢP @"8On ׿r[O/LVSTIiFXEŅc]ՊSW9j7=T*_}x:vbj Bz)^'rgP8ƌDŽZ*'JkѢ*V`C u\B&Ʉq-ls5&5 M{n0f&%HVV^c ϲc|E pPr(pH# yM;-AB G&LjMG\^ |Y#јr8S#/nqFnEV 9q +A|iCHy}B{BIZݿe\ [ ~iC?9zaz UQry吝5rNcZպ60ę _}֡{/6Y DYD̃Aѱ* ;{ B[A%zzӤ0XޘN?wiy{$[Ĭ%5P_aT1bcKU !h]Yfsc=4·~!+g\ab906;Wd/`:5F- 'zy㠌l0^7%oo;j tE'4:NiOM>dY58EfCr3c%N? (Υ'R¦սTUdpfM w&ۄgC!`X0TroSUGڿ]bVhkʃ;n-Ӧ\= wL3{9+^S_aodC x^c"&gI{ڷ"%-U^7rRyL H[k0 cq/޹ S E!5(T<)c)A|-nRPf4,0P1`sY&D\dwR3A+ٺ|o!PaH?ek«dv&4{^% ;MM1$~I,;jx`]sVz\/1Co0TyXR^/2zj0>՚1B°I #ڸ(0q_`ɣaM/Ǚ."płNؼ40y;'ƸaiH?;(ZC/v7ܱӧßn>ƼB7Q(heRwj-K'5.n\ )^XOX{iT̨g&H`K`8# ~8lI `s5GƱVL>#8d^BFzk Od^AE#\;]>rC|m~ll9`qpsv#E@]%=`GK6DήPQH<p}}d^(O= &g.yr?U+HԼ?^!@WNFRWs3NɷdŸW1O g_?@k{C=K۵cUȗn-J(JqoCCl< _P/~׿PZG.Q>pX.0_|r *,]I鎸P'WIoyR}}Yr@EEt]>uOiVA#. '`vteyvvwHNma}/ 4H<0(Ow Vܒ M"7)}V'|@|硴f^aÝ <є`AFv\;x,WGl"}NC~8<=Q8d{h'فI]j~vh]9K9 ;#Im<Eub'z\aBΒ~Brrp }ȡ[(Ob<51)BSjO[}m(Ki\j#MŌ?,-ҖXRg[HJI \EkӉ7`:SRqDIK @sg4|~q6UO/Т`?mPьGnU?墼38Wg} =3{r3O̫]ňv{{uWBdBc+ri/n+_mazgaq%9̸L!gуb>ܷν8\ =Dmn`I:T`H'W+8$ ږ%Eh;}E `P/(b4 ٠m+1+dZ0RXBA\1>26F3S75 {s{OJWdCQz(~c5_ yCdcdJ$_(͸O@C " 0 O7-{$MgQLq_-_d !S^>'_aB%rqK=;&o~~TLmDl߫I&Ǡ36~?Pa w8Pr.PwWFgOT3ɏ1 i5M\=fȦ[]oڑo/"F}F9mOCCN!и  ?X(>nH&p׋wt|% - y#;(8itb߷@!{7Ȋ@ YVvO@/{U MVi35'#WȯVeka^u˅nwU2?-ɿ[%;з$;mc fÀ(82 Tɪס2Zb,gTzuw11&o6F HjyZVLj~CRv/ t,t* M|k .TA5B=!&|,aRe1i%& !\1cr ^Iy p1 d>>̶Ոî 0rlqn/kءDVÈ9/ű1(x⤣2}o~X$Ū{s0a!-!)۳*)e\,0?Б\,ԩT _w:^VxV޾\!uQųåҶw#)Ei/z毲p[v F98/gsD)k)/Ifingӛ/~p%Q^$Slj>!DYܷ)eyCy9A+MWN )zkS< ~U3rŅ?~  ~tn,fy3jXDD1Zs"*ˁc8:$zi HIĀ@8HުL H_%A@N$A UeQr% 9jyMc@hV 틕Z Vqק)N-fcqw*7 5Wa"ɠBր[t!h!hl iwW~@PճMװx QV$AV ʔUWnྵa$ XK'aU{whkldMDfd~i/IO70j5,s@IvM;B(HDLns) _ɋ}oaOw.+rץ<}+FYYEEهTNoHm| ǥcs_DVj͈prͳ]ny` E`1©\1BN"r\,rN@%/N2g@#x\n܃"ukMxnXO DH?{vw#Vu*F_( +8=6 JRft;QZylu eX&hJpFS(l\v0k)h76*g$ k%ֿh,DUueI40" WIbuU~bڨv^FESGml,gHL|3ەCh\SU2` ߝWc9^28aI37~^b<#NygCHKJf-ۄoH Ja)Yfc(` 0qt&@3/C~A^ l( ؒ0~of˜os*`ژ46K-%#= %IH6Jo8C@TzWOpA:Z„TU|5YŗZ:G:%Sj~=eI&TwQ[P]vlDȨ!帊iX`[ŗY)L;]J5ULkD$5鰽bעT/I18T(q)9H[/u@g+3-fVo*ɛ`( ')dMP˲,\26K_A !PNhذy\CPIMAC8wn\e0Rԋ@+>`xT7}02m-yyS"wuXȃoxkcZ\3]ùzv٣Byqj3ƚ`'PC=+mvN%ύHf6AN( aϩI=߹_d: }+p?PO+Zbbyj.H@,Z@"ғ-ES4n)olIIBr~V>olbfLTq*+9)XLVRf.S9v.i硦>iFt+LVvuOx39]O#2]2=&K/~~<O^?vf)o=E4ӷ+4grN=U"g`k8=ü0}8QcÐӝXyTGָaYwSW-XVcNx.F~eyUڑ0@5㶼P?!@=LXI6QpӱڍyKoqK 0ݻ맕d5w$,ϩ/ tцB*v:-7ޚ, )p@ :$7ѴyN] h1 HZ޻Bf1畏?r 3uQB}\cmd!@ WS1zݨ]3CoFq"8ԚέiGb[UgfN G[oLĎnrWxzdD]Ջ` l_9 ]c2֋~ pIPӻߘ)* mS~H~X.t;/RG'~[!<8zvOB9`55'{ɸ6g {pqT3^-ZId, =4pBwbO&Ҹ$d%FN`7>͕xE_{ ۫v"{.1ן%$r_m L=mPO%os#(ĴyI%4aĘnzn|l6AT޾'VAJJ{` ,8I%vK$%Gv XY f 0NndQ& #Phꃢ H!x-ML.RN8D( `hz=Skc|j9{Б/Uڅ?AZX_f ؐ53eiEVmv° GJBnI[#Q")yq~ ruo7ӎbwO$26󦻬^lW%㽨:Y*F                              A@@@A@@A@@@@A@@@A@@@@@@AAA@@@@@@@@@@@@@A@@A@@A@@@A@A@@A@@A@@A@@@@A@A@@A@AA@AA@@AA@@@AAA@A@A@A@A@                              @@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@                                  ##%%&&))**,,//1122447788;;==>>@@CCEEFFIIJJLLOOQQRRTTWWXX[[]]^^aabbddgghhkkmmnnppssuuvvyyzz||        0 0 0  0 0  0 0  0           0  0 0 0 0  0  0  0          $$  $ $ $$  $ $             $$  $ $ $$  $ $                  0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0                            ((  ((  ((  ((  ((  ((  ((  ((          """"   " " " " ((((((((    """" ( ( ( ("("("("(66666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\Z H!x-ML.RN8D( `hz=Skc|j9{Б/Uڅ?AZX_f ؐ53eiEVmv° GJBnI[#Q")yq~ ruo7ӎbwO$26󦻬^lW%㽨:Y*F?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@8B-(-hW-0--Y-t[-\-l`-`- c-c-t- .(-".0--0$.|&.'.*.x+..+.t-vmmapbsyBUSYWANTEDTABLEDCLEANCLEANCHKRELEASEDFAKERDONLY ZERO PAGER1FREEINACTIVEACTIVEENCRYPTPMAP0PMAP1PMAP2PMAP3g1g1h$,9080908<908@9(9 9 9 D9 9H9L9 T9X9`9h9p9h9x9h99h9p 99p 099p `99p p99P 99P 99P @99P P99 č9ȍ9Ѝ9ȍ9č9ԍ9Ѝ9ԍ99ؽ99ؽ9܍9ؽ99ؽ99ؽ99ؽ9  9P:9P:99@99 99 99 99/ 99o$9(90/@99p ,98 @949 <949 @@949 `D949 d 949 H949 L949 P949 T9X9 0\9X9 @`9X9 `d9X9 h949 l9p9 t949 x9p9|9999 99099@99P99`99p999999999999999Ď9̎9Ď9 Ў9Ď90Ԏ9Ď9@؎9Ď9P8Ď9`܎9Ď9p9Ď99Ď99Ď99Ď99Ď99Ď99Ď99Ď9 99 99999 9 (990,99@099P49989<9D9<9H9<9P9<9X9`9d9`9h9`9p9`9t9|99|999 9999 99eqnecsccmiplvsvchilsgeltgtlenvdaiadbibedeafdfalsllsrasrrorpmzsdep0.01.02.03.04.05.00.510.0P1X1$99999Ē9̒9Ԓ9ܒ999999 9999$9,949Ē9̒9Ԓ9ܒ999999 999<9D999Ē9̒9Ԓ9L9T9\999 99l9999x9999999999 999ԓ99999(9<9ܒ999999 99l9P9x9\9h9Ē9̒9Ԓ9ܒ999999 99l9x9999Ē9̒9Ԓ9ܒ999999 99l99999Ē9̒9Ԓ9ܒ999999 99l9P9x999\9̒9Ԓ9ܒ999999 99999l99x9l9Ԓ9ܒ999999 99l9P9x99\9t9t9|9ܒ999999 9999999Ē9̒9Ԓ9ܒ999999 99VAt9P8PVA9P8VA9P8VA9P8VA9P8 VA9P8pA9P8qA9P8qA9P8qA9P8qAȔ9P8qAԔ9P8rAܔ9P8tA9P8tA9P8A9P8A9P8 A$9P8`A ,9P8A89P8`A @9P8`A L9P8`A L9P8PTX9P8A d9P8 A p9P8D |9PP8D 9P8i 9P8 i 9Q8 i 9PQ8 $i 9Q80$i 9Q8 ,i 9Q80,i 9Q8 .i ĕ9Q80.i ԕ9Q8!i 9R8 !i 9R8)i 9R8 )i 9R8-i 9R8Ai 9R8 -i 9R8Ai 9R8Ai 9R8Ai 9R8`A,9P8`A89P8AH9P8AX9P8h9t9p9|9999999999Ȗ9Ė9Ж9ܖ99999999$9,9<9D9T9P9\9d9d9l9|99999̗9ܗ999 99,981(9Ĵ1<981P9Ĵ1d9(1x99(19К9(19 9(1 9D9(1X9x9(199@````` ```999ة999,9D9h999ܪ999909P9p999̫9999,9\99Ĭ99(9T999 9 9 X9 9Ԯ9 9D9p999د99$9X9 p9 9 9 9 ̰9 9 9 9 (9 H9 T9 9 9 Ա9 9 $9 <9 \9 |9 9 9 9 9 89 l9 9 9 г9 9909L9h9|999ȴ999,9D9d9 |9 9 9 е9 9 9L9l999Ķ999<9X9l99999909L9l99999,9X999й99,9T999 99H999Ļ999,9X9t999ȼ999,9$9D9`999 9 ܽ9 9 ,9 P9 9 9 9 9 9 89 \9!9!9!9"ؿ9$ 9$$9$9$9$<9$X9$t9$9%9&9&9&9&9&89&d9&|9&9&9& 9& 9& (9& D9& x9&9'9'9'9'9'$9'@9'X9(t9(9)9)9)9),9)P9)h9)9)9*9*9*9*9*9*,9*D9*d9+9,9,9,9,,9,P9,p9,9,9,9, 9, 9-<9.`9/9090909090890`90909090 90 90<91T91l92929394959595(95H95l96979898989899<9:\9:p9:9:9:9; 9;,9;X9;9;9;9;9;9; 9; 9; 89; X9; t9; 9;9;9;9; 9;$9;@9;X9;t9=9>9>9>9>9><9?h9?9?9?9?9?9? 9?H9?d9? 9? 9? 9? 9? 9?9?9?,9?<9@`9A9B9Ch9D9E9F9G(9G<9G\9G9G9G9G9H49I`9Jx9K9K9K9K9K9K9K9L09NX9Px9P9P9Q9Q9R9S 9S<9SP9Tl9U9U9U9U9U9U 9UH9Wh9X9Y9Z9Z9Z9Z(9[H9[X9[p9[9\9\9\9]9]9]@9]t9]9]9]9]L9]9]9]9] 9]P9]9]9]9]9] T9]!9]"9]#9]$49]%l9]&9]'9]( 9])@9]*t9]+9],9]09]1T9]29]39]49]589]6p9]79]89]99]:L9];9]<9]@9]A,9]B`9]C9]D9]E9]F,9]G`9]H9]I9]J9]K9]LD9]P|9]Q9]R9]S9]TP9]U9]V9]W9]X9]YH9]Z|9][9]\9]`9]aL9]b9]c9]d9]e 9]fT9]g9]h9]i9]j 9]kT9]l9]9^9^9^,9^T9^x9^A9^B9^C9^E9^G9`@9aP9ah9a9b9c9c9d9d9e09f@9fd9f9f9g9g9g,9gD9gh9g9g9g9g9g 9g $9hL9ih9i9i9j9k9k9k9l,9mH9nh9o9o9o9o<9ol9o9q9r9r 9rH9rp9r9r9s9s 9s09sP9sp9s9s9D9L9\9d9p99999990949@99H9T99\9`99H9h99H9t999|99999999999999999\9999999$9899@9T99\9p9x999999999999999999999999999 9909899H9P99`9h99t9 999999(999999999999999999999::z:: :::::::::::@::@4:<::D:P:@3:\:@:H:d:lX::l:H::::79:::L9:`::::89::89:HT::GC::D:::: ::: :HT0:0:<:@L::89: X:\:`CGCZ)IeIl:t::ZIZIIIIII0I0PI0::I0::I0E::]I0E::PI0E:: I0E::@I  I::::@"::D:-/:::::$::<::T:l:t::: ")A::u EE:::9@&o@o @o @  @& 3BI0E@I0EHTI0E::@I0E::I0E:: I@(#0Vw:L ::` :x : :l: : :l: : : : :Pttt3V: : :V : : :8V : : :V0 :8 :T :\ : :Vt : : :s : : : :oo PM : :k&h= = s qPs&! qh: :l C,:@: d:x:a\cH3l333Ԧ33C(.} 1! 2" q wW^ a z '3#&4$eE=sdD`x5%rR+tT[fF\c--@  6&!yY]"gG;#v$bB_% & (7')8(*uU{+hH:,n-,/<.09)1iI}2jJ*3m4.?>680~9o:k;lL|=>@ApD FPQSTXY] @~8 ["$&'X4gklrdK2L8< 3H33   !"#$%&'()*+,-./0000000000:;<=>?@00000000000000000000000000[\]^0`00000000000000000000000000{|}~00000000000000000000000000000000000000000000000000000000000000ABCDEFGHIJKLMNOPQRSTUVWXYZvt1004В44$44(4  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^%% $ $ $ $ $%% %%<%%$%4%,%%d"e"`"  " %" #!#%# # # # ""*#d"`"e"+"4"""""<"C"!!a"""")"*"'"(""!!!!#@[\]^_`{|}~@[\]^_`{|}~|^_`#@_^_`#_#^_`^_#@^_`~#@^_`~^_``#_888@ `P0pH(hX8xD$dT4t L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}C#cS3s K+k[;{G'gW7wO/o_?T555d5l":":":":":":":":":":":":#: #:#:$#:,#:8#:@#:L#:XBBp@m@m @m@m@ f(  pt""(4I@@@@1` #U3UCU4QFb  w@          @     >@X@W@0@@ Q@ Q@c@c@d@eaQ@@^^^@@@<W50X5,`5x_5ti58/?9:;<=>?@ABC D E FG HIJK,L!MN-OPQRS T/U*V-W+X Y1Z2[3\4]5^6_7`8a9b0c.etuvwx yz{|}~ mMqQ@zy2" 3#6&$7/{%8([&9)]'0=}-?\./0+*1#'2#'345 6,;7.:8-_d<>| .'`0+*~5^2"@ 3#!4$#6&$7/{%8([&9)]'0=}-+?.|/01'*2'*3456,;7.:8-_d<>\ .'`|0^~-+?\0345d<>| .'`|0^~.\0345|d<>.\`0^~q,?azw&12~ "3#!'4{"(5[#-6|$7`%_8\&9^'0@-)].=+}/0$1*2*3m4%56;.7:/8!d<> bBeE hH iI jJkKlL|,?nN~aArR,sSzZyY2 "3!'4"(5{[#6$7%!8&9%!8'0-)}].-_/0$*2`@#3mM4%5@#7:/\8=+g= aAkK~xX}iIpP& eE ,; c d tsrqQ'?ljbB|oOuUv.:yY{!\"12< 3>!(4[")5]#@6$+7%-8&/9'*0, _-=^.%`/z0w123n4m5$#6gG7h8fd/ 2" 3"5%#6&$7/%8(&9)'0=-'?.^/{[0+*}]123@4#5\|6,;7.:8-_d<> 1!2" 3!4$"5%#6^$7&%8*&9('0)--_.=+1#~2#~4'@5``d\|2"#6&$7'%8(&9)'0--=.^~/@`0[{1]}2]}3;+4:*5\_\|1!|2"@ 3#!4$~#6&$7/%8(&9)'0=-'?./[0+*]1}2}34{5\6,;7.:8-_d<> eE !1@-2_ /3#!;4$":5#,6^$.7&%=8*&[9(']0), -?+'.xX%/{0wW}1qQ|2qQ|34"5`~67fF8\ q,?azw&1|2@ "3#!'4"(5#6^$7%!8&9{'0}-).-_/[0$*]1`2`3m4%56;.7:/8=+~d<>\ xje.> u i d c htnbrl'"poygk,<qf;:-[{.]}//?0=+3s4-_6w7v8z9: ;<=>?@ABCD E aAbBcCdDeE fF gG hH iI jJkKlLmMnNoOpPqQrRsStTuUvVwWxXyYzZ#6^6,$7&7./[{0]}3;:4'"6,<7.>8/? aAbBcCdDeE fF gG hH iI jJkKlLmMnNoOpPqQrRsStTuUvVwWxXyYzZ#6^6,$7&7.--_.=+/[{0]}1\|2\|3;:4'"5`~6,<7.>8/? eEzy1+|2"@ 3*#!4#6&$7/%8(&9)'0=-'?./[0!]1$}2$}34{5 6,;7.:8-_d<>\ -'?.^`~0!]/[34{2"@ 3##6&$7/{%8([&9)]'0=}-'?.<>/+*012345\|6,;7.:8-_d<> .+*/2\|4qQ@1!2" 3##6&$7/%8(&9)'0=-'?\./0+*~1}]2}]34{[5|6,;7.:8-_d<> 1!2@ 3#!4$"5%#6.=+/0[{1]}2]}345'"8;:c.d\|/? IqQ@2' 3^#!4+$"5%#6&$7/{%8([&9)]'0=}-*?\.-_/0~1,;2,;34i5"678.:d<>| /1,;`2,;`3'aAcCeElLnNoOsSxXzZ bB{cC& fF[ gG] iI jJnN}qQ\vV@wW|xX#zZyY>1'~2" 3+^!4!"5%#6/$7=`%8(&9)'-./QP01qp2qp3$4506,?;7.:8-_*d< bB{ fF[ gG]kKlLmMnN}qQ\vV@wW|zZyY1!~2" 3#^!4$"5%#6&$7/`%8(&9)'0=-'?.+*/0123456,;7.:8-_d<> mMoOpP1!2"@ 3/!4$"5%#6?$7&%8*&9('0)--_.=+/[0']1<>}2<>}3;:~4{5#|\6,'7..8d /^^[0]4``{8aAcCeE gG iIkKlLnNoOsSuUzZ cCmMrRsSxXzZ1!2" 3#!4$"5%#6&$7_%8({&9)}'0'-/?\.'/0*|1<>2<>3+45@6,;7.:8-=d][ .~/"^4'`%đ8R8 8]ؕ88ȗ8IƔ8X8J8R87@8 h8 8 8 ȕ8K8x8@#8x8x8x8x8x8 x8x8H@x8 N8 _$8ȝ8,8\ 8 z8 8 z8E8 28mJ8KJ8A8[b88068 88j88?8n&8 8555В5h5ܖ555h55(  v      W 1 Q `  5@  0 2 A@ A   @  @ @   P0 P  A   h }  } } } @  85   5  L+ L 5L2 D   O  {5o  A F  @@@ @ @AA@:F:FP 43W  !      @ @ @ @ A n@n n@n @nn@0Df @  Q k k"k"k"k"k @^z BF 9 |d55@5$5 B  w *w W UP  <1b0 0{&"79n= wF@W wn a- \5558555|5$5@ 'W W@ @EEE }WQ  k"BFFeeeZZ Z 0(4666d62V{%1" `"'`~%ZP `,866L6$6%6%6)6p/6hF F hF fF @6@A6C6 D6R6R6V6\6@@9WP P Q@url_int_miibus_readregurl_int_miibus_writereg:5g hahh! !(3P@3vK #(-2>'()*+,-./@ABCF'()*+,-./@ABCF'()*+,-./@ABCF/@ABCDEFGHIJKNMNO`abcdefghik*++,,--../-@@A&''(())**++,,-\66d66h9::::l":":":":":":": #:$#:,#:8#:!A  !@@@@7L77@@:t77 6p@:@:@:7 7X 7Q`@:t 7 7 6@:2@:3@:1 A:77 6(A:5(A:747\7CPDA:CP\A:CPtA:CPA:CPA:CPA:CP A:CP A:CP!A:CP$ B:CP"$B:CP 8B:CP&LB:CP`B: tB: B: B: A:76787x7 6 HC:Ð\C:!7"7$7!76$7C:C:H%76 6C:8'7D(7D)7}D:}D:},D:|*7+7 6HD:\D:pD:-7.7 69D:076 6273757E:(E:67?7 6F:F:F:B7TD7 6urlphy_attachurlphy_serviceurlphy_statusOpenBSD4.7RAMDISK#61 @(#)OpenBSD 4.7 (RAMDISK) #61: Thu Mar 18 23:51:05 MDT 2010 OpenBSD 4.7 (RAMDISK) #61: Thu Mar 18 23:51:05 MDT 2010 deraadt@zaurus.openbsd.org:/usr/src/sys/arch/zaurus/compile/RAMDISK dackirqtargetlunsizeintrcontrollersocketfunctionchanneldriveconsolemuxconfigurationinterfacevendorproductreleasereportidphywsmuxloopbpfilterbiodrive at %s channel %d drive %dwdcspl%s channel %d: reset failed for drive 1 drive 0atapi type: %s c_bcount: %d c_skip: %d missing untimeoutwdc_probe_caps%s(%s:%d:%d): using PIO mode %d, Ultra-DMA mode %d, DMA mode %d using BIOS timings%s: transfer error, downgrading to PIO mode %d %s: transfer error, downgrading to DMA mode %d %s: transfer error, downgrading to Ultra-DMA mode %d wdccmd%s:%d: %s %s(%s:%d:%d): %s physio split wd ioctl request... cannot proceed user_strat: No ioctl IBSSwlanwiLucent WaveLAN/IEEESony WaveLAN/IEEELucent Embedded WaveLAN/IEEEPRISM2 HFA3841(EVB2)PRISM2 HWB3763 rev.BPRISM2 HWB3163 rev.APRISM2 HWB3163 rev.BPRISM2 HFA3842(EVB3)PRISM1 HWB1153PRISM2 HWB3163 SST-flashPRISM2 HWB3163(EVB2) SST-flashPRISM2 HFA3842(EVAL)PRISM2.5 ISL3873PRISM2.5 USBPRISM2.5 ISL3874A(Mini-PCI)PRISM2.5 ISL3874A(PCI-bridge)PRISM3 ISL37300PPRISM3 ISL37300P(PCI)PRISM3 (USB): unable to read station address wi_attachaddress %sWaveLAN/IEEE node%s: received packet on invalid port (wi_status=0x%x) %s: received packet of unknown type on port 7 %s: oversized packet received (wi_dat_len=%d, wi_status=0x%x) %s: Error decrypting incoming packet. %s: oversized mgmt packet received in hostap mode (wi_dat_len=%d, wi_status=0x%x) wihap: failed to copy header %s: wi_cmd failed with %d %s: timeout in wi_cmd 0x%04x; event status 0x%04x %s: wi_cmd_io: busy bit won't clear %s: init failed %s: invalid data path: %x %s: failed to allocate %d bytes on NIC %s: unsupported crypto algorithm %d wiscan%s: wi_scan_timeout: %d tries %s: mgmt. buffer allocation failed %s: tx buffer allocation failed wi_do_hostencryptwi_do_hostdecrypt%s: wi_do_hostdecrypt: iv mismatch: 0x%02x%02x%02x%02x vs. 0x%x %s: wi_start: dropping unassoc dst %s %s: wi_start: xmit failed %s: host encrypt not implemented for 802.3 %s: wi_mgmt_xmit: xmit failed %s: device timeout Unknown PRISM2 chipSymbol %s: %s%s (0x%04x), Firmware %d.%d.%d (primary), %d.%d.%d (station), %s: Firmware %d.%02d variant %d, %s: %u (%d dBm) put_rateswihap_init: sc=%p whi=%p Sending disassoc to sta %s Sending deauth to sta %s wihap_shutdown: free(sta=%p) wihap_shutdown: sc=%p whi=%p wihap_timeout: disassoc due to inactivity: %s wihap_timeout: deauth due to inactivity: %s wihap_auth_req: station %s short request wihap_auth_req: returns status=0x%x wihap_auth_req: algorithm unsupported: 0x%x challenge: 0x%x 0x%x ... wihap_auth_req: new station wihap_auth_req: station %s algo=0x%x seq=0x%x wihap_assoc_reqwihap_assoc_req: bad ssid: '%.*s' != '%.*s' wihap_assoc_req: capinfo: not ESS: capinfo=0x%x wihap_assoc_req: returns status=0x%x wihap_assoc_req: already assoc'ed? wihap_assoc_req: polling not supported: capinfo=0x%x wihap_assoc_req: WEP flag mismatch: capinfo=0x%x wihap_assoc_req: rates mismatch. wihap_assoc_req: from station %s wihap_deauth_req: unknown station: %s wihap_disassoc_req: unknown station: %s wihap_data_input: no TODS src=%s, fctl=0x%x wihap_data_input: incorrect bss: %s wihap_data_input: dropping unassoc src %s wihap_ioctl: i shouldn't get other ioctls! wihap_ioctlwihap_mgmt_input: len=%d MGMT: unknown (stype=0x%x) assoc resp: assoc req: probe req: reassoc resp: reassoc req: ann traf ind beacon: deauth: auth: disassociation: probe resp: ftype=0x%x (ctl=0x%x) : where did the card go? ne2000_attach: setup failed ne2000_detect%s: remote transmit DMA failed to complete ne2000_write_mbuf: negative len%s: %d silo overflow%s, %d ibuf overflow%s comcomprmcomstartcomcninit: mapping failed: unknown uart %s: console : ns8250, no fifo : ns16450, no fifo : ns16550, no working fifo : ns16550a, %d byte fifo : st16650, no working fifo : st16650, %d byte fifo : ti16750, 64 byte fifo : st16c654, 64 byte fifo : pxa2x0, 32 byte fifo (SIR)comattach: bad fifo type%s: can't establish soft interrupt%s: probed fifo depth: %d bytes version %d.%d%s %s: unsupported OHCI revision ohci, legacy support%s: SMM does not respond, will reset %s: reset timeout %s: blocking intrs 0x%x %s: unrecoverable error, controller halted %s: resume detect %s: %u scheduling overruns ohci_add_done: addr 0x%08lx not foundohci_rem_ed: ED not foundohci_abort_xfer: not in process contextohciabohci_root_ctrl_startOHCI root hubohci_setintr: 0 interval %s: isoc TD alloc failed ohci_device_isoc_abort: early return softraid%s: could not allocate memory for metadata %s: could not allocate memory for foreign metadata sr_meta_probe%s:, sr_meta_probe: can't allocate vnode %s%d%c%s: read invalid metadata pointer %s: 0x%x i/o error on block %llu while reading metadata %d %s: sr_meta_rw: can't allocate vnode %s: sr_meta_clear can not clear foreign metadata %s: chunk sizes are not equal; up to %llu blocks wasted per chunk sr_meta_chunks_create%s: save metadata failed %s: no in memory copy of metadata %s: could not write metadata to %s %s: could not allocate metadata scratch area not yet save > 1 optional metadata membersnot yet read > 1 optional metadata members%s: not valid softraid metadata sr_meta_validate%s: %s can not read metadata version %u, expected %u %s: invalid metadata checksum %s: invalid foreign metadata %s: not enough memory for fake discipline sr_meta_native_bootprobe%s: native bootprobe could not read native metadata %s:, sr_meta_native_bootprobe: can't allocate vnode for partition %s: not enough memory for metadata buffer %s:, sr_meta_native_bootprobe: can't allocate vnode sd%s: failed to allocate device array %s: failed to allocate ondisk array %s: found duplicate chunk %u for volume %u on device %s %s: not all chunks were provided; attempting to bring volume %d online sr_boot_assembly%s: failed to allocate hotspare %s: failed to allocate boot volume! wdsr_meta_native_probe%s: not all chunks are of the native metadata format %s: could not read native metadata sr_meta_native_attach%s: not part of the same volume src_dev_mm == NODEVsr_locksr_hs_lock%s: controller registration failedsr_wu_get%s: %s device is being deleted, failing io %s: sr_scsi_cmd NULL discipline %s: unsupported state request %d %s: could not save metadata to %s %s: chunk not part of array %s: %s is already a hotspare %s: %s is already in use sr_hotspare%s: %s partition not of type RAID (%d) OPENBSDSR %sHOTSPARE%03d%s:, sr_hotspare: can't allocate vnode %s: %s volume degraded, will attempt to rebuild on hotspare %s %s: pending I/O failed to complete on failed chunk %s, hotspare rebuild aborted... %s: no offline chunk found on %s! %s: discipline does not support rebuild %s: rebuild already in progress %s: partition too small, at least %llu B required sr_rebuild_init%s: partition too large, wasting %llu B %s: rebuild of %s started on %s %s:, sr_rebuild_init: can't allocate vnode %s: no offline chunks available for rebuild %s: %s not degraded %s: roaming device %s -> %s %s: could not initialize discipline %s: invalid metadata format %s: can't attach metadata type %d %s: failed to clear metadata %s: one of the chunks has corrupt metadata; aborting assembly %s: trying to bring up %s degraded %s: volume level does not match metadata level! sr_ioctl_createraid%s: unable to create sensor for %s %s: volume %s is roaming, it used to be %s, updating metadata %s: %s offline, will not be brought online %s: disk already assembled; will not partial assemble it already assembled %s: %s was not shutdown properly is currently in use; can't force create %s: chunk %s already in use sr_downsr_raid_inquirysr_raid_read_capsr_syncsr_checksum%02x%02x%02x%02x-%02x%02x-%02x%02x-%02x%02x-%02x%02x%02x%02x%02x%02xsr_shutdown%s: %s: illegal cmdlen for %s %s: %s: illegal block count for %s %s: unable to start backgound operation %s: bogus rebuild restart offset, starting from 0 %s: resuming rebuild on %s at %llu%% %s: rebuild exhausted wu_rsr_rebuildsr_yield%s: could not create write io %s: could not create read io %s: rebuild exhausted wu_wRAID 0%s: %s: %s: invalid chunk state transition %d -> %d %s: %s: %s: invalid chunk state%s: %s: invalid volume state transition %d -> %d sr_raid0_rw%s: %s: too many ccbs queued %s: wu: %p not on pending queue %s: i/o error on block %lld target: %d b_error: %d %s: invalid target on wu: %pRAID 1invalid volume statesr_raid1_rw%s: is offline, can't read %s: retrying read on block %lld %s: permanently fail write on block %lld could not requeue ioRAID 4RAID 5sr_raidp_rwDisk %llx offline, regenerating buffer %s: can't get wu_wio error: disk %x %.2x CRYPTOsr_crypto_calculate_check_hmac_sha1sr_crypto_decrypt_keysr_crypto_change_maskkeysr_crypto_create_key_diskKEYDISK%s:, sr_create_key_disk: can't allocate vnode sr_crypto_read_key_disk%s: %s is not a key disk %s: not enough memory for chunk sr_uioplsr_iovplsr_crypto_alloc_resourcessr_crypto_ioctlsr_crypto_rw2%s: i/o error on block %lld RAID 6old_state = %d, invalid new_state%d = %d, sr_raid6_rw+Q singleDisk %llx offline, regenerating Dx%s Disk %llx & %llx offline, regenerating Dx+Dy Disk %llx offline, regenerating Dx+P rd%drdattach: device name too long WARNING: no memory for cfdata struct RAM diskfictitiousrd_idlebioioctlAll breakpoints used. Already set. Too many breakpoints. Not set. No breakpoints set Map Count Address %s%p %5d %-12sdb_commandCount missing Bad modifier Ambiguous No such command the kernel did not panic procscalloutmountsvnodesbufsallbcstatsbreaksextentsmallocobjectpagepanicpoolprocregistersuvmexpvnodewatchescrashhaltrebootpoweroffmachineexaminesearchwdeletebreakdwatchwatchstepcontinueuntilnextmatchtracecallshowboothelphangmandmesgddb> Bad function db_fncallArgument missing Too many arguments ELF[ %s symbol table has bad start address %p ] ELFbad magic[ %s ELF symbol table not valid: %s ] bad e_machine.strtab.symtabsymtab unaligned[ using %lu bytes of %s ELF symbol table ] symtab corrupteddb_examine= 0x%lx \%03o%-*ld%-*lo%-*s%-*lu%-*lx: db_print_cmd%*ld%*lo%*lu%*lxAddress missing Value missing Syntax error Symbol not found Divide by 0 Negative shift amount () Score: %lu/%lu db_hangman^R String too long Bad escape Bad character Bad character in number End of stack trace. --db_more-- -%*lo-%#*lo-%*lu-%#*lu-%*lx-%#*lxFaulted in traceback, aborting... Starting stack trace... %-12s%s %sdb_show_regs+%s[after %6d] bsd[ no symbol table formats found ] No slots left for %s symbol tableUnable to find symbol table slot for %s.invalid symbol table name%s %s%s Sifting table %s: db_printsym [%s:%d]After %d instructions (%d loads, %d stores), Breakpoint at Stopped at RUN AT LEAST 'trace' AND 'ps' AND INCLUDE OUTPUT WHEN REPORTING THIS PANIC! DO NOT EVEN BOTHER REPORTING THIS WITHOUT INCLUDING THAT INFORMATION! radixmaxoffmaxwidthtabstopslineslogUnknown variable No value All watchpoints used. No map. Too many watchpoints. No watchpoints set Map Address Size %s%p %8lx %lx Unknown size %s = %s db_write_cmdNothing written. /mnt/etc/firmware/%s, address %s dp8390_initdp8390_start: no header mbuf%s: NIC memory corrupt - invalid packet length %d : failed to clear NIC buffer at offset %x - check configuration %s: device enable failed extract_entropyarc4_stirarc4random_buf_largerndrdRRIP without PX field? RRIP with incorrect flags?RRIP with incorrect NM flags? IEEE_P1282RRIP_1991AIEEE_1282SPcd9660_mountroot: can't setup bdevvp'scd9660root_deviceCD001%/@%/C%/Eisoinodefhtovp: directory crosses block boundary %d[off=%d/len=%d] fhtovp: bread error %d fhtovp: crosses block boundary %d fhtovp: lbn exceed volume space %d cd9660_strategy: spectag VT_ISOFS, isofs vnode elf32_load_fileOpenBSDcoredump_elf32coredump_notes_elf32%s@%dcoredump_note_elf32#!/dev/fd/%dswapperfork initcfpendcannot mount rootcannot find root vnodepagedaemonfork pagedaemonreaperfork reapercleanerfork cleanerupdatefork updateaiodonedschedulerfork aiodoned/sbin/init/sbin/oinit/sbin/init.bak/dev/consolewarning: /dev/console does not exist warning: /dev/console error %d initexecinit: couldn't allocate argument spaceexec %s: error %d init: not found no initinitclocks: unable to register softclock intrfileplfdescpldup2: fdallocfdlockclosefkqueueplknoteplkqreadinit died (signal %d, exit %d)cpu_exit returnedwaitppwaitWARNING: thread `%s' (%d) exits with status %d unable to allocate kthread_qlockmgr: make up your mindlockmgr: not holding exclusive locklockmgr: non-zero exclusive countlockmgr: locking against myselflockmgr: draining against myselflockmgr: pid %d, not exclusive lock holder %d unlockinglockmgr: unknown locktype request %dmalloc(): allocation too large, type = %d, size = %lu malloc: allocation too largemalloc: out of space in kmem_map%d,No KMEMSTATS compiled in %s: lock not held%s: lock not held by this process%s: lock not shared%s: lock heldphysiophysbuf%-16s %-8s %18p %s %5d %5d %5d %d %#10x %-12.12s %-16s COMMANDSTRUCT PROC *UAREA * PID %-10s %18s %18s %18s VMSPACE/VM_MAP PID %-16s %-8s %18s %s EMULWAIT-CHANNELWAIT-MSGFLAGSWAITPPIDPGRPUID PID %5s %5s %5s S %10s %-12s %-16s usage: show all procs [/a] [/n] [/w] /a == show process address info /n == show normal process info [default] /w == show process wait/emul info procinit: mallocprocplprocessplzombieplucredplpgrpplsessionplpcredplchgproccnt: procs < 0idlestopzombiedeadonprocCONTROLTINMEMNOCLDSTOPPPWAITPROFILSELECTSINTR SUGID SYSTEM TIMEOUT TRACED WAITEDWEXITEXECPWEUPCSSTEPSUGIDEXECNOCLDWAITNOZOMBIEINEXECSYSTRACECONTINUEDBIGLOCKTHREADIGNEXITRVSOFTDEPSTOPPEDCPUPEGPROC (%s) pid=%d stat=%s flags=%b pri=%u, usrpri=%u, nice=%d forw=%p, list=%p,%p user=%p, vmspace=%p estcpu=%u, cpticks=%d, pctcpu=%u.%u%, swtime=%u user=%llu, sys=%llu, intr=%llu mawn%c%5d %-10.10s %18p %18p %18p plimitplidle%dfork idlecpu_switchto returnedstunrsensor_task_unregister: unexpected state %dcoredump%s%s.core/var/crash/sigaplpauseissignal coredump_tradpid %d (%s): %s write of %lu@%p at %lld failed: %d usersystemhashinit: bad cntsysctllksysctldlkkern_sysctl%s,%s%s(%d)sysctl_tc_choicedummyTimecounter "%s" frequency %lu Hz -- Insufficient hz, needs at least %u Time stepped from %ld.%09ld to %ld.%09ld sysctl_tc_hardwaredenied attempt to set clock forward to %ld denied attempt to set clock back %ld seconds nanosleep?%9d %2d/%-4d %8x %s ticks now: %d ticks wheel arg func syswqwqtasksunable to create system work queue threadwqdestroyunable to create thread for "%s" workq boredsmashed stack in %spreempt: cpu_preempt not yet implementedsetrunnable not configured unsupported >>> %s probe returned %d >>> probing for %s* mapply: no match function for '%s' device>>> %s probe won >>> no winning probe root device %s not configured %s at %s%s at rootconfig_make_softcconfig_make_softc: allocation for device softc failed%s%dconfig_make_softc: duplicate %sexpandcreatconfig_make_softc: %sing dev arrayconfig_make_softc: device name too long%s detached config_detach: forced detach of %s failed (%d)config_defer: can't defer config of a root deviceconfig_defer: can't allocate defer structureactivate: %s %d resume %s failing resume cannot be handled (default %s%s)can't figure root, hope your kernel is right setrootroot on %s%c swap on %s%d%c dump on %s%d%cnetbootroot device (%s) not foundwrit%s%d%c: %s %sing fsbn %lld of %lld-%lld (%s%d bn %lld; cn %lld tn %lld sn %lld)%llddklkdisk_attach: can't allocate storage for disklabeldisk_detach: disk_count < 0disk_unbusy: %s: dk_busy < 0 cannot open disk, 0x%x/0x%x, error %dcannot read disk label, 0x%x/0x%x, error %dfilesystem type %d not known.. assuming ffs dk_mountrootcannot close disk , 0x%x/0x%x, error %dcannot obtain vnode for 0x%x/0x%xroot filesystem has size 0use one of: exit %s[a-p]parsediskroot device (default %sswap devicefindblkmajorextentplextntextent_free: start 0x%lx, end 0x%lx extent_free: region not foundFLWANTEDWANTEDNOCOALESCEFIXEDextent `%s' (0x%lx - 0x%lx), flags=%b 0x%lx - 0x%lx extent_print: NULL extentklogphpoolpool_init: too much uptimepool_get: PR_ZERO when ctor setpool_do_get: %s: page emptypool_put of NULLpool_do_put: %s: page header missing page %p, nmissing %d POOL %s: size %u, align %u, ioff %u, roflags 0x%08x alloc %p minitems %u, minpages %u, maxpages %u, npages %u itemsperpage %u, nitems %u, nout %u, hardlimit %u nget %lu, nfail %lu, nput %lu npagealloc %lu, npagefree %lu, hiwat %u, nidle %lu empty page list: full page list: partial-page list: no current page curpage %p FailReleasesPgreqPgrelNpageHiwatMinpgMaxpgIdleSizeRequests%-10s%4s%9s%5s%9s%6s%6s%6s%6s%6s%6s%5s db_show_all_pools %*u %*lu %*d %*s %*lu inf%-10s %18p %18p %-10s %18s %18s Allocatorusage: show all pools [/a] %s: pool(%p:%s): page inconsistency: page %p; at page head addr %p (p %p) pool(%p:%s): page inconsistency: page %p; item ordinal %d; addr %p (p %p) kernel %sassertion "%s" failed: file "%s", line %d%s: table is full panic: splassert: %s: want %d have %d spl assertion failure in %slogprikprintf%llx%llobug in kprintf: bad base0123456789ABCDEF(null)0123456789abcdefaddchangeddbdisableenablefindlistquittimezoneverbose--- more --- 0%o*UNKNOWN**FOUND*%3d free slot (for add) Unknown devno (max is %d) %3d at disable %s flags 0x%x ???%3d %s count %d (pseudo device) %s [] ? Unknown argument %3d can't change free slot change (y/n) ?%3d %s changed flags changed out of memory. already disabled Error unknown state %3d can't disable free slot %3d %s already %3d can't enable free slot command args description [count] number of lines before more enter ddbdev add a device8|10|16 base on large numbersdevno|dev change devicesattr val|devno|dev disable devicesattr val|devno|dev enable devicesdevno|dev find devices this message list configuration leave UKC[attr [val]] show attributes (or devices with an attribute)[mins [dst]] set timezone/dst don't know toggle verbose bootingUnknown routine /%c/ Unknown attribute Unknown pseudo routine /%c/ Value missing for attribute %s ? Not same device type No more space for new devices. No device of this type exists. Clone Device (DevNo, 'q' or '?')Insert before Device (DevNo, 'q' or '?')Device not complete number or * is missing Argument expected Dev expected 8|10|16 expected DevNo or Dev expected Attr, DevNo or Dev expected timezone = %d, dst = %d Unknown command disautoconf verbose %sabled Unknown command, try help User Kernel Config UKC> Continuing... sys_ioctlselectpipelkpiperdpipewrpipeclpipeplttckoutqttwritettyrub: would panic c = %d, val = %d load: %d.%02d not a controlling terminal no foreground process group runningrunnableiowait cmd: %s %d [%s] %ld.%02ldu %ld.%02lds %d%% %ldk empty foreground process group putc: required clalloc b_to_q: required clalloc WARNING: mclpools limit reached; increase kern.maxclustersmbplmcl%dkunknown type of extension buffermbuf prepend length too bigm_copym0: null mbufm_copym0: m == NULL and not COPYALLm_copym0: off %d, len %dm_copydata: off %d < 0m_copydata: null mbuf in skipm_copydata: null mbufm_copydata: len %d < 0m_apply: len %d < 0m_apply: null mbuf in skipm_apply: null mbufm_apply: off %d < 0m == NULL in m_pulldown()unixsockplnetclssoclose: NOFDREFsoaccept: !NOFDREFnetionetlcksbappendaddrsbappendcontrolsemi-panic: sbcompresssbdropsbcreatecontrol: message too large %d netconacceptnetcon2uipc 1uipc 2uipc 4piusrrequnp_attachunp_bindunp_connect2unp_disconnectbremfree: lost tailbufplneedbuffergetblkbuf_get: dup lblk vp %p bp %pbiowaitbiodone alreadyCurrent Buffer Cache status: numbufs %lld, freebufs %lld bufpages %lld, freepages %lld, dirtypages %lld pendingreads %lld, pendingwrites %lld bufinit: can't reserve VM for buffersbuf_needvabuf_alloc_pagesbuf_alloc_pages: overlap buf: %p page: %pcache_lookupwtf? leak?nchplvop_generic_revokealloperation %s not listed in %s. vfs_op_descsvfs_opv_init: bad operationvfs_opv_init: operation vector without default routine.nameilockfpllf_findoverlap: defaultrelookup: null namerelookup: lookup on dot-dotvfslockvgetvclean: deadlockvclean: cannot reclaimvclean: not cleanvgonemissing bdevvgonel: not cleanmissing aliaskinfo: vp changed WARNING: some file systems would not unmount retrying unmount of %s failed with error %d syncing disks... giving up done %d softdep vwakeup: neg numoutputvinvalbufvinvalbuf: flush failedvinvalbuf: dirty bufsvflushbufvflushbuf: not dirtybgetvp: not freebrelvp: NULLAGENEEDCOMMITASYNCBADBUSYCACHECALLDELWRI DONE EINTR ERRORINVALNOCACHEPHYSRAWREADWANTEDWRITEINPROGXXXDEFERREDSCANNEDPDAEMON vp %p lblkno 0x%llx blkno 0x%llx dev 0x%x proc %p error %d flags %b bufsize 0x%lx bcount 0x%lx resid 0x%lx sync 0x%x data %p saveaddr %p dep %p iodone %p dirty {off 0x%x end 0x%x} valid {off 0x%x end 0x%x} VNONVREGVDIRVBLKVCHRVLNKVSOCKVFIFOVBADNONUFSNFSMFSMSDOSFSPORTALPROCFSAFSISOFSADOSFSEXT2FSVFSNNPFSNTFSUDFtag %s(%d) type %s(%d) mount %p typedata %p data %p usecount %d writecount %ld holdcnt %ld numoutput %d clean bufs: bp %p dirty bufs: RDONLYSYNCHRONOUSNOEXECNOSUIDNODEVASYNCEXRDONLY EXPORTED DEFEXPORTED EXPORTANON EXKERB LOCALQUOTAROOTFSflags %b vnodecovered %p syncer %p data %p vfsconf: ops %p name "%s" num %d ref %d flags 0x%x statvfs cache: bsize %x iosize %x blocks %llu free %llu avail %lld files %llu ffiles %llu favail $lld f_fsidx {0x%x, 0x%x} owner %u ctime 0x%x syncwrites %llu asyncwrites = %llu syncreads %llu asyncreads = %llu fstype "%s" mnton "%s" mntfrom "%s" locked vnodes: %p %p, %pall vnodes: %p, %p,syncersyncer vnode sys_mountmount: lost mountunmount: dangling vnodesys_getfhsys_fhopensys_fhstatsys_fhstatfsvn_lockvop_islockedvop_lookupvop_createvop_mknodvop_openvop_closevop_accessvop_getattrvop_setattrvop_readvop_writevop_ioctlvop_pollvop_kqfiltervop_revokevop_fsyncvop_removevop_linkvop_renamevop_mkdirvop_rmdirvop_symlinkvop_readdirvop_readlinkvop_abortopvop_inactivevop_reclaimvop_lockvop_unlockvop_bmapvop_printvop_pathconfvop_advlockvop_reallocblksvop_strategyvop_bwritedead_read: lockdead_write: locktag VT_NON, dead vnode dead_badop calledchkvnlockspec_read typespec_write typespec_ioctlspec_fsyncspec_fsync: not dirtyspec_close: not specialtag VT_NON, dev %d, %d spec_badop calleddos2unixtime(): month value out of range (%ld) denodedeget(): pcbmap returned %d detrunc(): can't truncate root directory, clust %ld, offset %ld deextend: file too largeextendfile(): attempt to extend root directory extendfile: pcbmapmsdosfs_lookup. .. doscheckpath(): .. not a directory? RRaArrAamsdosfs: reducing max cluster to %d from %d due to FAT size msdosfs_sync: rofs mod dev %d, %d, %s msdosfs_createmsdosfs_write(): bad file typemsdosfs_renamemsdosfs_rename: lost to startdirmsdosfs_rename: lost from startdirmsdosfs_rename: updating .. in root directory?msdosfs_mkdirmsdosfs_readdirmsdosfs_strategy: spectag VT_MSDOSFS, startcluster %ld, dircluster %ld, diroffset %ld (LOCKED)bpf_detachd: descriptor not in listbpf: ifpromisc failedbpfbpfwritebpf_mcopybpfattachifaddritempooltoo many interfacesif_attach_common: mallocif_clone_listif_downallifioctlrtinit: rtable_addifconfif_getgroupif_getgroupmembersegressif_group_egress_buildifpromisc%s: can't handle af%d lo%dlooutput: no header mbufifmedia_add: can't malloc entryifmedia_set: no match for 0x%x/0x%x ifmedia_set failedfile errorstream errordata errorinsufficient memorybuffer errorunknown compression methodinvalid window sizeinvalid reserved bitincorrect header checkincorrect data checkinvalid block typeinvalid stored block lengthsinvalid bit length repeattoo many length or distance symbolsincomplete dynamic bit lengths treeoversubscribed dynamic bit lengths treeoversubscribed literal/length treeincomplete literal/length treeinvalid literal/length codeinvalid distance code0.95Pstream endrn_addmask: mask impossibly already in tree Mask for route not entered Non-unique normal route, mask not entered rn_addroute: t->rn_p is NULL%s %p at %p rn_delete: Orphaned Maskrn_delete: inconsistent dupedkey list rn_delete: couldn't find our annotation rn_delete: inconsistent normal annotation rn_delete: inconsistent annotation rn_init: radix functions require max_keylen be set rn_initrn_init 2next == NULLraw_usrreqrtentplroute_init rtable_addrtfreertfree: %p not freed (neg refs) rtfree 2ifafreertrequest1rtrequest deletertinit: wrong ifa (%p) was (%p) rtinitrttmrplrt_timer_init: already initializedrt_timer_queue_destroy: rtq_count reached 0 rt_timer_remove_all: rtq_count reached 0 rt_timer_add: rtq_count reached 0 rt_timer_timer: rtq_count reached 0 route_outputsysctl_dumpentryroute%s: bad channel ignored; freq %u flags %x number %u %s: invalid channel freq %u flags %x %s: invalid channel (NULL) ieee80211_media_initUnexpected mode %uBad IBSS channel %u unexpected mode %uieee80211_prfieee80211_kdfPairwise key expansionieee80211_derive_ptkPMK Nameieee80211_pmkid_sha1ieee80211_pmkid_sha256ieee80211_eapol_key_micieee80211_eapol_key_check_micieee80211_eapol_key_encryptieee80211_eapol_key_decryptieee80211_bip_encapieee80211_bip_decapieee80211_ccmp_phase1ieee80211_ccmp_encryptieee80211_ccmp_decryptieee80211_tkip_decrypt%s: Michael MIC failure ieee80211_wep_encryptieee80211_wep_decrypt%s: %sassociation failed (status %d) for %s %s: received %s from %s rssi %d mode %s %s: station %s deauthenticated by peer (reason %d) %s: station %s disassociated by peer (reason %d) ieee80211_ioctl80211scan%s: tsft offset %s%llu %s: no memory for TIM bitmap! %s: no memory for AID bitmap! unable to setup inital BSS node%s: begin %s scan passive%s: creating ibss %s: end %s scan ieee80211_end_scanfreeing bss nodenot in ap mode, mode %uieee80211_ibss_merge%s: rates mismatch, BSSID %s %s: sync BSSID %s -> (from %s) %s: ieee80211_ibss_merge: bssid mismatch %s %s: my tsft %llu beacon tsft %llu %s: sync TSF with %s %s: failed to queue raw tx frame %s: sending %s to %s on channel %u mode %s null node%s: no node for dst %s, discard raw tx frame invalid integrity group cipher!invalid group data cipher!management frame too large: %u%s: station %s disassociate (reason %d) %s: station %s deauthenticate (reason %d) ieee80211_recv_4way_msg14-way%s: received msg %d/%d of the %s handshake from %s ieee80211_recv_4way_msg2ieee80211_recv_4way_msg3group keyEAPOL-Key frame too large: %u%s: sending msg %d/%d of the %s handshake to %s %s: sending EAPOL-Key request to %s .5 channel %d start %u%sMbshortlong protection enabled %s preamble %s slot time%s %s: bogus xmit rate %u setup assoc_reqassoc_respreassoc_reqreassoc_respprobe_reqprobe_respreserved#6reserved#7beaconatimdisassocdeauthactionaction_noackreserved#15INITSCANAUTHASSOCRUNauto11a11b11gturbo0x"%s: open authentication failed (reason %d) for %s newly%s: station %s %s authenticated (open) %s: no recent beacons from %s; rescanning associatedsynchronized%s: %s with %s ssid APL1APL1AAPL1_ETSICAPL1_FCCAAPL1WAPL2APL2CAPL2DAPL2_ETSICAPL2WAPL3APL3WAPL4APL4WAPL5APL5WAPLDAPLDEBUGETSI1ETSI1WETSI2ETSI2WETSI3ETSI3AETSI3W,ETSI4ETSI4CETSI4WETSI5ETSI5WETSI6ETSI6WETSIAETSIBETSICETSIEU1WFCC1FCC1AFCC1WFCC2FCC2CFCC2AFCC2WFCC3FCC3AFCCAFRANCEMKK1MKK1_FCCAMKK1AMKK1A1MKK1A2MKK1BMKK2MKK2AMKKANONEWOR01WWOR02WWOR0WWOR1WWOR2WWOR3WWOR4WWOR5_ETSICWOR9WWORAWWORLDaeamarauazbebgbhbnbobrbybzcacncocrcyczdodzegf2fifrgrgthkhnhrhuiliniqisj1j2j3j4j5jmjojpk2kpkrkwkzlbliltlvmamkmomxmyninlnzpaphpkprpyqarorusasgsisvtntttwuaukuyuzvnyezazwarp_rtrequest: bad gateway value arp_rtrequest: malloc failed arprequestarpresolve: %s: route without link local address arpresolve: %s: can't allocate llinfo arp: attempt to add entry for %s on %s by %s on %s in_arpinputarp: attempt to overwrite entry for %s on %s by %s on %s arp info overwritten for %s by %s on %s arp: attempt to overwrite permanent entry for %s by %s on %s duplicate IP address %s sent from ethernet address %s arp: ether address is broadcast for IP address %s! arptfreerevarprequestrevarp[NULL][ ifa_addr= ifa_dsta= ifa_mask= flags=0x%x, refcnt=%d, metric=%d la_rt=%p la_hold_head=%p, la_asked=0x%lx rtentry=%p flags=0x%x refcnt=%d use=%ld expire=%ld key= mask= gw= ifp=%p (%s) ifa=%p genmask= gwroute=%p llinfo=%p (NULL)Route tree for AF_INET (not initialized) in_controlinvalid argument to in_lifaddr_ioctlin_ifinitin_addmultiin_delmultiin_pcbinit: hashinit failedin_pcbinit: hashinit failed for lportinpcbplIPv6 pcb passed into in_pcbconnectinterneticmp_erroricmp lenicmp_reflecticmp_mtudisc_timeouticmp_mtudisc_timeout: bad route to timeouticmp_redirect_timeout: bad route to timeout%d.%d.%d.%dipqeplipqplaeshmac-sha1deflateip_initip_savecontrolip_outputip_setmoptionsrip_attachrip_detachrip_usrreqtcp_inputm_pulldown malfunctiontcp_pulloutofbandsynpltcp_outputtcp_output REXMTtcpcbpltcpqepltcp_inittcp_respondtcp_ctlinputtcp6_mtudisc_callbacktcp_set_iss_tsmtcp_timer_rexmttcp_usrreqtcp_identudp_inputudp6_ctlinputudp_usrreqipip_input: should never reach hereetherip_inputMD5FinalRMD160FinalSHA1TransformSHA1Finallibdes v 3.21 - 95/11/21 - eaycryptopcryptodesccryptocryptof_ioctlcrydevcuio_copydata: off %d < 0iov_copydata: empty in skipcuio_copydata: emptycuio_copydata: len %d < 0cuio_copyback: off %d < 0cuio_copyback: empty in skipuio_copyback: emptycuio_copyback: len %d < 0cuio_apply: len %d < 0cuio_apply: ind %d >= uio_iovcnt %d for offcuio_apply: ind %d >= uio_iovcnt %d for lencuio_apply: off %d < 0swcr_encdecswcr_authcomputeSoftware crypto device cannot initialize!DES3DESBlowfishCAST-128SkipjackRijndael-128/AESAES-CTRAES-XTSARC4HMAC-MD5HMAC-SHA1HMAC-RIPEMD-160HMAC-SHA2-256HMAC-SHA2-384HMAC-SHA2-512Keyed MD5Keyed SHA1MD5SHA1DeflateLZSaes_ctr_cryptaes_xts_cryptAES_CMAC_FinalHMAC_MD5_InitHMAC_MD5_FinalHMAC_SHA1_InitHMAC_SHA1_FinalHMAC_SHA256_InitHMAC_SHA256_Finalaes_key_unwrapfile system fulluid %u on %s: %s %s: write failed, file system is full ffs_realloccg: bad blocknodev = 0x%x, optim = %d, fs = %s ffs_realloccg: bad optimdev = 0x%x, bsize = %d, bprev = %lld, fs = %s ffs_realloccg: bad bprevmode = 0%o, inum = %d, fs = %s ffs_valloc: dup allocfree inode %s/%d had %lld blocks out of inodes %s: create/symlink failed, no inodes free ffs_clusteralloc: lost blockffs_nodealloccg: block not in mapcg = %d, irotor = %d, fs = %s ffs_nodealloccg: map corrupteddev = 0x%x, bsize = %d, size = %ld, fs = %s ffs_blkfree: bad sizebad block %lld, ino %u bad blockdev = 0x%x, block = %lld, fs = %s ffs_blkfree: freeing free fragffs_blkfree: freeing free blockdev = 0x%x, ino = %u, fs = %s ffs_freefile: range: dev = 0x%x, ino = %d, fs = %sffs_freefile: freeing free inodebno = %lld, fs = %s ffs_alloccg: block not in mapstart = %d, len = %d, fs = %s ffs_alloccg: map corruptedffs1_balloc: blk too bigCould not unwind indirect block, error %dffs_update: bad link cntffs_truncate: newspaceffs_indirtrunc: bad buffer sizesoftdep_flushfiles calledffs_mountroot: can't setup bdevvp's ffsWARNING: %s was not properly unmounted WARNING: R/W mount of %s denied. Filesystem is not clean - run fsck WARNING: soft updates isn't compiled in ffs_reload: dirty2ffs_reload: dirty1ffs_mountfs(): obsolete rotational table format, please use fsck_ffs(8) -c 1 ffs_statfsupdate: rofs modffsinodino1plffs_write: typeffs_write: nonsync dir writeffs_fsyncffs_fsync: not dirtyi_ffs_size too smallmangled entry%s: bad dir ino %d at offset %d: %s bad dirFirst bad Second bad ufs_direnter: newblkufs_direnter: compact1ufs_direnter: compact2checkpath: .. not a directory chown: lost quotaufs_linkufs_renameufs_rename: lost to startdirrename: EXDEVufs_rename: same fileufs_rename: lost dir entryufs_rename: lost from startdirufs_mkdirufs_readdir: lost in spaceufs_strategy: specufs_makeinodemode = 0%o, nlinks %d, inum = %d, fs = %s ext2fs_valloc: dup allocext2fs_nodealloccg: block not in mapcg = %d, ipref = %d, fs = %s ext2fs_nodealloccg: map corruptedbad block %d, ino %d dev = 0x%x, block = %d, fs = %s dev = 0x%x, ino = %d, fs = %s ifree: range: dev = 0x%x, ino = %d, fs = %sifree: freeing free inodeext2fs_mapsearch: block not in mapext2fs_alloccg: map corruptedext2fs_indirtrunc: bad buffer sizeext2fs_readdiri_size too smallrec_len is smaller than minimalrec_len % 4 != 0reclen is too small for name_lendirectory entry across blocksinode out of boundsbad directory entry: %s offset=%d, inode=%lu, rec_len=%d, name_len=%d ext2fs_dirbadentryext2fs_direnter: newblkext2fs_direnterext2fs_direnter: frag sizecheckpath%s: typeext2fs_write%s: nonsync dir writeext2inoplext2dinoplext2fs_mountroot: can't setup bdevvp'sext2fs%s: file system not clean; please fsck(8) ext2fs_reload: dirty2ext2fs_reload: dirty1ext2fs_statfsExt2 fs: unsupported first inode positionExt2 fs: unsupported optional feature ext2fs_rename: lost to startdirrename: linked directoryext2fs_rename: lost dir entryext2fs_rename: mangled dirext2fs_rename: lost from startdirext2fs_mkdir: blksizeamapplamap_wipeout: corrupt amapcownowpagecownowamap_cow_now: non-resident wired page in anon %pamap_splitref: split at zero offsetamap_splitref: map size check failedamap_pp_adjref: overshot targetamap_pp_adjref: negative reference countamap_lookup: offset out of rangeamap_lookups: offset out of rangeamap_add: offset out of rangeamap_add: replacing null anonamap_add: slot in useamap_unadd: offset out of rangeamap_unadd: nothing thereanonpluao_set_swslot: uobj = %p uao_set_swslot: attempt to set a slot on a NOSWAP objectuao_create: kernel object already allocateduao_create: hashinit swhash faileduao_create: malloc swslots faileduao_create: asked to enable swap on kernel objectuaoeltplaobjpluao_detuaoflshuao_flush: strange, got an out of range flush (fixed) uao_flush: weird flagsuao_getuao_getpageudv_attachudv_detachudv_faultfltamapcopyanonget1anonget2flt_noram1flt_pmfail1flt_noram3flt_noram2flt_pmfail2flt_noram4flt_noram5fltagain2uvm_fault_unwire_locked: address not in mapuvm_init: page size not setuvm_km_init: could not reserve space for kerneluvm_km_suballoc: unable to allocate space in parent mapuvm_km_suballoc: submap allocation faileduvm_km_suballoc: unable to create submapkm_pgrmuvm_km_pgremove_intrsafe: no pagekm_getwait2km_alloc1wvallocwaitkmthreadkmallocuvm_mapent_alloc: out of static map entries uvm_mapent_alloc: cannot allocate map entry# uvm_map() successful calls# uvm_map() back merges# uvm_map() missed forward# back merges skipped# map lookup calls# map lookup hint hitsvmspplvmmpeplvmmpekpluvm_map_clean: weird flagsvmmaplkfork: encountered a submap during fork (illegal)fork: non-copy_on_write map entry marked needs_copy (illegal)MAP %p: [0x%lx->0x%lx] #ent=%d, sz=%u, ref=%d, version=%u, flags=0x%x pmap=%p(resident=%d) - %p: 0x%lx->0x%lx: obj=%p/0x%llx, amap=%p/%d submap=%c, cow=%c, nc=%c, prot(max)=%d/%d, inh=%d, wc=%d, adv=%d OBJECT %p: locked=%d, pgops=%p, npages=%d, refs=%d PAGES : <%p,0x%llx> refs= PAGE %p: flags=%b, vers=%d, wire_count=%d, pa=0x%llx uobject=%p, uanon=%p, offset=0x%llx loan_count=%d [page ownership tracking disabled] >>> ANON DOES NOT POINT HERE <<< (%p) checking pageq list >>> PAGE NOT FOUND ON PAGEQ LIST! <<< page found on pageq list anon backpointer is OK checking object list >>> PAGE NOT FOUND ON OBJECT LIST! <<< page found on object list uvm_page_bootstrap: no memory pre-allocateduvm_page_init: lost %ld page(s) in init uvm_page_inituvm_setpagesize: page size not a power of twouvm_pageboot_alloc: out of virtual spaceuvm_pageboot_alloc: out of memoryuvm_pageboot_alloc: pmap_growkernel() faileduvm_page_physget: called _after_ bootstrapuvm_page_physget: out of memory!uvm_page_physload: page size not set!uvm_page_physload: start >= enduvm_page_physload: tried to add RAM after vm_mem_inituvm_page_physload: unable to load physical memory segment %d segments allocated, ignoring 0x%llx -> 0x%llx increase VM_PHYSSEG_MAX uvm_page_physload: bad free list %duvm_page_physdump: physical memory config [segs=%d of %d]: 0x%llx->0x%llx [0x%llx->0x%llx] STRATEGY = RANDOM uvm_pagealloc_strat: bad strat %dpagersegpagedaemon: deadlock detected! pgdaemon%s = %d Current UVM status: pagesize=%d (0x%x), pagemask=0x%x, pageshift=%d %d VM pages: %d active, %d inactive, %d wired, %d free min %d%% (%d) anon, %d%% (%d) vnode, %d%% (%d) vtext pages %d anon, %d vnode, %d vtext freemin=%d, free-target=%d, inactive-target=%d, wired-max=%d faults=%d, traps=%d, intrs=%d, ctxswitch=%d fpuswitch=%d softint=%d, syscalls=%d, swapins=%d, swapouts=%d, kmapent=%d fault counts: noram=%d, noanon=%d, pgwait=%d, pgrele=%d ok relocks(total)=%d(%d), anget(retries)=%d(%d), amapcopy=%d neighbor anon/obj pg=%d/%d, gets(lock/unlock)=%d/%d cases: anon=%d, anoncow=%d, obj=%d, prcopy=%d, przero=%d daemon and swap counts: woke=%d, revs=%d, scans=%d, obscans=%d, anscans=%d busy=%d, freed=%d, reactivate=%d, deactivate=%d pageouts=%d, pending=%d, nswget=%d nswapdev=%d, nanon=%d, nanonneeded=%d nfreeanon=%d swpages=%d, swpginuse=%d, swpgonly=%d paging=%d kernel pointers: objs(kern)=%p swplkuvm_swap_init: can't get vnode for swap deviceswapmapswp vnxswp vnduvm_swap_init: extent_create failedswapdrum_addsys_swapctlswapctl: copystrswapctl: miniroot copy failedswap0x%04xswap_on: miniroot larger than swap?Preserved %d pages of miniroot leaving %d pages of swap swap_on: unable to preserve minirootdisklabel regionswap_off: swapdev not in listswstrategy: vnode type 0x%xsw_reg_strategy: swap to sparse filewarning: resource shortage: %d pages of swap lost swapmount: no device swapmount: no device 2 swap_deviceswapmount: copystrsbrk: grow %ld failed, error = %d uvm_coredump: user process with submap?uvm_deallocate with null mapuvnsyncuvn_attachuvn_termuvm_vnp_terminate: io sync wanted bit setuvn_flushuvn_flshuvn_flush: obj=%p, offset=0x%llx. error during pageout. uvn_flush: WARNING: changes to page may be lost! uvn_cluster: offset out of rangeuvn_getuvn_getpageuvn_iosyncrd%d: fixed, %d blocks NULL pointer passed to ip_ecn_ingressNULL pointer passed to ip_ecn_egressNULL pointer passed to ip6_ecn_ingressNULL pointer passed to ip6_ecn_egressin6_pcbconnectin6_pcbnotifyin6_ifloop_requestADDDELETEin6_ifloop_request: %s operation failed for %s (errno=%d) in6_controlnd6_prelist_add succeeded but no prefix prefix ioctls are now invalidated. please use ifconfig. in6_update_ifain6_update_ifa: addmulti failed for %s on %s (errno=%d) in6_update_ifa: failed to remove a route to the old destination: %s in6_update_ifa: the prefix length of an existing (%s) address should not be changed in6_update_ifa: valid lifetime is 0 for %s in6_update_ifa: prefixlen should be 128 when dstaddr is specified in6_update_ifa: a destination can be specified for a p2p or a loopback IF only in6_purgeaddr: failed to remove a route to the p2p destination: %s on %s, errno=%d Couldn't unlink in6_ifaddr from in6_ifaddr in6_unlink_ifa: autoconf'ed address %p has no prefix invalid argument to in6_lifaddr_ioctlin6_savemkludge: no kludge spacein6_addmultiin6_delmultiin6_are_prefix_equal: invalid prefix length(%d) in6_prefixlen2mask: invalid prefix length(%d) in6_prefixlen2maskin6_ifawithscope: output interface is not specified get_rand_ifid%s: interface identifier generated by random number %s: ifid: %02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x %s: failed to get interface identifier %s: borrow interface identifier from %s %s: got interface identifier from %s %s: got interface identifier from itself in6_ifattach_linklocalin6_ifattach_linklocal: failed to configure a link-local address on %s (errno=%d) %s: no ifid available in6_ifattach_loopbackin6_ifattach_loopback: failed to configure the loopback address on %s (errno=%d) in6_nigroupin6_ifattach: %s has too small MTU, IPv6 not enabled in6_ifattachin6_ifattach: %s is not multicast capable, IPv6 not enabled in6_ifdetach%s: didn't unlink in6ifaddr from list in6_cksum: mbuf len (%d) < off+len (%d+%d)in6_cksum: out of datainternet6icmp6_mtudisc_callback_registerENOBUFS in icmp6_error %d icmp6_input: unknown type %d(src=%s, dst=%s, ifid=%d) ICMP6 checksum error(%d|%x) %s icmp6_notify_erroricmp6_notify_error: in6_embedscope failed icmp6_mtudisc_updateni6_inputicmp6_rip6_inputicmp6_reflecticmp6_reflect: source can't be determined: dst=%s, error=%d ../../../../netinet6/icmp6.csanity fail: off=%lx, sizeof(ip6)=%lx in %s:%d (src=%s dst=%s tgt=%s)icmp6_redirect_inputICMP6 redirect sent from %s rejected; must be from linklocal ICMP6 redirect sent from %s rejected; hlim=%d (must be 255) ICMP6 redirect rejected; no route with inet6 gateway found for redirect dst: %s ICMP6 redirect rejected; neither router case nor onlink case: %s icmp6_redirect_input: lladdrlen mismatch for %s (if %d, icmp6 packet %d): %s icmp6_redirect_input: invalid ND option, rejected: %s ICMP6 redirect rejected; redirect dst must be unicast: %s ICMP6 redirect rejected; not equal to gw-for-src=%s (must be same): %s ICMP6 redirect rejected; no route found for redirect dst: %s icmp6_redirect_outputicmp6_mtudisc_timeout: bad route to timeouticmp6_redirect_timeout: bad route to timeoutip6_initip6_input: packet to an unready address %s->%s ip6_savecontrolip6_nexthdrip6_nexthdr: m == NULLOpenBSD-currentcannot forward from %s to %s nxt %d received on %s cannot forward src %s, dst %s, nxt %d, rcvif %s, outif %s ip6_outputassumption failed: hdr not splitip6_ctloutputip6_getpcboptip6_setmoptionsnd6_init called more than once(ignored) nd6_setmtu0: new link MTU on %s (%lu) is too small for IPv6 ndopts == NULL in nd6_optionuninitialized ndopts in nd6_optionndopts == NULL in nd6_optionsduplicated ND6 option found (type=%d) too many loop in nd opt nd6_options: unsupported option %d - option ignored uninitialized ndopts in nd6_optionsln->ln_rt == NULLln->ln_rt->rt_ifp == NULLrt_llinfo(%p) is not equal to ln(%p)dst=0 in nd6_timer(ln=%p)nd6_lookupunspecnd6_lookup: failed to lookup %s (if = %s) nd6_freend6_rtrequestnd6_rtrequest: bad gateway value: %s %s: failed to join %s (errno=%d) nd6_rtrequest: malloc failed nd6_ioctla router(%s) advertises a prefix with non-link local address default router list contains a non-linklocal address(%s) ifp == NULL in nd6_cache_lladdrfrom == NULL in nd6_cache_lladdrnd6_output: can't allocate llinfo for %s (ln=%p, rt=%p) nd6_storelladdr: something odd happens nd6_storelladdr: sdl_alen == 0, dst=%s, if=%s scope error in prefix list (%s) nd6_ns_inputnd6_ns_input: src=%s nd6_ns_input: dst=%s nd6_ns_input: tgt=%s nd6_ns_input: invalid hlim (%d) from %s to %s on %s nd6_ns_input: bad DAD packet (wrong ip6 dst) nd6_ns_input: lladdrlen mismatch for %s (if %d, NS packet %d) nd6_ns_input: duplicate IP6 address %s nd6_ns_input: bad DAD packet (link-layer address option) nd6_ns_input: invalid ND option, ignored nd6_ns_input: bad NS target (multicast) nd6_ns_input: NS packet from non-neighbor nd6_ns_outputnd6_ns_output: source can't be determined: dst=%s, error=%d nd6_na_inputnd6_na_input: invalid hlim (%d) from %s to %s on %s nd6_na_input: duplicate IP6 address %s nd6_na_input: lladdrlen mismatch for %s (if %d, NA packet %d) nd6_na_input: ND packet from non-neighbor nd6_na_input: invalid ND option, ignored nd6_na_input: a solicited adv is multicasted nd6_na_input: invalid target address %s nd6_na_outputnd6_na_output: source can't be determined: dst=%s, error=%d %s: starting DAD for %s nd6_dad_start: memory allocation failed for %s(%s) ???nd6_dad_start: called with non-tentative address %s(%s) nd6_dad_start: ifa->ifa_ifp == NULLnd6_dad_timer: called with null parameter %s: DAD complete for %s - no duplicates found %s: could not run DAD, driver problem? nd6_dad_timer: called with non-tentative address %s(%s) nd6_dad_timer: called with duplicated address %s(%s) nd6_dad_timer: DAD structure not found nd6_dad_duplicated: DAD structure not found %s: DAD detected duplicate IPv6 address %s: NS in/out=%d/%d, NA in=%d %s: DAD complete for %s - duplicate found %s: manual intervention required nd6_dad_ns_input: ignoring DAD NS packet for address %s(%s) ifa == NULL in nd6_dad_ns_inputifa == NULL in nd6_dad_na_inputnd6_rs_inputnd6_rs_input: invalid hlim (%d) from %s to %s on %s nd6_rs_input: lladdrlen mismatch for %s (if %d, RS packet %d) nd6_rs_input: invalid ND option, ignored nd6_ra_inputnd6_ra_input: invalid hlim (%d) from %s to %s on %s nd6_ra_input: src %s is not link-local nd6_ra_input: lladdrlen mismatch for %s (if %d, RA packet %d) nd6_ra_input: bogus mtu mtu=%lu sent from %s; exceeds maxmtu %lu, ignoring nd6_ra_input: bogus mtu option mtu=%lu sent from %s, ignoring nd6_ra_input: invalid option len %d for prefix information option, ignored nd6_ra_input: invalid prefix len %d for prefix information option, ignored nd6_ra_input: invalid prefixlen %d for rfc2374 prefix %s, ignored nd6_ra_input: invalid prefix %s, ignored nd6_ra_input: invalid ND option, ignored defrouter_addreqdefrtrlist_del: negative count on %s defrouter_delreqdefrouter_select: called unexpectedly (forwarding=%d, accept_rtadv=%d) defrouter_select: more than one router is installed nd6_prelist_add: failed to make the prefix %s/%d on-link on %s (errno=%d) prelist_remove: negative count on %s prelist_remove: failed to make %s/%d offlink on %s, errno=%d prelist_update: failed to make the prefix %s/%d on-link on %s (errno=%d) prelist_update: nd6_prelist_add failed for %s/%d on %s errno=%d, returnpr=%p pfxlist_onlink_check: failed to make %s/%d offlink, errno=%d nd6_prefix_onlinknd6_prefix_onlink: failed to add route for a prefix (%s/%d) on %s, gw=%s, mask=%s, flags=%lx errno = %d nd6_prefix_onlink: failed to find any ifaddr to add route for a prefix(%s/%d) on %s nd6_prefix_onlink: %s/%d is already on-link nd6_prefix_offlinknd6_prefix_offlink: failed to recover a prefix %s/%d from %s to %s (errno = %d) nd6_prefix_offlink: failed to delete route: %s/%d on %s (errno = %d) nd6_prefix_offlink: %s/%d is already off-link in6_ifaddin6_ifadd: failed to make ifaddr %s on %s (errno=%d) in6_ifadd: wrong prefixlen for %s (prefix=%d ifid=%d) in6_init_prefix_ltimes: preferred lifetime(%d) is greater than valid lifetime(%d) rip6_inputrip6_outputrip6_attachrip6_usrreqrip6_detachudp6_outputcompat_43_sys_acceptcompat_43_sys_getpeernamecompat_43_sys_getsockname spsrr0r1r2r3r4r5r6r7r8r9r10r11r12usr_spusr_lrsvc_spsvc_lrpcund_spabt_spirq_spFaulted in DDB; continuing... address %p is invalid address 0x%08lx not a valid page framedb_fetch_reg: botchbranch_taken: botchscp=0x%08x rlv=0x%08x ( rsp=0x%08x rfp=0x%08xBad frame pointer: %p Bad user frame pointer: %p %sr%d=0x%08xtrace: pid %d at %p not found frame address = %08x frame address must be specified spsr=%08x r0 =%08x r1 =%08x r2 =%08x r3 =%08x r4 =%08x r5 =%08x r6 =%08x r7 =%08x r8 =%08x r9 =%08x r10=%08x r11=%08x r12=%08x r13=%08x r14=%08x r15=%08x slr=%08x mainbusmainbus_bs_alloc(): Help!mainbus_bs_free(): Help!cpu%s, #0x%03ximbimbrangeswiblxblmulSnmsmlaSnmsdumullSdnmssmullumlalsmlalstrtdaWldrtstrbtldrbtstrldrstrbldrbstmYnWlldmXnWlldrsbldrhstrhldrshswpdmoswpbmrsdpmsrpFmpF2bxclzdmbkptSdn2eorsubrsbadcsbcrsctstDn2teqcmpcmnorrmovSd2bicmvnadfPRfghmufsufrsfdvfrdfpowrpwrmffmlfdvfrdpolfpbopmvfPRfhmnfabsrndsqtlgnexpsincostanasnacsatnfpuopstfQLvldffltPRgdfixPRdhwfsrfswfcrfccmfPRghcnfcmfecnfemcr2#zmcrmrc2mrccdp2#ycdpldc2L#vldcstc2stcund%s %08x %s%s#0x%08xp%d_f%d#%s[r%d]cpsr[%c - unknown]c%d, c%d, c%d, %dr%d, c%d, c%d, %d, rrx, %s r%d, %s #%d{r%d-r%d}^[r%d#0x%02xf%d, c%d, No support for this CPU type (%08x) in kernelcpu.branchpredictcpu.cachecpu.nocachexscale.branchpredictxscale.cachexscale.icachexscale.dcacheUndefined instruction in kernel WARNING: not updating battery clock Warning IRQ's disabled during boot() real mem = %u (%uMB) avail mem = %lu (%uMB) _bus_dmamap_load_raw: not implemented_bus_dmamap_sync: mix PRE and POSTunknown buffer type %d _bus_dmamap_sync_bus_dmamap_sync: ARM32_BUFTYPE_INVALID_bus_dmamem_map: size botch%s: SA-110 with bugged STM^ instruction rev 0rev 1rev 2rev 3rev 4rev 5rev 6rev 7rev 8rev 9rev 10rev 11rev 12rev 13rev 14rev 15step Jstep Kstep Sstep Tstep Bstep Cstep Dstep Erev 10step Gstep A-0step B-0step B-1step B-2step B-3step B-4step B-5(IXP1200 step A)(IXP1200 step B)(IXP1200 step C)(IXP1200 step D)(IXP1240/1250 step A)(IXP1240 step B)(IXP1250 step B)step A-1step C-0step D-0step ?step C-5step 0ARM600ARM610ARM620ARM700ARM710ARM7500ARM710aARM7500FEARM710TARM720TARM740T (8 KB cache)ARM740T (4 KB cache)ARM810ARM920TARM922TARM926EJ-SARM940TARM946E-SARM966E-STI ARM925TARM1020EARM1022E-SSA-110SA-1100SA-1110IXP1200i80200i80321 400MHzi80321 600MHzi80219 400MHzi80219 600MHzPXA250PXA210PXA27xIXP425 533MHzIXP425 400MHzIXP425 266MHzARM1136J-SARM1136J-S R1ARM OMAP3430ARM OMAP3530unknownCPU_ARM2ARM2asCPU_ARM250CPU_ARM3CPU_ARM6CPU_ARM7CPU_ARM7TDMICPU_ARM8ARM9TDMIARM9E-SCPU_ARM9EARM9EJ-SARM10ECPU_ARM10SA-1CPU_SA110XScaleCPU_XSCALE_...ARM11JCPU_ARM11CPU_ARMv7wr-thruwr-back**unknown 3****unknown 4**wr-back-lockwr-back-lock-Awr-back-lock-B**unknown 8****unknown 9****unknown 10****unknown 11****unknown 12****unknown 13****unknown 14****unknown 15**%s: IDC disabled IDC enabled WB disabled WB enabled LABT EABT%s: %dKB/%dB %d-way %s unified cache %s: %s does not fully support this CPU. %s: This kernel does not fully support this CPU. %s: Recompile with "options %s" to correct this. %s: %dKB(%db/l,%dway) I-cache, %dKB(%db/l,%dway) %s D-cache branch prediction enabled DC disabled DC enabled IC disabled IC enabledunknown CPU (ID = 0x%x)%s %s (%s core)Processor failed probe - no CPU ID Vector ExceptionAlignment Fault 1Terminal ExceptionAlignment Fault 3External Linefetch Abort (S)Translation Fault (S)External Linefetch Abort (P)Translation Fault (P)External Non-Linefetch Abort (S)Domain Fault (S)External Non-Linefetch Abort (P)Domain Fault (P)External Translation Abort (L1)Permission Fault (S)External Translation Abort (L2)Permission Fault (P) uvm_fault(%p, %lx, %x, 0) -> %x UVM: pid %d (%s), uid %d killed: out of swap Non-emulated page fault with intr_depth > 0 data_abort_fault: Misaligned Kernel-mode Program Counter kernelFatal %s mode data abort: '%s' trapframe: %p FSR=%08x, FAR=r0 =%08x, r1 =%08x, r2 =%08x, r3 =%08x r4 =%08x, r5 =%08x, r6 =%08x, r7 =%08x r8 =%08x, r9 =%08x, r10=%08x, r11=%08x r12=%08x, usp=%08x, ulr=%08xssp=%08x, slr=%08x, pc =%08x Fatal abortInvalid, Fatal %s mode prefetch abort at 0x%08x trapframe: %p, spsr=%08x badaddr: invalid size (%lu)mmrwpmap_enter: no pv entriespmap_enter: failed to allocate L2 bucketpmap_init_l1: can't get PA of L1 at %ppmapplpvepll2dtblpll2ptpplpmap_bootstrap: WARNING! wrong cache mode for primary L1 @ 0x%lx pmap_bootstrap: WARNING! wrong cache mode for L2 pte @ %p pmap_bootstrap: No L2 for va 0x%x, pa 0x%lxpmap_bootstrap: out of static L2spmap_bootstrap: No L2 for L2 @ va %ppmap_alloc_specials: no l2b for 0x%lxCannot allocate L1 KVMCannot allocate L1 physical pagespmap_map_entry: no L2 table for VA 0x%08lxpmap_map_entry: can't find L2 table for VA 0x%08lxpmap_map_chunk: no L2 table for VA 0x%08lxpmap_map_chunk: can't find L2 table for VA0x%08lxpmap_map_chunk: no L1 table providedxscale_setup_minidata: can't find L2 table for VA 0x%08lxuser pmap (%p): pmap_kernel (%p): domain %d, l1 at %p %08lx: %c |0000 |8000 |10000 |18000 |20000 |28000 |30000 |38000 pa 0x%08lx: krw %d kro %d urw %d uro %d %c va 0x%08lx, flags 0x%x dumping to dev %u,%u offset %ld dumpsysdump device bad aborted from console i/o error device not ready succeeded area improper area unavailable dump to dev %u,%u not possible vmapbufvunmapbufThe operating system has halted. Please press any key to reboot. rebooting... reboot failed; spinning Attempting to power down... %08lx -> %08lx @ %08lx cpu not recognized! OpenBSD/zaurus booting ... initarm: Configuring system ... physmemory: %d pages at 0x%08lx -> 0x%08lx Allocating page tables freestart = 0x%08lx, free_pages = %d (0x%08x) initarm: Failed to align the kernel page directoryIRQ stack: p0x%08lx v0x%08lx ABT stack: p0x%08lx v0x%08lx UND stack: p0x%08lx v0x%08lx SVC stack: p0x%08lx v0x%08lx Creating L1 page table at 0x%08lx Mapping kernel Constructing L2 page tables freestart = 0x%08lx, free_pages = %d (0x%x) switching to new L1 page table @%#lx...bootstrap done. init subsystems: stacks vectors undefined page pmap initarm: out of memoryglassbootfile: %s bootargs: %s ffuartbtuartstuartunknown option `%c' attempting to switch console to lcd screen %sCheck Condition (error %#x) on opcode 0x%x AT BLOCK #: %d (decimal) SENSE KEY: %s INFO: 0x%x (VALID flag %s) SKSV: %s FRU CODE: 0x%x ASC/ASCQ: %s COMMAND INFO: 0x%x %c Incorrect Length Indicator Set%c EOM Detected%c Filemark Detectedscxsplscsipluggetxsscsi_sizesyncxsscsi_done called twice on xs(%p)unknown error category (0x%x) from scsi driver scbusy%s(%s:%d:%d): No Additional SenseSoft ErrorNot ReadyMedia ErrorHardware ErrorIllegal RequestUnit AttentionWrite ProtectedBlank CheckVendor UniqueCopy AbortedAborted CommandEqual ErrorVolume OverflowMiscompare ErrorReservedNo Additional Sense InformationFilemark DetectedEnd-Of-Partition/Medium DetectedSetmark DetectedBeginning-Of-Partition/Medium DetectedEnd-Of-Data DetectedI/O Process TerminatedAudio Play Operation In ProgressAudio Play Operation PausedAudio Play Operation Successfully CompletedAudio Play Operation Stopped Due to ErrorNo Current Audio Status To ReturnCleaning RequestedErase Operation In ProgressLocate Operation In ProgressRewind Operation In ProgressSet Capacity Operation In ProgressVerify Operation In ProgressNo Index/Sector SignalNo Seek CompletePeripheral Device Write FaultNo Write CurrentExcessive Write ErrorsLogical Unit Not Ready, Cause Not ReportableLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Initialization Command RequiredLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Format In ProgressLogical Unit Not Ready, Rebuild In ProgressLogical Unit Not Ready, Recalculation In ProgressLogical Unit Not Ready, Operation In ProgressLogical Unit Not Ready, Long Write In ProgressLogical Unit Not Ready, Self-Test In ProgressLogical Unit Not Accessible, Asymmetric Access State TransitionLogical Unit Not Accessible, Target Port In Standby StateLogical Unit Not Accessible, Target Port In Unavailable StateLogical Unit Not Ready, Auxiliary Memory Not AccessibleLogical Unit Not Ready, Notify (Enable Spinup) RequiredLogical Unit Does Not Respond To SelectionNo Reference Position FoundMultiple Peripheral Devices SelectedLogical Unit Communication FailureLogical Unit Communication TimeoutLogical Unit Communication Parity ErrorLogical Unit Communication CRC Error (ULTRA-DMA/32)Unreachable Copy TargetTrack Following ErrorTracking Servo FailureFocus Servo FailureSpindle Servo FailureHead Select FaultError Log OverflowWarningWarning - Specified Temperature ExceededWarning - Enclosure DegradedWrite ErrorWrite Error Recovered with Auto ReallocationWrite Error - Auto Reallocate FailedWrite Error - Recommend ReassignmentCompression Check Miscompare ErrorData Expansion Occurred During CompressionBlock Not CompressibleWrite Error - Recovery NeededWrite Error - Recovery FailedWrite Error - Loss Of StreamingWrite Error - Padding Blocks AddedAuxiliary Memory Write ErrorWrite Error - Unexpected Unsolicited DataWrite Error - Not Enough Unsolicited DataError Detected By Third Party Temporary InitiatorThird Party Device FailureCopy Target Device Not ReachableIncorrect Copy Target Device TypeCopy Target Device Data UnderrunCopy Target Device Data OverrunInvalid Information UnitInformation Unit Too ShortInformation Unit Too LongID CRC Or ECC ErrorUnrecovered Read ErrorRead Retries ExhaustedError Too Long To CorrectMultiple Read ErrorsUnrecovered Read Error - Auto Reallocate FailedL-EC Uncorrectable ErrorCIRC Unrecovered ErrorData Resynchronization ErrorIncomplete Block ReadNo Gap FoundMiscorrected ErrorUncorrected Read Error - Recommend ReassignmentUncorrected Read Error - Recommend Rewrite The DataDe-Compression CRC ErrorCannot Decompress Using Declared AlgorithmError Reading UPC/EAN NumberError Reading ISRC NumberRead Error - Loss Of StreamingAuxiliary Memory Read ErrorRead Error - Failed Retransmission RequestAddress Mark Not Found for ID FieldAddress Mark Not Found for Data FieldRecorded Entity Not FoundRecord Not FoundFilemark or Setmark Not FoundEnd-Of-Data Not FoundBlock Sequence ErrorRecord Not Found - Recommend ReassignmentRecord Not Found - Data Auto-ReallocatedLocate Operation FailureRandom Positioning ErrorMechanical Positioning ErrorPositioning Error Detected By Read of MediumData Synchronization Mark ErrorData Sync Error - Data RewrittenData Sync Error - Recommend RewriteData Sync Error - Data Auto-ReallocatedData Sync Error - Recommend ReassignmentRecovered Data With No Error Correction AppliedRecovered Data With RetriesRecovered Data With Positive Head OffsetRecovered Data With Negative Head OffsetRecovered Data With Retries and/or CIRC AppliedRecovered Data Using Previous Sector IDRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Recommend RewriteRecovered Data Without ECC - Data RewrittenRecovered Data With Error Correction AppliedRecovered Data With Error Correction & Retries AppliedRecovered Data - Data Auto-ReallocatedRecovered Data With CIRCRecovered Data With L-ECRecovered Data - Recommend ReassignmentRecovered Data - Recommend RewriteRecovered Data With ECC - Data RewrittenRecovered Data With LinkingDefect List ErrorDefect List Not AvailableDefect List Error in Primary ListDefect List Error in Grown ListParameter List Length ErrorSynchronous Data Transfer ErrorPrimary Defect List Not FoundGrown Defect List Not FoundMiscompare During Verify OperationRecovered ID with ECCPartial Defect List TransferInvalid Command Operation CodeAccess Denied - Initiator Pending-EnrolledAccess Denied - No Access rightsAccess Denied - Invalid Mgmt ID KeyIllegal Command While In Write Capable StateObsoleteIllegal Command While In Explicit Address ModeIllegal Command While In Implicit Address ModeAccess Denied - Enrollment ConflictAccess Denied - Invalid LU IdentifierAccess Denied - Invalid Proxy TokenAccess Denied - ACL LUN ConflictLogical Block Address Out of RangeInvalid Element AddressInvalid Address For WriteIllegal Function (Should 20 00, 24 00, or 26 00)Illegal Field in CDBCDB Decryption ErrorSecurity Audit Value FrozenSecurity Working Key FrozenNonce Not UniqueNonce Timestamp Out Of RangeLogical Unit Not SupportedInvalid Field In Parameter ListParameter Not SupportedParameter Value InvalidThreshold Parameters Not SupportedInvalid Release Of Persistent ReservationData Decryption ErrorToo Many Target DescriptorsUnsupported Target Descriptor Type CodeToo Many Segment DescriptorsUnsupported Segment Descriptor Type CodeUnexpected Inexact SegmentInline Data Length ExceededInvalid Operation For Copy Source Or DestinationCopy Segment Granularity ViolationInvalid Parameter While Port Is EnabledHardware Write ProtectedLogical Unit Software Write ProtectedAssociated Write ProtectPersistent Write ProtectPermanent Write ProtectConditional Write ProtectNot Ready To Ready Transition (Medium May Have Changed)Import Or Export Element AccessedPower On, Reset, or Bus Device Reset OccurredPower On OccurredSCSI Bus Reset OccurredBus Device Reset Function OccurredDevice Internal ResetTransceiver Mode Changed to Single EndedTransceiver Mode Changed to LVDI_T Nexus Loss OccurredMode Parameters ChangedLog Parameters ChangedReservations PreemptedReservations ReleasedRegistrations PreemptedAsymmetric Access State ChangedImplicit Asymmetric Access State Transition FailedCopy Cannot Execute Since Host Cannot DisconnectCommand Sequence ErrorToo Many Windows SpecifiedInvalid Combination of Windows SpecifiedCurrent Program Area Is Not EmptyCurrent Program Area Is EmptyIllegal Power Condition RequestPersistent Prevent ConflictPrevious Busy StatusPrevious Task Set Full StatusPrevious Reservation Conflict StatusPartition Or Collection Contains User ObjectsOverwrite Error On Update In PlaceInsufficient Time For OperationCommands Cleared By Another InitiatorIncompatible Medium InstalledCannot Read Medium - Unknown FormatCannot Read Medium - Incompatible FormatCleaning Cartridge InstalledCannot Write Medium - Unknown FormatCannot Write Medium - Incompatible FormatCannot Format Medium - Incompatible MediumCleaning FailureCannot Write - Application Code MismatchCurrent Session Not Fixated For AppendCleaning Request RejectedMedium Not FormattedMedium Format CorruptedFormat Command FailedNo Defect Spare Location AvailableDefect List Update FailureTape Length ErrorEnclosure FailureEnclosure Services FailureUnsupported Enclosure FunctionEnclosure Services UnavailableEnclosure Services Transfer FailureEnclosure Services Transfer RefusedRibbon, Ink, or Toner FailureRounded ParameterEvent Status NotificationESN - Power Management Class EventESN - Media Class EventESN - Device Busy Class EventSaving Parameters Not SupportedMedium Not PresentMedium Not Present - Tray ClosedMedium Not Present - Tray OpenMedium Not Present - LoadableMedium Not Present - Medium Auxiliary Memory AccessibleSequential Positioning ErrorTape Position Error At Beginning-of-MediumTape Position Error At End-of-MediumTape or Electronic Vertical Forms Unit Not ReadySlew FailurePaper JamFailed To Sense Top-Of-FormFailed To Sense Bottom-Of-FormReposition ErrorRead Past End Of MediumRead Past Beginning Of MediumPosition Past End Of MediumPosition Past Beginning Of MediumMedium Destination Element FullMedium Source Element EmptyEnd Of Medium ReachedMedium Magazine Not AccessibleMedium Magazine RemovedMedium Magazine InsertedMedium Magazine LockedMedium Magazine UnlockedMechanical Positioning Or Changer ErrorInvalid Bits In IDENTIFY MessageLogical Unit Has Not Self-Configured YetLogical Unit FailureTimeout On Logical UnitLogical Unit Failed Self-TestLogical Unit Unable To Update Self-Test LogTarget Operating Conditions Have ChangedMicrocode Has ChangedChanged Operating DefinitionINQUIRY Data Has Changedcomponent Device AttachedDevice Identifier ChangedRedundancy Group Created Or ModifiedRedundancy Group DeletedSpare Created Or ModifiedSpare DeletedVolume Set Created Or ModifiedVolume Set DeletedVolume Set DeassignedVolume Set ReassignedReported LUNs Data Has ChangedEcho Buffer OverwrittenMedium LoadableMedium Auxiliary Memory AccessibleRAM FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)Power-On or Self-Test FAILURE (Should Use 40 NN)Internal Target FailureSelect Or Reselect FailureUnsuccessful Soft ResetSCSI Parity ErrorData Phase CRC Error DetectedSCSI Parity Error Detected During ST Data PhaseInformation Unit iuCRC Error DetectedAsynchronous Information Protection Error DetectedProtocol Service CRC ErrorSome Commands Cleared By iSCSI Protocol EventInitiator Detected Error Message ReceivedInvalid Message ErrorCommand Phase ErrorData Phase ErrorInvalid Target Port Transfer Tag ReceivedToo Much Write DataACK/NAK TimeoutNAK ReceivedData Offset ErrorInitiator Response TimeoutLogical Unit Failed Self-ConfigurationOverlapped Commands AttemptedWrite Append ErrorWrite Append Position ErrorPosition Error Related To TimingErase FailureErase Failure - Incomplete Erase Operation DetectedCartridge FaultMedia Load or Eject FailedUnload Tape FailureMedium Removal PreventedSCSI To Host System Interface FailureSystem Resource FailureSystem Buffer FullInsufficient Reservation ResourcesInsufficient ResourcesInsufficient Registration ResourcesInsufficient Access Control ResourcesAuxiliary Memory Out Of SpaceUnable To Recover Table-Of-ContentsGeneration Does Not ExistUpdated Block ReadOperator Request or State Change InputOperator Medium Removal RequestedOperator Selected Write ProtectOperator Selected Write PermitLog ExceptionThreshold Condition MetLog Counter At MaximumLog List Codes ExhaustedRPL Status ChangeSpindles SynchronizedSpindles Not SynchronizedFailure Prediction Threshold ExceededMedia Failure Prediction Threshold ExceededLogical Unit Failure Prediction Threshold ExceededSpare Area Exhaustion Prediction Threshold ExceededHardware Impending Failure General Hard Drive FailureHardware Impending Failure Drive Error Rate Too HighHardware Impending Failure Data Error Rate Too HighHardware Impending Failure Seek Error Rate Too HighHardware Impending Failure Too Many Block ReassignsHardware Impending Failure Access Times Too HighHardware Impending Failure Start Unit Times Too HighHardware Impending Failure Channel ParametricsHardware Impending Failure Controller DetectedHardware Impending Failure Throughput PerformanceHardware Impending Failure Seek Time PerformanceHardware Impending Failure Spin-Up Retry CountHardware Impending Failure Drive Calibration Retry CountController Impending Failure General Hard Drive FailureController Impending Failure Drive Error Rate Too HighController Impending Failure Data Error Rate Too HighController Impending Failure Seek Error Rate Too HighController Impending Failure Too Many Block ReassignsController Impending Failure Access Times Too HighController Impending Failure Start Unit Times Too HighController Impending Failure Channel ParametricsController Impending Failure Controller DetectedController Impending Failure Throughput PerformanceController Impending Failure Seek Time PerformanceController Impending Failure Spin-Up Retry CountController Impending Failure Drive Calibration Retry CountData Channel Impending Failure General Hard Drive FailureData Channel Impending Failure Drive Error Rate Too HighData Channel Impending Failure Data Error Rate Too HighData Channel Impending Failure Seek Error Rate Too HighData Channel Impending Failure Too Many Block ReassignsData Channel Impending Failure Access Times Too HighData Channel Impending Failure Start Unit Times Too HighData Channel Impending Failure Channel ParametricsData Channel Impending Failure Controller DetectedData Channel Impending Failure Throughput PerformanceData Channel Impending Failure Seek Time PerformanceData Channel Impending Failure Spin-Up Retry CountData Channel Impending Failure Drive Calibration Retry CountServo Impending Failure General Hard Drive FailureServo Impending Failure Drive Error Rate Too HighServo Impending Failure Data Error Rate Too HighServo Impending Failure Seek Error Rate Too HighServo Impending Failure Too Many Block ReassignsServo Impending Failure Access Times Too HighServo Impending Failure Start Unit Times Too HighServo Impending Failure Channel ParametricsServo Impending Failure Controller DetectedServo Impending Failure Throughput PerformanceServo Impending Failure Seek Time PerformanceServo Impending Failure Spin-Up Retry CountServo Impending Failure Drive Calibration Retry CountSpindle Impending Failure General Hard Drive FailureSpindle Impending Failure Drive Error Rate Too HighSpindle Impending Failure Data Error Rate Too HighSpindle Impending Failure Seek Error Rate Too HighSpindle Impending Failure Too Many Block ReassignsSpindle Impending Failure Access Times Too HighSpindle Impending Failure Start Unit Times Too HighSpindle Impending Failure Channel ParametricsSpindle Impending Failure Controller DetectedSpindle Impending Failure Throughput PerformanceSpindle Impending Failure Seek Time PerformanceSpindle Impending Failure Spin-Up Retry CountSpindle Impending Failure Drive Calibration Retry CountFirmware Impending Failure General Hard Drive FailureFirmware Impending Failure Drive Error Rate Too HighFirmware Impending Failure Data Error Rate Too HighFirmware Impending Failure Seek Error Rate Too HighFirmware Impending Failure Too Many Block ReassignsFirmware Impending Failure Access Times Too HighFirmware Impending Failure Start Unit Times Too HighFirmware Impending Failure Channel ParametricsFirmware Impending Failure Controller DetectedFirmware Impending Failure Throughput PerformanceFirmware Impending Failure Seek Time PerformanceFirmware Impending Failure Spin-Up Retry CountFirmware Impending Failure Drive Calibration Retry CountFailure Prediction Threshold Exceeded (false)Low Power Condition OnIdle Condition Activated By TimerStandby Condition Activated By TimerIdle Condition Activated By CommandStandby Condition Activated By CommandPower State Change To ActivePower State Change To IdlePower State Change To StandbyPower State Change To SleepPower State Change To Device ControlLamp FailureVideo Acquisition ErrorUnable To Acquire VideoOut Of FocusScan Head Positioning ErrorEnd Of User Area Encountered On This TrackPacket Does Not Fit In Available SpaceIllegal Mode For This TrackInvalid Packet SizeVoltage FaultAutomatic Document Feeder Cover UpAutomatic Document Feeder Lift UpDocument Jam In Automatic Document FeederDocument Miss Feed Automatic In Document FeederConfiguration FailureConfiguration Of Incapable Logical Units FailedAdd Logical Unit FailedModification Of Logical Unit FailedExchange Of Logical Unit FailedRemove Of Logical Unit FailedAttachment Of Logical Unit FailedCreation Of Logical Unit FailedAssign Failure OccurredMultiply Assigned Logical UnitSet Target Port Groups Command FailedLogical Unit Not ConfiguredData Loss On Logical UnitMultiple Logical Unit FailuresParity/Data MismatchInformational, Refer To LogState Change Has OccurredRedundancy Level Got BetterRedundancy Level Got WorseRebuild Failure OccurredRecalculate Failure OccurredCommand To Logical Unit FailedCopy Protection Key Exchange Failure - Authentication FailureCopy Protection Key Exchange Failure - Key Not PresentCopy Protection Key Exchange Failure - Key Not EstablishedRead Of Scrambled Sector Without AuthenticationMedia Region Code Is Mismatched To Logical Unit RegionDrive Region Must Be Permanent/Region Reset Count ErrorDecompression Exception Long Algorithm IDSession Fixation ErrorSession Fixation Error Writing Lead-InSession Fixation Error Writing Lead-OutSession Fixation Error - Incomplete Track In SessionEmpty Or Partially Written Reserved TrackNo More Track Reservations AllowedCD Control ErrorPower Calibration Area Almost FullPower Calibration Area Is FullPower Calibration Area ErrorProgram Memory Area Update FailureProgram Memory Area Is FullRMA/PMA Is Almost FullDEFERRED CDBParametersError in %s, Offset %d, bit %dProgress Indicator: %dActual Retry Count: %dASC 0x%02x ASCQ 0x%02xDiagnostic Failure on Component 0x%02xDecompression Exception Short Algorithm ID OF 0x%02xTagged Overlapped Commands (0x%02x = TASK TAG)XS_SHORTSENSE DEC RZ55 (C) DECEMULEX MD21/S2 ESDIA00IBMRAID 0662SIBM 0663HIBM0664H3171-S2KZ-CDFRSS2FQUANTUM ELS85S iomegajaz 1GBMICROP4421-07SEAGATEST150176LW0002HPC3725SDCASSONY SDT-5000 3.WangDAT Model 1300 02.4Model 2600 01.7Model 3200 02.2CR-2801TE1.07CREATIVECD3630EAC101FX320Sq01GCD-R580B1.00MATSHITA CR-5741.021.06Memorex CRW-26421.0gSANYO CRD-256PSANYO CRD-254PSANYO CRD-S54P1.08CD-ROM CDR-S11.70CD-ROM CDR-N161.25UJDCD87301.14scsibusscsibus at %s: %d targetsscsibusattach: can't allocate target links%s: unable to register bio scsibusattach: can't allocate lun links, WWPN %016llx, WWNN %016llx, initiator %dPLEXTORCD-ROM PX-40TS1.01MICROP 1588-15MBSUN0669vendor-unique targ %d lun %d: <%s, %s, %s> ATAPIremovablefixed %d/%s %s%sscsibus_printlinkSCSI%ddirectsequentialprinterprocessorwormcdromscanneropticalchangercommunicationenclosure servicessimplified directscsibusprint: device type T_NODEVICE offlinescsibusprint: qualifier == SID_QUAL_BAD_LUscsibusprint: qualifier == SID_QUAL_RSVDscsi_probedevscsi_devidNEC CD-ROM DRIVE:260cd%s: WARNING: unable to establish power hook cdioctlATAPI CD-ROMSCSI CD-ROMdvd_authdvd_read_physicaldvd_read_copyrightdvd_read_bca%s: WARNING: unable to establish shutdown hook drive offline%lldMB, %lu bytes/sec, %lld sec totalsd_ioctl_inquiry(unknown)SCSI opticalSCSI disk%s %ssdgetdisklabel../../../../arch/arm/arm/softintr.csoftnet_intrhand != NULLsoftintr_establish: unknown soft IPL %dpxaippxaip_attach: failed to map CLKMAN: CPU clock = %d.%03d MHz pxaip_attach: failed to map RTCpxaip_attach_critical: failed to attach INTC!pxaip_attach_critical: failed to attach GPIO! addr 0x%lx intr %dpxa2x0_probe_sdram: impossibleWARNING: using filesystem date -- CHECK AND RESET THE DATE! pxa2x0_io_bs_alloc(): not implementedpxa2x0_io_bs_free(): not implementedpxaintc: Interrupt Controller stray interrupt %d intr_establish: bogus irq number %dintr_establish: can't malloc handler infocouldn't establish interruptirq %ldpxagpiopxagpio_reg_read: not bootstrappedpxagpio_reg_write: not bootstrapped: GPIO Controller %s: Can't map registers! pxa2x0_gpio_intr_establish: Pin %d not GPIO_IN%s: failed to hook main GPIO interrupt %s: unhandled GPIO interrupt. GPIO#%d pxa2x0_gpio_set_intr_level: bad level: %dpxaost%s: Cannot map registersclockpxaudc: cannot map mem space : USB Device Controller : unable to establish interrupt usbc: unable to establish connect interrupt pxaudc_read_epN: ep %d, no xfer fifo full when trying to set short packet ep%d: fifo error endpoint %d already used by %c%s: init failed, error=%d %s: cannot establish powerhook %s: unable to establish interrupt at irq %d: failed to map registers %d%s: Unknown depth (%d) apm%s: battery life expectancy %d%% %s: AC on,off,unknown, battery is undecoded (%x)highchargingCRITICALbackup power,%s: failed to create kernel thread, disabledapmevpxa2x0_apm_attach_sub: failed to map POWMAN apmlk%s: failed to map CLKMAN %s: failed to map MEMCTL %s: can't map GPIO pxa2x0_apm_sleep: can't map OST bogus new frequency 0 for rate %d maxclock %d manufacturer 0x%x%sproduct 0x%x function %d "pcmciapcmcia_card_attach%s: error %d detaching %s (function %d) (pcmcia_function_init: function is enabledpcmcia_function_enable: function not initialized@ %lx%s%lx%s%lx; iomask %lx, iospace %lx%s%lxunknown (%d)multi-functionserial portparallel portfixed diskvideo adapternetwork adapterauto incrementing mass storageSCSI bridgeSecurity servicesInstrumentSerial I/O Bus AdapterPCMCIA 1.0 PCMCIA 2.0 or 2.1 %s: CIS checksum failed %s: CIS version PC Card Standard %d.%d unknown (major=%d, minor=%d) %s: CIS info: %s: Manufacturer code 0x%x, product 0x%x %s: function %d: unspecified, ccr addr %lx mask %lx %s: function %d, config table entry %d: memory cardI/O cardcard type unknown; irq mask %x;%s: %d errors found while parsing CIS audio readonly powerdown irqlevel irqpulse irqshare io16 io8 bvd_active wp_active rdybsy_active mwait_required; maxtwins %d; memspacepcmcia_parse_cis_tupleSVECFD605 PCMCIA EtherNet CardV1-1%s: using CIS quirks for AmbiCom IncAMB8002TPMX PE-200DIGITALDEPCM-XXPCMCIAUE2212D-LinkDE-660DE-660+RPTI LTD.EP400CISV100RPTIEP401 Ethernet NE2000 CompatibleACCTONEN2212ETHERNETW89C926Seiko Epson Corp.P/N: EEN10B Rev. 00CNetCN40BC EthernetNE2000FastEthernetLNT-10TNNDC004743118001TAMARACKGVCNIC-2000pR01Ethernet CardiPort10/100 Ethernet CardFast-EthernetETHER-C16Fast EthernetPCMCIA LANCF10Base-EthernetLinksysEtherFast 10/100 Integrated PC Card (PCM100)Ver 1.0DE-650I-O DATAPCET/TX-RDFE-670TXDLINKSYSE-CARDPCLAcorega K.K.corega Ether PCC-Tcorega Ether PCC-TDcorega EtherII PCC-Tcorega EtherII PCC-TDcorega FastEther PCC-TXcoregaFEther PCC-TXFcorega FEther PCC-TXDSMC8041TX-10/100-PC-Card-V2XircomCompactCard EthernetCFE-10: no suitable config entry port 0x%lx/%d, %s: can't match ethernet vendor code : can't map ASIC I/O space : can't map NIC I/O space : function enable failed : can't get subregion for asic : unexpected I/O space configuration %s: can't map mem for enet addr %s: can't alloc mem for enet addr %s: can't alloc mem for LAN iobase %s: can't map mem for LAN iobase Digital Mobile Media CD-ROMPortable CD-ROM DriveNinjaATA-EXP PnPIDEF1SHUTTLE TECHNOLOGY LTD.PCCARD-IDE/ATAPI Adapter: can't handle card info port 0x%lx/%lu: %scan't allocate memory for command queue ,0x%lx/%lu: can't map second i/o space : can't map first i/o space %s: couldn't enable PCMCIA function %s: couldn't establish interrupt handler %s%s %s: can't establish interrupt : can't map i/o space : can't alloc i/o space Wireless LAN PCC-11Wireless LAN PCCA-11corega_K.K.Wireless_LAN_PCCB-11WL PCCL-11ISL37300PWLCFL-11INTERSILHFA384x/IEEEVersion 01.02SMC2632WNANOSPEEDNECWireless Card CMZ-RT-WPVersion 01.01NTT-ME11Mbps Wireless LAN PC CardAddtronAWP-100 Wireless PCMCIACabletronRoamAbout 802.11 DSIntersilPRISM 2_5 PCMCIA ADAPTEREval-RevASymbol TechnologiesLA4111 Spectrum24 Wireless LAN PC CardPLANEXGW-NS11H Wireless LAN PC CardD-Link CorporationD-Link DWL-650H 11Mbps WLAN AdapterAllied Telesis K.K.WR211PCM: %d slot%s pxapcicpxapcic_mem_map: bogus kind%s: unable to create event thread for %s pxapcicevpxapcicsspcic_attach_card: already attachedpxammc: can't map regs mmccd: MMC/SD/SDIO controller sdmmc%s: can't attach bus : can't establish MMC interrupt : can't establish card interrupt %s: unsupported bus frequency of %d KHz %s: data not a multiple of %d bytes mmcmdmmclklcdzkbd: unable to establish powerhook : PCMCIA/GPIO controller : failed to map %s Unable to establish %s powerhookwd0%s: can't map memory %x for scoop%s: invalid CF slot %dscoop_pcic_read: bogus registerscoop_pcic_write: bogus registerscoop_pcic_set_power: bogus power statescoop_mmc_set_power: unsupported OCR (%#x) zssp: can't map bus space %s: can't establish power hook zssp_ic_send: invalid IC %d zssp_read_ads7846: not configured apm_acapm_bczts%s: enable failed : <%s> %s: %d-sector PIO, LBA, %lluMB, %llu sectors %s: freeze lock command didn't complete wdattach%s: enable write cache command didn't complete %s: enable look ahead command didn't complete CHS, %lluMB, %d cyl, %d head, %d sec, %llu sectors LBA48, %lluMB, %llu sectors %s: IDENTIFY failed __wdstart: bad return code from wdc_ata_bio()wddone%s: soft error (corrected) , retrying device faultdevice timeoutST506/MFM/RLLESDI/IDE diskwddumpwddump: try againwddump: device timed outwddump: unknown error typewddump: %swddump: drive faultwddump: DMA errorwddump: polled command has been queuedwd_get_params: bad return code from ata_get_paramsST506%s: flush cache command didn't complete %s: flush cache command: drive fault %s: flush cache command timeout wdc%s:%d:%d: not ready, st=0x%b, err=0x%02x BSYDRDYDWFDSCDRQCORRIDXERR%s:%d:%d: timeout waiting for DRQ, st=0x%b, err=0x%02x %s:%d:%d: bad state %d in _wdc_ata_bio_start _wdc_ata_bio_start: bad state%s:%d:%d: intr with DRQ (st=0x%b) %s:%d:%d: read intr before drq %s:%d:%d: device timeout, c_bcount=%d, c_skip%d %s:%d:%d: bad state %d in wdc_ata_bio_intr wdc_ata_bio_intr: bad statewdc_ata_ctrl_intr: state==RECALrecal%s:%d:%d: %s drive fault error (%x) %s:%d:%d: %s timed out piomodedmamodegeometryno media/write protectedinterface CRC erroraddress mark not foundtrack 0 not foundaborted commandmedia change requestedid not foundmedia changeduncorrectable data errorbad block detectederror not notifiedwd0aboot device: lookup '%s' failed. boot device: %s wsdisplay%s: screen %d-%d added (%s, %s emulation) %s: screen %d deleted wsdisplay at %s mux %d: console (%s, %s emulation), using %sdmuxwsdisplay_common_attach: no memorywsdisplaytty() on ctl devicewsdisplay_switch2: giving up wsdisplay_switch2: screen %d disappeared wsdisplay_switch2: not switching wsdisplay_switch2: invalid screen %dwsdisplay_switch1: screen %d disappeared wsdisplay_switch1: not switching wsdisplay_switch1: invalid screen %dwswaitwsmoused_sleep%s: couldn't allocate copy buffer wsevent_readwskbdwskbd at %s%s: attach error=%d : console keyboardcannot load keymapwskdetwskbd_detach: %s didn't detach %s: event queue overflow %s: connecting to %s %s: disconnecting from %s wskbd_get_mapentry: %d(%d): bad entrywskbd_load_keymap: %d(%d): bad entrywskbd_load_keymap: %d: recursion too deepwsmousewsmouse at %s attach error=%dwsmdetwsmouse_detach: %s didn't detach wsmux: attach out of memory wsmux_getmux: no memory for mux %d wsemul_vt100_output_c0c1: ESC in kernel output ignored \[>24;20;0cP0!u%5\wsemul_vt100_handle_csi[?62;6c[%d;%dR[?13n[?21n[?27;1nP2$u/wsemul_vt100_handle_dcs: bad type %d[11~[12~[13~[14~[15~[17~[18~[19~[20~[21~[23~[24~[25~[26~[28~[29~[31~[32~[33~[34~OPOQOROSOpOqOrOsOtOuOvOwOxOyOIOMOD[7~OBOCOA[8~[6~[3~[2~[5~[4~[1~OjOkOlOmOnOorasops_init: couldn't lock font rasops_init: font table is empty rasops_init: fontwidth assumptions botched!fontwidth not 8/12/16 or RASOPS_SMALL - fixme!wsfont_unlock: font not lockedpre 1.01.12.0usb: USB revision %s, not supported usb_attach%s: can't register softintr %s: root device is not a hub %s: root hub problem, error=%d usbtaskunable to create event thread for %sunable to create usb task threadusbevtconfigusbtskusb at %susbreausbreadusbd_add_dev_eventusbd_add_drv_eventusb_add_eventusb_detachusbdet%s: event thread didn't die usbpalockusbsynusbd_transfer: not doneusbd_start_next: error=%d usb_desc_iter_next: descriptor length = 0 usb_desc_iter_next: descriptor length too large usb_desc_iter_next: bad descriptor usb_detach_wait: %s didn't detach NORMAL_COMPLETIONIN_PROGRESSPENDING_REQUESTSNOT_STARTEDINVALNOMEMCANCELLEDBAD_ADDRESSIN_USENO_ADDRSET_ADDR_FAILEDNO_POWERTOO_DEEPIOERRORNOT_CONFIGUREDTIMEOUTSHORT_XFERSTALLEDINTERRUPTEDXXXvendor 0x%04xproduct 0x%04x%x.%02x"%s %s", class %d/%d rev addr %dusbd_devinfousbdly0 lengthout of datausbd_fill_iface_data: bad descriptor(s): %s iface descusbd_set_config_index%s: device addr %d (config %d) exceeds power budget, %d mA > %d mA %s: port %d, set config at addr %d failed %s: No free USB addresses, new device ignored. usbd_new_device: cannot find HS port configuration %d interface %d port %duhub%s: hub depth (%d) exceeded, hub ignored uhub_attach%s: no ports, hub ignored %s: bus powered hub connected to bus powered hub, ignored %s: no interface handle %s: no endpoint descriptor %s: bad interrupt endpoint %s: port %d power on failed, %s %s: cannot open interrupt pipe %s: port %d reset failed %s: device problem, disabling port %d %s: strange, connected port %d has no power %s: illegal enable change, port %d %s: port error, giving up port %d %s: port error, restarting port %d hid_start_parsedefault bType=%d Local bTag=%d Main bTag=%d Global bTag=%d BAD LENGTH %d , %d report id%s%s: no memory %s: no input interrupt endpoint %s: unexpected endpoint %s: could not read endpoint descriptor uhidev%s: no report descriptor %s: iclass %d/%duhid at %s reportid %duhidev_intr: bad repid %d uhidev_set_report_asyncuhidevwiuhid: input=%d, output=%d, feature=%d uhid_do_readuhidreauhid_do_ioctlukbd %s: attach failed, %s %s: was console keyboard too many modifier keysbad modifier sizemultiple key code arrays key codes not on byte boundarytoo many key codeskey code size != 8umassCBIBulk-OnlyRBC%s: using %s over %s %s: atapiscsi not configured %s: command protocol=0x%x not supported %s: bus attach failed %s: isdata not configured SCSIUFIISD-ATACBI with CCI%s: got polled xfer %p, but %p already pending %s: BBB bulk-%s stall clear failed, %s %s: Invalid CSW: sig 0x%08x should be 0x%08x %s: Invalid CSW: tag %d should be %d %s: Invalid CSW: status %d > %d %s: Phase Error, residue = %d %s: BBB reset failed, %s %s: BBB bulk-in clear stall failed, %s %s: BBB bulk-out clear stall failed, %s %s: transferred %d bytes instead of %d bytes%s: Unknown state %d%s: CBI bulk-in/out stall clear failed, %s %s: CBI intr-in stall clear failed, %s %s: CBI reset failed, %s %s: CBI bulk-in stall clear failed, %s %s: CBI bulk-out stall clear failed, %s umass_cmd: large datalen, %d %s: Unknown status %d in umass_scsi_cbaue%s: EEPROM read timed out %s: MII read timed out %s: reset failed %s: setting config no failed auemii%s: getting interface handle failed %s: missing endpoint %s: address %s %s: couldn't get endpoint descriptor %d %s: no memory for rx list -- packet dropped! %s: %u usb errors on intr: %s %s: %u usb errors on rx: %s %s: usb error on tx: %s %s: aue_send error=%s %s: tx list init failed %s: rx list init failed %s: open intr pipe failed: %s %s: open tx pipe failed: %s %s: open rx pipe failed: %s %s: watchdog timeout %s: close intr pipe failed: %s %s: abort intr pipe failed: %s %s: close tx pipe failed: %s %s: abort tx pipe failed: %s %s: close rx pipe failed: %s %s: abort rx pipe failed: %s axeaxe%d: read PHY failed axe%d: write PHY failed %s: media change failed axe_setmultiaxemii AX88172 AX88772 AX88178%s: couldn't get ep %d %s: usb errors on rx: %s axe%d: usb error on tx: %s axe%d: rx list init failed axe%d: open rx pipe failed: %s axe%d: open tx pipe failed: %s axe%d: tx list init failed axe%d: watchdog timeout axe%d: close intr pipe failed: %s axe%d: abort intr pipe failed: %s axe%d: close tx pipe failed: %s axe%d: abort tx pipe failed: %s axe%d: close rx pipe failed: %s axe%d: abort rx pipe failed: %s cue%s: read MAC address failed %s: cue_send error=%s kue%s: warm boot, no firmware download %s: failed loadfirmware of file %s: errno %d %s: cold boot, downloading firmware %s: failed to load trigger segment: %s %s: failed to load fixup segment: %s %s: failed to load code segment: %s %s: loading firmware failed %s: could not read Ethernet descriptor %s: no memory for multicast filter buffer %s: kue_send error=%s cdce%s: no data interface %s: could not find data bulk out %s: could not find data bulk in %s: no descriptor for bulk endpoint %d %s: interface alternate setting %d failed %s: no descriptor for interrupt endpoint %d extra ethernet descriptor %s: close interrupt pipe failed: %s %s: abort interrupt pipe failed: %s %s: open interrupt pipe failed: %s %s: too many errors, disabling %s: usb error on rx: %s udavudavmiiudav_setmulti%s: udav_send error=%s upl%s: upl_send error=%s urlurlmii%s: couldn't get endpoint %d %s: failed to get interface, err=%s %s: url_send error=%s %s: %s: bad register %04x wi_usb%s: open pipes failed %s: already detached %s:%s: invalid packet id sent %x invalid packet len: %x memsz %x max %x %s: %s: error=%s write_record buf size err %x %x wiTXsync%s: %s error=%s UGH RX UGH TX wi_usb: received USB_BUFAVAIL packet wi_usb: received USB_ERROR packet wiIDLwitxlwiusbthrural%s: could not set configuration no %s: could not get interface handle %s: MAC/BBP RT%04x (rev 0x%02x), RF %s, address %s %s: no endpoint descriptor for iface %d %s: could not allocate tx buffer %s: could not allocate tx xfer %s: could not allocate rx mbuf cluster %s: could not allocate rx mbuf %s: could not allocate rx buffer %s: could not allocate rx xfer %s: could not allocate beacon %s: could not transmit beacon %s: could not transmit buffer: %s ural_rxeofural_tx_data%s: could not allocate protection frame %s: could not read EEPROM: %s %s: could not read MAC register: %s %s: could not write MAC register: %s %s: could not write to BBP %s: could not read BBP %s: could not write to RF RT2522RT2523RT2524RT2525RT2525eRT2526RT5222%s: timeout waiting for BBP %s: could not allocate AMRR xfer %s: could not allocate Tx list %s: could not allocate Rx list %s: could not queue Rx transfer %s: could not open Rx pipe: %s %s: could not open Tx pipe: %s %s: timeout waiting for BBP/RF to wakeup %s: could not retrieve Tx statistics - cancelling automatic rate control usbf%s: can't establish softintr %s: usbf_new_device failed, %s %s: can't create task thread set config activated %s %s, rev %d.%02d/%d.%02dusbf_devinfo_allocusbf_allocmemusbf_start_next: %s cdcefOpenBSD.orgCDC Ethernet Emulation: usbf_add_config failed : usbf_add_interface failed : usbf_add_endpoint failed : usbf_add_config_desc failed : usbf_end_config failed : usbf_alloc_buffer failed : usbf_open_pipe failed : usbf_transfer failed : address %s cdcef_do_request %s: usbf_transfer failed encap error mii_attach: phyloc and offloc specifiedmii_activate: phyloc and offloc specifiedmii_activate: DVACT_ACTIVATE%s: config_activate(%d) failedmii_detach: phyloc and offloc specifiedOUI 0x%06x model 0x%04x rev %d at %s phy %dmii_phy_setmedia: MASTER on wrong mediamiiautnsphyDP83840 10/100 PHY: %s, rev. %d nsphyterDP83815 10/100 PHYDP83843 10/100 PHYDP83847 10/100 PHYqsphyQS6612 10/100 PHYinphyi82555 10/100 PHYi82562EM 10/100 PHYi82562ET 10/100 PHYi82562G 10/100 PHYiophyi82553 10/100 PHYeephy88E1000 1 Gigabit PHY88E1000 2 Gigabit PHY88E1000 3 Gigabit PHY88E1000 4 Gigabit PHY88E1000S Gigabit PHY88E1011 Gigabit PHY88E1111 Gigabit PHY88E1112 Gigabit PHY88E1116 Gigabit PHY88E1116R Gigabit PHY88E1118 Gigabit PHY88E1149 Gigabit PHY88E3016 10/100 PHY88E3082 10/100 PHY88E1000 5 Gigabit PHY88E1000 6 Gigabit PHY88E1000 7 Gigabit PHYexphyxl: 3Com internal media interface %s: ignoring this PHY, non-zero instance exphy_service: can't isolate 3Com PHYrlphyRTL8201L 10/100 PHYIP101 10/100 PHYrl: RTL internal PHY rlphy_service: attempt to isolate phylxtphyLXT970 10/100 PHYLXT971 10/100 PHYmtdphyMTD972 10/100 PHYicsphyICS1890 10/100 PHYICS1892 10/100 PHYICS1893 10/100 PHYsqphy80220 10/100 PHY80225 10/100 PHY84220 10/100 PHYtqphy78Q2120 10/100 PHYukphy: Generic IEEE 802.3u media interface, rev. %d: OUI 0x%06x, model 0x%04x %s: no media present bmtphy3C905B internal PHY3C905C internal PHYBCM4401 10/100baseTX PHYBCM5201 10/100 PHYBCM5214 Quad 10/100 PHYBCM5220 10/100 PHYBCM5221 100baseTX PHYBCM5222 Dual 10/100 PHYamphyAm79C873 10/100 PHYDM9101 10/100 PHYDM9102 10/100 PHYDM9601 10/100 PHYAm79C875 quad PHYacphyAC101 10/100 PHYAC101L 10/100 PHYAC_UNKNOWN 10/100 PHYnsgphyDP83861 10/100/1000 PHYDP83865 10/100/1000 PHYDP83891 10/100/1000 PHYurlphy: RTL internal phy %s: %s: enter down%s: %s: link %s mmcdiemmctsk%s: can't enable card %s: no functions %s: can't supply bus power %s: can't supply clock %s: can't identify card %s: mem init failed %s: i/o init failed mmcdlySpectecSDIO WLAN CardSDW-820%s: bad CIS ptr %#x %s: CISTPL_VERS_1 too short %s: bad CISTPL_FUNCID length %s: bad CISTPL_MANFID length %s: CIS parse error at %d, tuple code %#x, length %d %s: CIS version %d.%d wireless network adapter%s(%sat %s%s: can't supply voltage requested by card %s: can't send I/O OCR %s: can't set I/O RCA %s: can't select I/O RCA %d %s: can't read CIS %s: can't set mem RCA %s: unknown SD CSD structure version 0x%x %s: unknown MMC CSD structure version 0x%x %s: unknown MMC version %d %s: can't attach scsibus %s: can't allocate ccbs getccbSD/MMC Drive #%02dsdmmc_scsi_cmd%s: out of ccbs ,Eid'(3 p@ @@ @ , 9|8888988 $:8888888$:8888 88 8  ,.,('&F!"% #1 0:D:4::b0b4::b b@:H:b(b4::@bTb:,:|bb:,:bb@:H:bb\:L:bb\:L:,b@b|:L:b::L:b:l:L:b:L:L:Hb\b\:L:b:\:L:bb:0: cd::4:cc:4:c::4:`ctc\:L:cc\:L:cc\:L:cc\:L:cc\:L:Dcc\:L:Xclc\:L:cb\:L:cc\:L:cc:8:cc:<: cc:&:x cd c:P:88Xc4:X: ̐8Xc4:@: XcXc4: :!8Zc4: :!80Zc:D:/8lZc:D:/88Zc4: :!8Zc4: :!`8Zc4: :!t8Zc4: :! 8Zc4: :!p8[c4: :!8_c4: :!ȵ88_c4: :!ܵ8L_c4: :!<8:4: :! 8_c4: :!_c_c4:`:0_c_c4:T:0`c,`c: :1@`cT`c: :1h`c|`c: :1`c`c: :1`c`c: :1`c`c: :1acac: :10acDac: :1Xaclac: :1acac: :1acac: :1acac: :1ac bc: :1 bc4bc: :1Hbc\bc: :1pbcbc: :1bcbc: :1bcbc: :1bccc: :1cc(cc4:\::$8,848:@84<(d'$"""d   `   D x80B F 4I O M 0N H9 i u U | ? 7nl8THIS is A memory TEST pattern8%%K  , 8     `!l!!`!p!t!!!!*!*!,!!*!+!4+!+!,!!+!+!8,!@,!,!!.!,/!80!T0!p,!!,!,!.!.!p,!!2!T5!|5!6!,!P6! @ @   )X^!^!_!_!8$f!_!h!W!X!(]!X]!3$23:x "h" " "" g8#8v$L 9$8."8."8$/"8:80" 8|*"T9@."8/"8x."V9\." 9."$8P/",8l/"48/"<8/"D8/"L8_"X80"`8/"h88y"7:2"p82"<83"x8$3"8<3"8T3"8!9="89"P:9"8 @"9u"P9z"8z"8(*"9(*"8L*"8x"8x"8e"8e"8hf"08hf"8e"8e"8e"8$4"8\1"8#8v$ 8:8:8,0"$8G",8l3"8H4"l7"7"8" 9"9"9"xx$g$gP:,Eih8̕:(v"p88:(v"x8ȕ:(v"8:(v"8ĕ:(v"8:(v":5g ##$P^gP^g"t"""PX""TF","PN8"RR"CE"ST"NM""CLH"0PLH"0RE"@RR"CE"ST"SL"RR"CE"ST"ER"CE"ST"Ե:P<%:":P<%:P<%:":"(:"4:H"@:("L:"X:P<%d:T"p:\":\~&:X<%:P<%:8":P<%Ķ:P<%ж:P<%ܶ:h":":":& :@":"$:"0:"<:"x:"H: ":,"T:<"`:P<%:&Tdgd:Ե:4'(:"4:H"@:(" :@":"$:"0:"H: ":,"Pdg:L#h:4X#h:native18ț:@#|1@##,7@7native18ț:#|1$,7@7888$#4# =% @% |&H##$& &$&l& &' 's/ $ $̺#l&D&##4#$ 8& && & %& $&h&$&H'&l#$#$<#DT%#4%$ P#h##@#h#$(## C%~$'& @& t#'D&$$$$#$$..$$(/ / /$$ .#8### `g$$$Lf$$$$=#$ @?#G%$ ' 0# & & $#$$1 &!&H&$ $$$8#$ $ $$Xc$#"&$ 4>% XA%c$ ('x'$ ##H '$$V#&,&L!&&D'@''$he$ $$$$$$ #l&$ $$$$$$$$$$$&$$$2$$$$$$$'p'$$$$$$###$$$$$$$&I# 8]/$#h#' .$&x '| ' $//$'#J.$$$$$$$$$$$$$$$$$$$$$$$t`$`$8a$$$$$$a$$$$$$$$$$ T/Ў# `P%P# '# /$$$ $$$$&&$$'4'`#a#L// ,'&$$$$$$$ # # h# #$ .Z##$$h&I#&&$$$HP$$$$$$ ('d$ @&&H&&)&*&k#k#k#k#[#l#`l#[#(\#L\# ]#x]#x[#^#_#_#:::::: :  0 $$L$::: : :d88`P$@B(8x:\::Ԭ::L::ĭ::0:<:x:0:0: t8d:989L9$ $<:8$L$ (" d 99, 9 9h 908p 979t 99| 988`959 9d.98x8 98:8": 959 88 9(9 9:$8x899(X%,Z%]%4^%Pa%$_%_%a%pb%a%b%c%c%c%e%% g%g%ttyclsttyopnttybgttyinttyout@%Ȃ%`%%g%<%p%h%%h%%l%0<%0<%0<%0<%%0<%0<%\%0<%0<%0<%0<%%0<%0<%\%0<%0<%0<%0<%%0<%0<%\%0<%0<%0<%0<%%0<%0<%\%0<%0<%0<%0<%%0<%0<%\%0<%0<%0<%0<%%0<%0<%\%0<%0<%0<%0<%%0<%0<%\%0<%0<%0<%0<%%0<%0<%\%0<%0<%0<%0<%%0<%0<%\%   $0@9:(*&:(*&4((( (t96&x=&X::,%X%,%%%%PF8ffsF8ext2fsи7cd96607msdos:::P:@:p:::л::p:&&2lockf@` l9t9|999999999999999999999 9 Ե:P<%:X<%:$& :&:X<%$:0&0:8&H:L&:@&g\:''('h '!'' '9` 9p 9| 9 9 9 9 9 9 9 9 9 9 9!9!9!9(!94!9@!9L!9X!9d!9p!9|!9!9!9!9!9!9!9!9!9!9"9"9 "9Ե:x::::::::(:4:@:L:X:d:p:|::::::Ķ:ж:ܶ:::: ::$:0:<:H:T:`:l:Ե:P<%:p&:T4':T4':82':X<%(:L4'4:L4'@:L4'L:@2'X:2'd:2'p: 3':X<%:T4':T4':T4'Ķ:T4'ж:T4'ܶ:T4':L4':L4':T4' :X<%:X<%$:3'0:8&<:3'x:3'H:,4':@&T:L4'`:L4':X<%g(:Ե:P<%:p&:D':D':4':|@'(:B'4:8B'@:hB'L:L7'X: ;'d:='p:>'|:>':\~&:L?':D':D':D'Ķ:D'ж:D'ܶ:D':D':D':D' ::':X<%$:0&0:8&<:&x:@'H: C':@&T:LC'`:C':&gH:. .. Ե:P<%:Dw':t':|':':'(:'4:H'@:0'L:ȥ'X: 'd:į'p:̯':د': ':':'Ķ: 'ж:'ܶ:ؼ':':':& :@_':^'$:'0:'<:'x:l'H:':'T:'`:8':&hg: 'l' :0123456789abcdef^^33338<(=(#$%&'()*+ʚ;,-.ʚ;/ʚ;0ʚ;1@B2 T3 T4 T56 T7 Tcde@B@B@KLاO[@T6nQ%l7Jpp@@@@j j j @          )9)99'9'9(9(9((99 Ŀ:(:(((8(( ()l-9|(:(:d,2:\**|*4**:++x*+H++:,,+,}+++n++l+:t + +++:ܵ* +++*|*:h+ +++(+:)h+ +++:v* +++t*}*~**:t + +++d +?9::( dX:::::}E#(D<8Q @X,:::::::::X::\:`:d:h:l:p:x:t:|::::/dev/null 2>&1 || { echo "FAILED." ; exit ; } echo "OK." echo -n "Mounting root filesystem (mount -o ro /dev/$ROOTDEV /mnt)..." mount -o ro /dev/$ROOTDEV /mnt || { echo "FAILED." ; exit ; } echo "OK." for _f in fstab hosts myname; do [[ -f /mnt/etc/$_f ]] || { echo "No /mnt/etc/$_f!" ; exit ; } cp /mnt/etc/$_f /tmp/$_f done hostname $(stripcom /tmp/myname) THESETS="$THESETS site$VERSION-$(hostname -s).tgz" enable_network manual_net_cfg startftplist munge_fstab check_fs umount /mnt || { echo "Can't umount $ROOTDEV!" ; exit ; } mount_fs install_sets finish_up  . .. bin@ dev etc mntAmnt2-\Ƣsbin-\ tmpB usrvarinstbin.profile+ install.mdupgrade install  install.sub MDXDM=y md_installboot() { } md_prep_fdisk() { local _disk=$1 _q _d while :; do _d=whole if [[ -n $(fdisk $_disk | grep 'Signature: 0xAA55') ]]; then fdisk $_disk if [[ -n $(fdisk $_disk | grep '^..: A6 ') ]]; then _q=", use the (O)penBSD area," _d=OpenBSD fi else echo "MBR has invalid signature; not showing it." fi ask "Use (W)hole disk$_q or (E)dit the MBR?" "$_d" case $resp in w*|W*) echo -n "Setting OpenBSD MBR partition to whole $_disk..." fdisk -e ${_disk} <<__EOT >/dev/null reinit update write quit __EOT echo "done." return ;; e*|E*) cat <<__EOT You will now create a single MBR partition to contain your OpenBSD data. This partition must have an id of 'A6'; must *NOT* overlap other partitions; and must be marked as the only active partition. Inside the fdisk command, the 'manual' command describes all the fdisk commands in detail. $(fdisk ${_disk}) __EOT fdisk -e ${_disk} [[ -n $(fdisk $_disk | grep ' A6 ') ]] && return echo No OpenBSD partition in MBR, try again. ;; o*|O*) return ;; esac done } md_prep_disklabel() { local _disk=$1 _f _op md_prep_fdisk $_disk disklabel -W $_disk >/dev/null 2>&1 _f=/tmp/fstab.$_disk if [[ $_disk == $ROOTDISK ]]; then while :; do echo "The auto-allocated layout for $_disk is:" disklabel -h -A $_disk | egrep "^# |^ [a-p]:" ask "Use (A)uto layout, (E)dit auto layout, or create (C)ustom layout?" a case $resp in a*|A*) _op=-w ; AUTOROOT=y ;; e*|E*) _op=-E ;; c*|C*) break ;; *) continue ;; esac disklabel -f $_f $_op -A $_disk return done fi cat <<__EOT You will now create an OpenBSD disklabel inside the OpenBSD MBR partition. The disklabel defines how OpenBSD splits up the MBR partition into OpenBSD partitions in which filesystems and swap space are created. You must provide each filesystem's mountpoint in this program. The offsets used in the disklabel are ABSOLUTE, i.e. relative to the start of the disk, NOT the start of the OpenBSD MBR partition. __EOT disklabel -f $_f -E $_disk } md_congrats() { val=`ztsscale` case $? in 0) grep -v '^mouse\.scale.*$' /mnt/etc/wsconsctl.conf \ >/tmp/wsconsctl.conf echo $val " # see ztsscale(8)" >> /tmp/wsconsctl.conf cp /tmp/wsconsctl.conf /mnt/etc/wsconsctl.conf grep -v '^machdep\.ztsscale.*$' /mnt/etc/sysctl.conf \ >/tmp/sysctl.conf cp /tmp/sysctl.conf /mnt/etc/sysctl.conf ;; esac } md_consoleinfo() { local _u _d=com for _u in $(scan_dmesg "/^$_d\([0-9]\) .*/s//\1/p"); do if [[ $_d$_u == $CONSOLE || -z $CONSOLE ]]; then CDEV=$_d$_u CPROM=com$_u CTTY=tty0$_u return fi done } ELFa(d4"4 (^L^L`L`L`LGG\\\<<m444OpenBSD -LP@0! MP@ -ؠ0 p `p0@SLP0 I/#P000 h0S 0P *0 0 0 R P: 00 값  0S S 0-``LM  0@S @1S@D0Q@Dt @Dt0鄑4 -880 0 LR@ 00S( -鄠LM| 0S hh00\0P 0S<0lt000S 꼐 8$ -(( 0S 008 -LM`pQ 0S5/㒓p@PPPQ P Q088 8Q  pLDg\gx p-PLM@@P` ph 0-@L PP \jTm2 0OSP8  (0|0SPjpLxdg\g` -䢟䒟<LMP000ȂS09 ?pP=v w@T` 8K0  \ Xn TŸ8 7 R<Ÿ8 0a 08 Z0000S0A  10S000 B \j 10S0 S+ 10S 1!0!0Sx!p1  !h 7000D81810(10S0 `R PpU S00SRU!S0p0 @0S 0S  0<0 @0S 0Sp S,d tiLj(hj|j jjh ljk,kHkpk -LZ 00,d -LO0頠 -LG P00霠 -L<0N -0L000(,0, -0L00(d0d -Lp0鄠 -Lh0L -LLSk 0-LMK PFjp@81 0W  R@ 0b0CS$꼋ȋԋ0D0E0J0AS00 0xS S *S 0S ", 0 $R0 R0 Ĉjk p-LM KP" qr1 SW PY 0b0CS5@Xp`P$K4`P%%K5 `P*%F:`P!%O1 VU00 0xS S *S`P0E" $ VU "0 0 (~R0 yRp Ĉjk 0-x0LP h0   aAq 0A0q08@0P 0R0 : 0騠,d0 R0 ,d - L >RĈN - L 5RĈN - L ,RĈN - L #RĈN -LMd5\5TwP00s D@00Cs0 00Cs0c㷡̚$N -8rLP,20  %WP ,10S0q QP1000 A0! 1WP0 1!V0P00 t1VLQPa` \10S 0@ (P4 $A0P 0(P 0 (PV0  Rp: P 0 0; S0`@%,"V@0h0Q XkQPhc,Nkdk(Ĉll l̠ 0-LM@KVP tU0: S\4 KP3P0000 0<pq0S0000Ĉm @ 0-L1 R 1 0Su*Q  1Q   .A ɟP 0!0  tuU l^0 0T<8Q0 0 0 0  P0    00 00000 0000 @0  W00 \D L000 T0 0 00(00霠(,Ĉd -0LM 0RE0RQ0R_ x00 l@ R R*T bQ  .00,00S h餠l h(d -`1LMP``p@Q ^P@  . #0S@ T0/T0V000 0T0 0 0 0S00[f 0pd  t!PP@0 fR `!* 00 0Rb9,0 00d8lĈ$Llpl -pLuM0d yK,0 a 1b1 P a!  B=9! = 1 . P@0 r/ p`Pno JP PoOK 0!dPP A - R  x1 RtVOKd0`!A -  R ,1,R@Kd0!w?KAq-v?K!00/C#b10 e+ 0 됀K p`0d wKP뉁M- @v?K 800 ,0SD,O.A?̠lllllMbl0m -LM(@N%@ -LG4 -0L0P0 `@%,"0:p7q / 30p`0-  P 0 pWp@0P`p 0S0C0X OT00  Z <g  uS0,LN8m(Ĉ -L Mȡ00 `@%,"0D:pbq`C 2[ 8c8d0 K00 , h1PQ4 `0pSI 0SF 倝PQ4"`0 K03K,` K1p  @0 pR' 0S$ <]0`PP  l S@0 pR<0 0S@0p R 0SdmĈ -MLM2 P` p( 堤 h"_p?@Y 4PDğğğğğğğğğğğğğğğğğğğğğğğğğğğğğğğğğğğğğğğğğğğğğğğ̟ppppI.KL1 BH BbT(JK L@1$Rp *0 PbUa=B^KPEPE@P 4 04 04 I>K0C 0CD $ 0t , PP0-S  TM0HM <OR0$,JR㈝댑Hn<TmTn\nnnn -L0B %tnx -LM`PP( @(K,pK 0  (0@S$R -L M0@p00 0Si PP 0S nSZ =P0`0@Q 4P QLQJ  0V0P 1 0* Y0  0000V 0`0!00 ,K, ?R0S@p @0"Sl 04MY000 LPH00D 0oSP M5noo,oHo -霣圃LxMP@`p#^pA P0@$S3̤ؤ`p2`2`p222 R2l2|"0QAPc<2 R 82 RpK9EP`,r 0Sp ^%P g `P? pKP^PX0: S SK QPB1 R 0 5 |P) `^0SV pW P@@*Wp@T^ W p0 R  V L  | b}b媈:P!PP`Lbbty<+LdoN<poooĈop -LMp KD@T` P  P@ T^ 00 0-x0L0PS0@Q  |P 0S(0 R00 R0NԠ P-L` 0SKnS 0@ ,P@v$l0PP@p` ,Pp@0oS` P,pԠN -蠟L0S 0 R0 R D X @ Pp`0|S 0 PUNvP D0\.0 'n~PN p-L M `K P@!0s  pp0PPK@0  `P?  @&0 (|$<`0E" $P@X$0I" $?$P@K #"` "@ &, CY@DpLp`plpp@& -0LMPpP`)0 R @;$0 ' 0 @咅0 R {W@ $0@T^\~ K$KA@@@'$00 ppppppp -2L\MP, P"Ÿ8 8 @,;840  24 KT`  0XP 0@ L P T0 X@ @D@ X` pPm/ @@K 8\'pXWH T 4WQ*$D0 0L)W< 4PW9* $ 0 K&LW" 4W*# 0=&P@PX ,H00@@K0T0 $0PXPUΌ0P X 4#`0E" $P@4#0H" $4#D@`0E" $ $P@$0 > #@PKY@ q,q8qppq -`L@8NPP pJ0S pKMPpJĈ -LM`@P0p;4 ᕗP@ z0S T 0 $$zqx -0L h`Lxq -逢L MZ, 0 0 P@P   0PP\%(2R 0004  000\%1RO 0  08N!8?`/1E $0!<@0d@d_0d ,!C%`V pPH!00, $0A0C˄@0, 0@\@`@,,00QZ i$0Z ,d$0 | (0 O8 00@1%o`<(pdl0d %0uOP0,0$A 0,O\%0RlyؠTT`#q -pL M, 0 [PP #81RL0S00@D@030(}"P `h@u"Bp@o"␇# Pc`` 0 @S 0$@,0 0\0`0,D0QZ #,Z #| S`#q -AMLX6 M L6L@P p`84 , 0&Yps ?0@8Sz(Pd|Ȼ 5` YP]p0S JP44 R 8$ 9P41Ppl4 < @bTQ {T {YY .P`) P PP 0SjP*0 P9P<40<4 P<$0R0X0S 'NP ზTTqPP B.K B B8倅P@ 4Ppx0S $KBK@@0?P XP@0|]P@T^0T@2 R 808 P0"8$ 84P084 1 RcBKHHP] {P5 P0 , 0  iP P`| 04|000$ 04~ 04 0 00!.P` *F.P` 9P 2P -P -P`|F p{J댑q<rr(kN@nnrssXs,s8sMxP sP9<iP  4< = =tL P " =HLP X |=H<-8<4< $< < < << ; ;;-; ;;,;;,;;,;; x; p;vl; \;X; ~H; @;e<;,,t,;q(; m;j;+f;c; `b0FSQD:M>KQ0C0C p  InK`F`FCP@ $CY0S 4: S$\v  S P TMKLLؙ @ $ P{9y@9Tx9D 9^ P\ R$ U9 PT ^ \ R U$U0 Pܤ0J   \4Z L0380S5 0S  8 R 8 R8 R   ^l8 x8 Rp8 R  Pe  H8 Rk i U U80> X00R00S7 P 0@ 0P 10135:3P  h7 R 0B$ 70S4 l7 R R0$ 70S4 ,7 R 7 Rp$ 60S4 60S4 6 0 S4 0  Sf4%S04 RPؔ6Y> A= Д0AP(  26X@JP 'dV000TU 3 5#:(P< 0 V00X@6h1h ? 6``U 0#5 %* % U UU 4S X0 4  \ P  @ؔ  YRJ^   $X T \% P ؔ PY, <U U%1 ATE Uc ccXe 00S.K,5 \py \ IC6<0S@#/Q 0SKoP\0@  TS,50P5 P  P$L%  QL #%*LUdUP4 射 05 0@R8 Q<.8 q0nJ  0 % RP L 5S 3 p0# U Ugg Ug gg ;L\0@.L   %8b ,L5`J 0ZP@V`!LUU: X X V ^ ^82 v Pb 2Pb`$"#00C4 R4R 00UV `Pw4SQ004 e$ V04 0S03$ 54 5 X4 $4 $ u<Qq ,0 S , 錑<TRTpKܤ0C@R0 00aAU0!|rP!d0B!U0PBBBB@B`BBpB0BPBBBB|4(KM.KP B4`( Kp$(0K4(K4(K-K0 B$<5 (K 4@% 0K.KD5 4 B#4 `5 4H% $D PT"$`lK``V! ` pK  0Xp6BNKx6Q%̠%4%(@D@D0 P5&d 0S66TQ$0 N0o00  e T oܤU0 U 0A AH7(KJ.KP BX7(K`'(0K$"$d% $$PT0!l |! D! `0 @ p lKd`V,Ġ@ `000 q%*$X]  0 %> 40Q*>V=d8 \ \ʠ 59 V:$V"OU8'L40S@.cc#T5g P0!01S03+S345(*Q$H9U! $UT  h9Q eVPR 9U  T 9R UP9R R/5 TPBNK@D@D*5 P j>p  e n>Pa4: S ܤEnK`F `F @P0 k  %9`\d4S: 8j\d4S0 O$Z44 D D y] -LM@(Kr1P`5  rPpp0W0* R00S 0rS`Fv (P@ YP@Z`F (00T P P (0v>(0 %=(0 08T},s\} -PL`p@PDP @T:T @2 8Op} -LPgM/, `"wPBp  Q q00  R P\ 8Ÿ q00  RP 0`SpSapCP 0S.S  <800Y00S ,0S 0S 0S $0S5MK  pI w8pW0SH00Y00S(0 0(0,0S0,00S' 0S $0S ?P $0 ?c02 $00 ,0S ,χ0 {$, u (l oX |cP@ <4.t0ꌑ}edA}A}z{z}}~ -LMpWsQ5Q/NsQ& Gs,Q0S hVF4 0:s8s`8|@|PP/sh-s<Q@(sL%sD"s<s4s<~X~d~|~~~~~~~~ Q-0L $ Q*  X7~~ -LM`@p i $KKNPi0S0S 0 :7$0 UR#U~ p-LM`PU@ T<1PP UTUpT~- 0\ \8 0000ӑS^ 0 ^0Ȑ Br0 BS 0r0 -0L ҵ㜆`Lx . -LM00`Kq@ 00 pjPPS 00@TH 0uS> <S2  0BS^Q 0( 0 0 0 ?R(0  -R   4K EP@ 40 R0 0(@L LP0 0( dP 0LL< 0p PP0(Tx P-L Z6W6묈Ȉ 0-LMt@ 0PdqQ Go@-o 80hq0(0 q 0S0 $ -L M0p:$0 1P0$ 0S$0 0 $KqPP) 0S& =P@l 00(`K =0cSY iS@ lS5 oS A0S 0S 0S$0SP0( [0 0SP(00 0oSP (0(0ܿP(0 0 0ӿP(00 0iSɿP0 \(0$0XἿP(00 097$0yD,008@HPX壿 -LM `P0p-S000P(K 0(P P@  0S 0 Q (KK R܉ D00S $ "-,0 0$  0-LMPD0K@  0S000 9$0 C 0+ 0 -00 $0 0 0+ -0 D0< -L M0KS0@0,0  K 0 0 0`t -LM@æm0 00S 0 $: 00 $ 00 $: 0S00  <<  00 0 -LM@呦m0 0 -LM0@S  h"9 0 << 0 0-LMPD0K@ j0S000 8$08  0 0(0-K 00 $ 0g@+$ p -LLmho -LM K00"P8t  - LP8nt  - LP8ot $ -A0 LR`P p5PJ RDA R p(P3 RA R pP R@ R pP 0S 0   0 p  0$  $ 0 p $ 0   0 p  0  0 p H`Ć -LMx \, P`p 0LSE 0 Nol@lT 1  BoW%X  @}W $8W8}W $8tWp8kW P8bW $08YW00 QW $7HW@ $7?W  76W  7-/W00SW $ \7W <7W 7 W 6W  6W $ 6@W  6W $t6W@ $T6W 46W  $6W 5W  $5W 5W 5W00 tWX5W $85W $5zW 4q@\W00fW4]W $4TW@ $t4KW T4BW  449W$40W 3'@W 3< S S 3$W  3W $d3W  D3W  $$3W $3W $ 2W: b0S Q KdeW " @ ^ 0K0 X" XK 0SXT1 ,0S ,咁KcKccKca0S @K00!d 0Sqi S  SetplhrI 2@ Hm<m0  m$ ꌑt4$,dtЌTdt̍dt̋$T4D܍<, \lȎXhxȊH0Ўh؎0<84D ,8H 0-0P@0LS 0@0?00lp 0-|PL0@S d0dl00 0HS@l4l$l0000lpjTĈ -0L0CSQ tM00-  Q^00?  Q^00@  ,00 0 dxX -3LdM S3p`| , xp p tR|09 |0@i0TD#| Bpa@ P(000p0| `Kx | Pxt K PK4Kx PW |0S0t  | l h 0S |`KxPKP' |0 | Ql0Sh0S 1 ,0S ,x Pl x6P4APP|0 |\1  0P 1K@ 0pS h i0l0 |0 i4 }P|0 |0F, t  ;lnp1x@ 5Px (p%H/댑X`t@hht@ļgttĈ< -0L 嗮a`Lxȏ -qLpM@P`!ApF@9 -PR44444444444444444444444444444444444444444`1`00 00Q @` 0T Q" T 1@K ~P0: S 0`S  0`S~T 8  (3xt| L ,Ĉ -NMLM@@0S( `Ppt 2 "2Q0UNINK@D@DP4: SA M6P0S 1 R alP1P =k(0 S h(~`0SKAA}P,%4R%4R0 R DP@ B^KPEPE0 @ PINK2@D2`1@D2:p`?00 jINK@D@DS}PX0 R4: S{W`00|H tĈ@x -0L 0W!~`LxH -鸕UL M0p40 %?p ?0@8S񟗉!!!!!!!!!!!!! !!!8 !!!!T !!!!!!!!!!!|    ! !!!!! ! !!!!! !(!$0000S h4 0SH$000 0S 0S$00 ##0S 3#*00#C0P 0 R 0 mx# il#0S L#0S0pa0W 3 R 2 R 2 R BRQ 0P i a0,KtCb@] ,0a 0 ,`P O@Tڬ,00CS x"""###WM   4 4}WC    W;  1 R H l1 00GS @PP GP4   @  s4  (1 0 R  0 KP$0 00GSW 1 e/@s { P4 x  A \k1T<Į ĈmdЮ p-LM@P`{X0Se/ : 0U $000 0 ph9p , p-0LM0008@P \`0TS  p90S00S0pWEVgd -LM@^^00CSl&&&&&&&&&&&&&|&&&&&&&0hB$ h,TĈ 0-0L PR@00  Pp0`S00h PD P<0P(sd rdAedA -LM( R,@:( 0e/ eT *0 SR: ,, -L M0Ss0S 0% ^ R2! ڪ(  ֪,  Ҫ0  Ϊ4  ʪ8  ƪG<PP@ 0 弪4S l<"嵪dr4S  P孪 @\0 S@ ,oXں Xp 0@@0   Xp  A oxa  0p, 0 @@0P`0,  `t0 @@0P`0,  H`g 0S S,! 1$,  Z 0S S 0 S1 0 3, H 0P 00C   0,  620 t ,B0 \':X`S`#Ȱ԰ܰS  -LM0 pPd(`pVP@R0 B0JP@SA,,D-D-D--D-D-D-,-D-8-D-D-D-D-D-D-P-V0  8@pT`P0  `P   | H P@ `P?@{0 A>P?>p= -L$M┠, @PP@ `pP 0\ p`0@@0  0 R 0 00C#0 0S 0 00C3 0P 01 0 0Q 000C4 q/ PNP0B0U0, @P a p0# 0S 0ڕ\ څ! P H 0S" 44!01,!R 1 R 00CS00  0  o@  o@ 0404   0@@0`,0p@Pa 0L0pϨ4 $S<DH`#PXh -LM*Q, Q!007< @@0P, `0KQ`/ 8 0Ƞ,X`0@ 0,x @ T`PS,8@ P 00 `S 4@T0PK0 K 800S80 ,P (@$0[0`Q4 PK$0M00Q4PPM$00?0`Q4 PGTȐ -LMp`sX3 P * R<3<!8!0( 0 0 X02 R00CS00  ä0( , 0 8 4 G<PP@ 0`7< @@0 0{/ P@ZPB X 0 ʧ +?$ç$ῧDPPP@ 0ᵧDTPP@ 0᫧ 0!@ \0 BS,@TZ@TP@\ D啧PU@ >Zmy(ᆧ1!偧8@T 08@TT >?k  ?g 0T0 X0KSıر,@XdxȲ -LfM\0pT(0 xp`P 86P@  0 0 "0pK ϞP@d ooKe/*PPPQ e/}| PPP@ dA`a`c0S1XPD00CS0X0ӤX0% Pp@ 0S0 0CS00Ӥ0 PpNTnTVe(0 S (w94XPDᲴ@>e`YX d,@dꌑT ԴȑĈ -LM@8PKtP  0ST R 0S8!8<K0j=p6 <000   p `4p@ P@PK'   cp7Y0S 3Y0@     <"Y@ @0#4 Y00a 딐t$ -LM@Κ0S@, -LM@@ᨚ000S 00ᷚ0S, M-L M0hp`P@ \ |0 0  RP 00 0 ա@@ -CML 7 MD$ BKL, :L < 8 \ 0'0\8$RP \aP00\P` :԰Ppx 00dpѰP5WLv Dq@6Pp8F<`T *0S dP0hC1 @T:BKHd6H ~044 PSB>K0C 0C0<0  <ᖰP-W4 ` 0S44<X0DHpჰ0S440044 `W 0St0S 440D40D4 <cP0W`k 0Sh BKHH0 #04P@Sh  4D <44 !\0P`J Z00R00S@L<BKJ J JPw 3W (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x   ` h p x p!P<$ 2'P<4 PBKH0H 044 S;;S<$(  0$  <DD PBKH0H 044 S<,  0 ;D40D4 ˯PBKH 0H044 S<$8  0, ;DD ᬯPBKH0H s044 S<0ᖯPBKH 0H]044 S<$4tုPmO0BKH0H  G04S<0O7<xgPBKH 1H.044 S㰠<$PP?BKH0H 044 S㰠<c04HzLԭSPxȵ`#ozص{,0<HXdxS,LhX P hP xP P P P a0BS60S3<$8a AR:R<`0A8̑#<W @$  B>K0CH4 HLO0`L0p H 04S@$0O0W vNO0`H 0p 04S@$00W@4 p1 ^A`XPTp *0S =P0h@C1 0 @T:qH20  00S044 04S44S  :044 0@$ 0@4 @TM TyW> $`H p@01E.KXXf W2 `H0 p@0X44 ` v` @@s`A@W  H 3@$`8 B:D$ D$ 1 ;:LW+ `H p0E.KPX W H0 @0P44 ` -` @@*`A@ H0 4 e  9DD 6 9DD <75D ,0\S ,,s  @9DD  X9D$ D$  p 9  9440CS㰠ڑ< 9D$<4 D$ -LM, (0S4 L  ,,0S  , 00S4( ,40S , Q ,80S,00 8,7<@@0 , 48,R37<,P ,0(P,P ,0(P,8S R0 `,00  a0@ 8  x'8@P`@0@0~, 0@w@<0P ` 0@V U 8|794 , w<4 Y 0@`@0`P0 @p  0@TS8940040 ,08Q0 Q2, 02 )8@p@00@0 a P` @ )(0 @P0 P@ 0`p  80  R0 40S'(00 088u 8,8Q8I84  4 B86t84  4 /`8 4T84 844ꈷԷ<lԸ,L` -L3Mp0moKOKPe/ 0 e/ KKK?Kx@KZ?K@d0e/@H2 01 2( $1 2`1 d O 0S  r錑"t p-AMLA 0|D 0w3 0rI 0mP5 0`f2 0a 0P0 Pڠc ֠xx Ҡ5 0dHB 0TCLL ĠqxĹ @`#̺<|4x82P *0P ": -LMg.KM8̟ B B 0*  e/ ,0 0: Z P  RP !IP ;  > KAA    P`p[(K0KSH0@@: 4 _S( K0(KS(0K; K ` @ P`00*U % \5*S:5 5(KS:5 0S(K00 e/ Ke/Kh (SKLL T: L 呺 D*㢕P4: Rv 00CS00  ä0h9q (K 9( K H P@ B PuQUQA 0ApS7V(](](](](](](](](](](](](](](](](](](](](](](](](](](](](](](](](](](](](](](](](](](](](](](](](](](](] V(]lV(](]V(](](](](](](](] W(](](](](](](]W(](]\X(](](](](](](](]XXXXX(]X V(](](]XY$Y(]\YY [[(]h\(]\TZ(]4]UW Ke/㦹PP PK NKKAe/  B* P Ke/`7  < *P ,7 @ P6ƟQ@T\ 0`: PP 0SVK@ @ 6p  AYP@ 6 0ᎹY s X\ Ke/;P PNKe/@yKe/ uNKe/AKp S P M Qoş5 R@@R@[b $^ = [ W S #P0 *[JU 0xA 7=5 R7 4"3 / Y U0  J$4 RZ < T4 R@4 RG |D||$|)PP  R0000ӑ yS0 R000ӑnSU P$00ӑyP     P ,,0 S ,Jo *P 5 e/ e/uP`BQX # 0 S* 0 :  0@P00`Vp 2 0  0S  0 d 0 SU ᵕP@  0{8b[w ,,PPp 0Sm NKe/@\Ke/ XNKe/AKS  6 3 0 l1 Rp *P X4D0 e/_P 6NKe/K@&e/K"  T   g5 8I5 ꌑ 68p ȑ`#rdAнؽ<HPx`оؾ,Tpȿ -T LM0$0 K @K$0K p R\ -LyM LK0,0 1( 0# @%1şA0S1 e/ K 10K1 #AA0AP Q T5 ^!0!Q42P1B @0! @P0  K KK>KPژ1!4 p@0 `P0 `0 S0S*.KP10S1 @@ TA K0d ,K1 2 K9@@0  ^^  K"A `0D! "\ !  P B0 O "" 0 S0 S*.K P  KP 0 NKSpv 0`0S@"TS.K`p 0 @0SZ Y.KY A0 S=0 S90O 00 00/S   " P " cgKe/,1 ,0S $,l!A0 0TϗP2 G^ 0Se!RbV 0AS0 S*dKa.K  K0@댑<, -LMP_ . @3@ U a LR000 R p 君00" 0S 0@@ 808#P #6( (80 8#R@ 0@0@@@ T 0 0KSpT 0`0S@"TSp00K` 0  0S400S00p800 O0 00 000 0_ P @000 0 P 0 P 0 P 0 P 0 P  0S h+PK,PK唠0P  0@ 000Q00S0a0,PK,0KQ0  88PP80$ Mx@pX -QLM P4 aN\00?((\` i鲚  p`V 0@@   0 SS S S0X0H!P i <</P , 0 ixpT4`t -QLM pD aPLU00?((U` b"` Q0@@ $ ,@K P 1 P P: P P! P < 44P  0圴px p-QLM @1 *\+ a`LV00?((V` ph R0@@  @0@0@hP@@MApDL ph 88P ( 0 phOxp -QLM4 aLX00o((X` o鵙r , 0@@   00K,@ PP00PK0T0LV o{ 881P( 0 oxp0@-0@@0`p P@ `p0 S RUT -pa0lL0p@TT! LV88!֎P0Q0S?0  P0 S R @000?S T S 0?S + (L0S0`000Sx00CS00  ä0 0 80,P ȑ`#  M-CMLM4 8@`}K`KP, 08$ 0 0mK0L }KKKLPT:3E.K(@KBKPH㨣P H pxU#LPXC  @3(KRXX0 5@T S80 0S S@D00(K0?S (K0*S 2(K RTA   0SQ"0000ӑcS &S %S 0@-S+S@L4 0D _KBK0A0A\P@UK0"S 04 RuPdVgd0 E~K Lp`+^S L-QL @v00 C  5 PTU2 4K8  0 t% 0 `PP8`E"<($K0S@ T@S`P 0@%,"=K`Qp T@,0 S ,iw `Rp`pPh0 1EK Jp`00p`? ȑY@P@DPE\( O EK47< @P@h `0`?bS=4T@D( bP$ 0050@D0"\ O E.K0l0CS050  0XX PP D师P1 @ᲈP) @TP  0M@P T@ 0T0S00CS0 +t m+/@00(ԞP|0K @1SḓT 44 ,L  -L$M< 0@@0P``P@!0 0p`PU <0  0 SR0K` 0@ !Q@0P`0@KpWPU``P@ 0 0Pp`P 7< 0@0 0K R0VU00K L@P``0P v440 o閭vxx -LM\@2@"0042` @0` P0,P @P@` R:0S* 0@@,0   , \= 0@@0p  P`0pS?0S< 1Q4 0 @@0P` 0S0SRQ,` 2,  1S,xP@"000\0S:0S*40(0S:0S* -LM4P@@0`p p4T@@0L P@0 0S 00 ^PO -L1 0Sp  `  0S@p  0S 0 S -0LD0C6S]ꄌČ̌Ԍ܌x (hD|xtplhd`D\DTPLXd`0Dh -L`pPAT 1SPUAi@@P   p-LM`P@PQ@TpP Q P pQ -IMLM0 S,   ,0S ,8bJnK`F`F !@1J^KSPE1A@T|Q| ̅P0rSF /PP@ prWBK0I0I0  !cp @@@ 0/廈Pp 4S J^K⸠PE10 "\a0@ Tʄ1SݞBKII $ 0(T}prpHU -ML─, ` Ƞ,8@p@00@ 0,@ @ P\"0Ppp`w vn !0Sh0Sd0S 0S0 0脐@ P @,l P(0SD  0@S 00 0S( 1# ٪P0S0S0S000  @` @`0 0@PU`TS0OP0 0SDw 80<w 0$,x -L$MBpT00K0`K`蔀`0@@0P` ` 0 @PSSpp!0Pp`PK uB : 0. 0@   0 S:0S*.0 0 R00轏,V00U0PK |寏0OP0X0\ v 40<v 0$x -1L$M Rᔐ 0S  @P\ 00C W  /pǏTJ   B020 K`0 K @`P!0` Z`Pu 0 uv 0, 00B","0@ L @@0LA0 0\2BvL 40圩@00PKpHxX -2L,M R, 8  0S 8 @P 00C   ɯTy   B02/0@K400c @x(<@ 嚃(<@0P@P0P@,0!pP@L tC QPT P廎 0 ; $1$  0 QP0< 0@K 4P0 54B"`P,"0@ K @@4KA08 0u \0duT 800 K{xx4 -ML─ 0S ' @P$!0p` 0PT`Pu 0 uv Pv 0嬨頠!Pp `PP @0P`VUVU4J 0 0 PtxT -X1LM RP3 P0 P. P, P* q! AR P`/ ᲂP@@% 1ST@T0/S ! 0E+ᧉP PTa 0\P嶍A@ (0'$@Hx|P0S  0 S  p-LtM`KP0seh L@T P #0S8 @pP{rdAedA S-Lpo UP* %DP " 1ʧZ 7<@@0 (`,048PR3O<(`,048P7\ L1m髧dP uPW 7<@@0 (`,048PZR3O<(`,048P7 ( (0R, ,0R0 00R4 40R8 80R7<@@<0P  `  UV@2 44 4P0$ xL -LM@\p`P````,a@TPڰ7<@P@`P -RLMP` p `0 p @p@RP@+  0`S  00 0S00Kp0S0S0S00Kp0KpW0S -LM` P@VL p0S 0BV0 ` Ii IP -LM p`0PH 0- 0H P 0pH 0 XXX H8PU 08 8PU 2 -L M0U@pm 55 u  % 5PTTT$4@  $&Pp 4Q 0SDP PpdP(D0: S  S  S0 0&p{ 00 R000Sg Rꤥhhph?;#003 <0S c#?;0P@ ?LD T@ ;00S  ?+83 0S,3@T c ?2"@@ 0S H2 AR;;S" ":00S 0S 2Ql2l"d2T"H2D2q>0S0||D K1Ps1 =A 00 ~=!0![Az 00 o=0!MAgC*=0d!CAT P!9P00p 0Q  =0!(A0 0T P=0 A0P 0<0  H0U8X|UUP UUDm @X -LMc0Ss0S 3 R S0S3 R3 R CPÖDP,K #G0S `3 R d0 0RTL R @C 0 S ,#000 R3  S0S 3 R\삟00CS00  ä0N00`V 20 0P)x2`BKPd@ 0S 0+ 0 @b00$Ÿ0+,P !1aA0 @@AP !x !d 0UH1 ĺmA\XA#PI0: SE8 @T@ 1OH@;0 RЀ 0 R00CS00  ä00 奉咺 q!` R!808 $0UUU8X4U0;\ 0T ?00  XP@0 0UUU|Ul -b0LP@@xr VPP PX"000SQ꘱000̲Uڅ;;SNU8U0011 U00R@@T U 1 Q P>M;!0|!>l1 h|>\x>,8;0S 4;0S 0;0ES U0P0 0 R0Q/ PU;0 S ;0S ;0S ;0S00PX6>00 000UUUU=0000U$ha 0 RQ R 0wQ9!I= 1 R 9 T:P0U$`0 =[0 njlȠ( `0P@( Kd$@ sP9$0H =<TUUlUUm< -?ML M804S?KK (@D, r@Dz r"(K0?[K<(PE0 PE00 6PAb0 0,PV?KK(@D@D?+LVP`G?+EVP;@@ HP+X@ P000 P ,0 S ,=W*90 <[<9 <9 9p  9` 9 ?+UP}UUmlx< -LMdNK@D0 @Dp (0 bPd [P3UW`# -LM\q0`SN H!3#c1c0cAT R$0S8 Q0S. T P T $`P ἶ00T 0$`00  唒XPl0(&PC3dAd@d@;000XRPUUW`# -LpPP 0S ,0SP!d&0aV 0S !P0S$0 0@0S# V Q}P00 0$ 0 T 5&P(@V`PeP0000U=U -LpPP 0S ,0SP &0aV 0S ŁP0S$0 0@0S# V P00 0$ 0  %P(@`PP0w000UU2! -LM@(傁aMP@ 0S ` -1LM 0 bM@ ^0 - ! ^  ^ a0 :#:900 !P \0  ^  ^ ^  ^    0-LbM(MPbMK@D$@D0p 0 d0 KX0P  0 W@0 0 0S F0錑\`  P F $04 4!N0 P V $04 4`!f0 L1^  P@:0@0P3n000cBP) 0: S `@0 0S@P0 ` `,o 0S P `@0 0S@ Pn#R\ (,H8$0 |0 T \ -H$L|M0 ,0 P $00CS 4   4圐K R 0  s P3=6K 0k P7#00CS08 l l l 00a=0p`P@00S@b-P ``06  P03 ($3 0; P3 03 P 2 (2 ,0S ,C2 0 P2 0 Pa=. 0 P`2& 0 PDR>0 0 PF 88# 0 PQN0 0 PV 88# 0 P^ 0 Pp nP/P*Pn000cP@P00S S S S  P<00cPy0 T(sq0b= 0P@60 0 PL [b=0P@06\  0 P ꌑ0\q H(,$TqQ-H0 4S Q 0 S  q -LMPpPb@03 R 0#400"400"40 0"40  0"40  0"400"40 a͠$ 0 `48 0`  !H8 0Da=$"$2T:0D0P300cPP*!0: S `@0 0S@P1 ` `,o!00 P `@0 0S@ %P0 400 400 40 0 40  0 40  0 400 40 a͠$ 0 `48 0`  !H8 0y (,$08H P& -%L0M0 (0 H |P4H@ AR4  0ASxlxxHPa`%<%8.K-0K.[- [%<$,0KP0K+K(,0[+[pPPČ%H8 0P`KPH0`P@P`b- 0^ H3 &S(0 S (A0LS#H@4B0KAKB [A0[4Pq 80D KC0K 83H@@ 4#H0 4@0K?K@ [?0[4P#H@ 4>0K=K> [=0[4P" 4<0K;K< [;0[4P" 4:0K9K: [90[4P" 480K7K8 [70[4P8"@460K5K6 [50[4Pa=@,@8@4 K30K2K1K4[3 [2[10[ $4(PpPE400K/PK0 [/0[4UDKP2P-000cP@P#D1H`0S S S S\H  ePH<00cPLH0  &EC0HP H 0 @@,@8. K-0K,K+K, [.[-[+0[ 4H0P@b- P0@/HP b=0+ K. K- K, K#ꌑ0 (,$0 -0` LK$KP P0`P| Pp"d 0QpL0L {P0, % (,T 0-QLM@P&0 R00P0 R0S 0;0 R0 R0 R a= 0P0"\ 00h%40 |000 0 ` @XDX8h(, p-LKtM @`KPP   \L0  Fp"%p!0 00E%- 0P ) -LpM`@KJPP X0PpWH0P 0R ,0 ^$P -LtMpPK@ P1 R* 0R5 0: S, /-P4P ! 0Q` P X 0x @$Xb!0L $P 0R $0D -MLP4M H4p , t * $00C S`|3gyP3 RIKII 4S+P) !#0@P \ `3 RT3T P00#Z$3 ,0S ,>3P 2 Ro 2 BQ R0P0 R0Sx"0;0 RQQ B0S|2 R p2a  02LxP P0SBB0S1 R  IKAAP!0S$\1  r 4t!#11  BnKP`F`FU!B4: S>Sp@ PpQ  0#00 +,  %x q#B  X hhX(,h`@XDX8h0 p-LtM`KPP 0@T0: S +PpL 0b#pPVp p0D -LtM0@/SP @//x`@pKT/ `X0Sl0S ĵx0\0S:0S! x ` -@LpMS` Pp0S 0 R KP0Sl00d0 Rd00HPv00 "o 0"U@XDXd -LtMp@W0 P`0S 0 R KP0Sp00d0 Rh00HP;00 "4 0"V@XDXd -LM@70Sl`0^wP 0S 04 v"$0 RPgh -LM@ 0Sl`01wP 0S 04 I"$0 RsPgh -LM@w0Sl`0wP 0S 04  "$0 RJPgh -LM!@P 0h" -*0LM"*@ 8P 0h! -LMRp, `1 0S00000SPP0e0 peR  V@*0S@T*0S T00- x@ x@@T P`W,0c? 0 !pWP  0p\b!x/0Q` 0 pl , p-RLM`0 Pp@0T<  P 0phW! V` 0-0@SLPi 4 0R0a 0h2 8 -ML4M!0QP,0 pG`1 KK`(@D@D V k#  :P p R0 RPa- 0S0S 0  0 ,0S ,;K(A4A P a=(K0Q p0| 0QX0Pq4 0@  i 0$ ꌑ`x -0 0R00000L R0000 R0@00x0 Rlh0P PP0 R[P$b XdT V   p-PLM@` 0SJ pPP @P0/S00L 0S< @ `0 0PPPPp  V$V$d0 R00T0T QH0  \80 R,0 P0(V4,VV0 R00(V 0-0P LRx0@T 0S@T00S 0SU0 ((iP  VLx6 -QLP=aq R1 0S  0S0! @ 0S00 0 RP 0P 0eP` 0` WP P00V V(V <| -L#L M0PS44s P 30C S8/T//l//////////2 R 0, K@00KP0,0 0n0 A 0l"g0X"a 0@"bMb=0@`l `0 @p {1؁ * RY 7 R$00  +P0 `ç 0!L P;0\1 x1 0\!  R8a- 00 R0 !0 R  R00 R0 00S  0a @0@00}0SPAth 00P2V,V   8 -1LM PRH `P@A*q0S90 0CS00Ӥ0.p%  @T:0`0D0$S0 0CS00Ӥ0 P p VvvT Iv~vꄀp|p ]P  8sP@ 00@0S0  `T1P $ȑ$D -2LtMŸ@0ŸT S, Pp,T& g2 R0 CR 00ØL2 ,0S @,80R Y  v@K1 R@(08&B`P0 \*L-S0!^ *\ ^ *\^0305 -$$q0LS`P P: 0-S00 00 0S&0@T0  p:TP 0 0:S l R1 0 LP0e?0C0 h <x p-LM0@P/-%|P00l0p0SP`ph;<}p0Sph00phhhhg -LTMptp % p 00@JS񟗈`@PAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAp@PA@APAXAtAPAPAPAAPAPAAAPAPAPAAAPAPAAAAPAPAPAPAPAPAX@A,B8BPADBPAPAXBdBpB|BPABBBPACCCCCCCPADp04q$D$Tk0S`?0@0w,0S 3wCoPv ,4 uW4Podj<3p Pvd<3u43u,3 3t 2 Pt2 Ps2s2r2rBp 2P: 2p2pP2p 22 p|"|2x2@pzp2pwh2|t2|P1@ 0S `Pa0CS"ChChChCz `0S HXX<$XdXTH%8XUDX`4@h LXtȑ8<W3X | = X0X P#3!"c1 0c!R 0S R(/>3XX p-PLM@3 R0 (a0S= 0#S4 \S. ቦPP$ F0"C12d1@cP 0S P㋮P P0! 0px  ` 0#S@ P,孰P  \X/>3  =X0X P#3!"c1 0c!R 0S R,/>3\X -PpL`P 0Sd /mP@p0 S 00C S0u 0SPPj T 0SE00HK0S1W 0S !0 0P!10P PPP000 RH 0 , y Ṯt P 00000 0S MS CS000 0S 0O cS mS00dv,QW0p0P .QUP}  (5 PPXTXh$P@-0\ @a 0S)  S   0R  0R \\  0 S0S 0 S0S  0R PXH -LMPᦴ0pS@ q 20  00S| 0S .T`q @ቴP_0 1 !.B=R pGV0G SR~~~~L~~ ~~~~} 0!0!>C111v>C 0C0 !0!>CP00 1 !.BR00 R0S P&0B00 1 !.BR00R0S P0 1 !.BR P 0 1 !.B;R  2p010!.CDR Pk?C@.PT @} 0-LPL@DT  00S0 9 `X t -LM⬁PPe 1 R 1 R|1|!11a11acAT pP0 S @T0 0RT 00Ȭ0hŬ0`X$qv -dpL0S ` AT@0`V01P@P妬᤬U`X p-LMP@T0 p0Sx`t 0 h0h壱eoX0P000 ` 00 dXGHP|X -ML0M (R04 ,0  2 ,0S ,$4! L!8 0AT ~KpGR0pG8 @T^P@, Q0 B0Q  vP D! T4a=  8,1008 A  0`PS 0S0d#0S  -HPT 4a=0 S0ńb8  \$ dX G|X,Ll 0-LPL@DT  0)0S0 v hX -8L@T`e !0pAT b^PP! @T 㸪P@  OP OP 0! 0A}{h6 T  8^P m NP ! hX H -@L0`SpP` N0AT ^P @T HP:0G0hX 0-LPL@DT  0鑬0S0  lX=d -0LP -p`LP% 0Ƃ"S12e1PcAT 0S @T 0ST Q P@ 0`0 10 AlX/>3 -1L M@\, `p? ̡1 0, @R@\`0 PPI P 0S: Pda00S0@P! 00S00S 㼩P 00 0 0   A>0, PhPP 0p p00  ` WPP 0X0@ ラP 00  lXX 0-LPL@DT  0髫0S0  pX=( p-LML`0S P0AT  0@TPOUppX -LM䀟pPP, / 0"c12f1`cAT 0S @T P@ tMP pP ,000! 0A(o0ST pX/>3` 0-LPP 0A"#12b1 cAT 0S @T00 ST 00 00宩ᬩ0pX/>3 0-XP@ @LT0 000 0S00N0tX -MLM,Q,0S, p`* 1 R 0/S BKAAP % `Ѐ@0Q P@LBP 00(00 徠 000 ,0S `,!T gP 0 tX$XxX -`L0S$ PPUJp0"S@0S  0RH Q  PUZ000tXxX@XDX p-@Q0@LM@C!1`@P  KP*0P0:0 R@U K0P0,*0P0:0@p ) -P 0S\ \P00S0 BS08Ȓ00L\:0000L \*P\:000L\*00L  L 0 00L 0@- 0P@CR00L\ :1!P@00L \*0\:000L\*00L  L 0 00L P-  *0 R: R$0 R:  Q0-LP0 S\  tD0S @T0   0( -LMP@ ZPpZP \ 00CSP0 @ ($ 0 ,8X4\ -LMP, P, 4#, ,(3(cpp0K0CS d, B, l0  , ,2  t , ,2|   a,  u,l2a-d2bb0  00 02R(0 ` >0R 2 "00<(@ /R }   @<0S@P `1`) (@0/S  00C0Xl1 @1) @1  5R K0BS` 0@Q KP0  @P00 9p 0 0 :0 d@0, @m, 0PT , @b, B$ (,H8  lp -3LCM |3 B, Rș؜̜؜؜83 R  3 ,0S ,rBP0SPdU <"K d2K0b S Sy 0CSV+2 Kd1KvK 0P>KdP2 0P >Kl,20 P  2 S>Kt10 Pa=.K0 PK&K 0P|K~P P@!0S Sa]P K@ 0K@P `p@< 0S@P``0 _+0 Kd2.K@/K N@KPt0h0x\0pP0h2?KJ 4}K0bK 0PK}P  P8" B0S SXLp@pj1 $R R30K40,K0A0B B?KR0 0PK 88 #0P/K| 0#?K| 06$1 OK R20K10,K0A0B 2d+ 0K|0 p  R70,K00LK0B0D a=0@<P`0S@p?K| 0sP 0 B K 00Xp6 --0P|0  QLl@ 0S \0\ XI He@ %40z$ 00,0h@xLX -0-0P L0  \P@ 0Sx0x tI d~eTIT HI@ 080wz$ 00,0h@xaLX -@6LcMO?(PK$6@(K, p@ xA P  tp !5! f ! %p D0@3S;гггPгг гггггDPгггггггггггггtгг̱ггг(4xгسD1 [KD4Ul!R0t 0; 0094( P(@K P 0 0TK <P 0<P L 0 QCˌ0 [KDl! R0xdC0 [_KPDl!t R08$#]?KqpQ$0@00:P000=@H 딒 ̢/ P@P!#. ᎄP/ P / P00kyP H 0:ZPA1 [K9Dl! R0@00C0`!00 008005,AX1 [KP @Dl!\1R,0@ˌ0 [_KPDl!O?(KR0a 0< |@1 [_KPCl!0R 0|A?{Gz?jHXT<x! Ĉ$<TlXXhXXL (X4X \FTp'(<|pH.A0 pbW0`0ppp彎呋0 ᛐh O 謐벎 P$0 p p0 pp :PP L 0Sx   qQ1 01 P 0 0 R* 0 R :D0 2  0<2S"000 00 0p1!@  @@FPt |B@vj ^  0<2S";0000 B>BS$  #0 $ 0<2S (@'(PKdA $(KPYoK P0 `A \A XA TA PA LA HA DA @A 嶱PxC000 <3>K 墱PVlClK#_?K@A FPH|!1R T@$0傱P0;CS0H0T4Q0S|  tTx)&A  !r 10C1 YAt0\ T0 02P@Up00< KK0 ! l`VeKf/K:1  < K fK⹠ R 0S:ᰞ. 0S $O5 1 q  00Ì cK0nPʱ8 0P~X8&^rH6Hp&a?K@POx&Y?KP0C PҰP Y?KP0C PİPwN G^?K 寰0(PK0@00  O? K ^ 300 0p1  000+^?K剰 W ^?K 7 ^?Ku ~7ƇP@ 00 OOK,\@d -LlpS0 R` `0S* vP0 0bCP 00 S Ipx\P0Sd0@ \( F@P@Dܩ4 xTXL@xXX  -LM@@ -MLMXXb0PpH,0 pp03*0* 201 0 2 嵠1  Q P1@ԡ`0 810 @@ 0P0?P P$JKx!(@D@D0h!`P4` 0P ,0 Q  , vM`8#8P#$0$ mJK(@D @D`K<:(<2: !<(K0<:(<2:(LL!<  0ꌑXxXXL|hHX -L4MD 0K`)D 0P@K0 Z 7  z  D h0S'0S0 0R0e 7"  p R000 0p H470G 0 B0p0 ǟ0  DX@0S 1S 0 0c@BHX@|06 R00CS00  ä0 `t,0  HV  (S= S@PHUp0 ă ā Ă< 4 <( "4\,<PEU pH'W5 R 00CS00  ä0kPiC<cPHpWp!pW U0W< 'W002QP0 ă ā Ă< 4 <( "4\,<?pW PHo 'Ul4 R 00CS00  ä0B&4! p(D 0T  ]Pß0 0p@g;0#DHL[$H 0 DD0S>W9|S J0R1:l3p W @*0W*0@Sp W *0W:G p W@*0W*0Sp  W*0W:P@K0/PKP@0/N0 h 8Kd48 < ( 4" <( "4, ! 0,< `Rc@0 , =9 A0 0 0 =,0 2a, 3c#0OPK< LH0`KqPK@ P K`KPKH 0@PK\8!L@0SPK!!H0S>0L@S:*PK6T0  0010ZP   ' FLTXPX x$0DtHxP`hXXTXXXXMQڲ0AQQ00  8#8LȃLȌ 00Ѝ -ML$4M4Q (K @, |4 R p 0 CR 00HrK(IITK(JJ$T$$0 tX] * {T (0P0PiT -LM@Qshhhhx (`hQ@dlt|ph"0S #!Q $PX`pB`XPLHDh84 0#$(,"(h0S S0Swusqo0("#8X| Dl 0@\l$Dh  $ 8 L d  p-L M0@0aP0 !P`))Z 0U 屫P嬫KVP`Fʀ0 R t00CS00  0p phN< ph0,.V`F    ! ! -0L M0 K0 P@ m0888 Z(b0 ZL Ĉ -LM@~0 01R4 R(  0 $h!D! -LxM0`S qP10  0D0SJ 0S TKPKLKHKDK @KK0C4 01PßPoAJD  \ $  0 B00S00Y X 6#1@% "X`P$R`1 ,0S X,y 0@8BP @" Q 7r0$ :  0!PPd 0hƑ(0CC1/|Qx0Pw00S  n Q<;P9ꌑph%p%%% -MLM0tC\d#, 4 <(  P@\434 #A6T8 4 ` #140\F" $p`B6# AV#1%Y X @0 0 Ɨ p2Re L 8(LH0PS@*KAAD R& 48 S <8(000 @XT:8H000,0 S , 4 0 |00S00YX   D0TPDHWPH @7 Q L 1HH@8H0006#!P*8H0L Q@T *BKAA@ 0 S@@T:08V|0Q @.P0088  <  +ꌑpp%p%%%%8 -0LM PU@p$`֑` #T*U0 R  0喃" l`▂#0U<0 R 0 0喃" p(%&&4& -0P0 P00LMS0 P܀ R0 P.:p$60PP5`@2:(P`@z,F0Bd$r|P0 R0`@00T$Fb00$L@0 pLP&p -!LM0\00 \pG\(:`(P``0,F0B$(0 ƚ \Pt0t0l h d@d0 h0(0000pLp&D - 6 8`0(@ 0L 0SĠP`ߐ묀ppɐP3@00 00`PS P@0Ss0S喌P,Dp& -LM@P00T -LM@&B ?Ǖ Pa(cPUp* 0Аr0 T00P00@ 000p@0 (($`9d0 dS D 0 Q000P p@H<4& -P0LM@3<0 P 0S P <& p-LM``0S TPT 01@CT*ьό000pɌ0T*<H@ 0   -LM`P@aUpᰀ 0SP 0S 00C0$d 㵑\0 iD380  \0   ><t&D&"m 0-(0@ LRP 0 ,凑, 00 0-(0P@LT ,?P  T00T0S 0 T @0L 0-LM@0T0 T00S0 T0P7@H᫅0S|ttqp0 Rd Tg0K0  8_ (Z'L'{''<('4'@ -0LM@ 0h Z\ 00CS   00 00  L'X' -PLM@ @1 Q (P0P*0ES;PU:0U z W/ , Ẁ0 0V`EP( 00@$K'$ @0 0 /&`$ 000H0G  W00 RLpD 0- L8M00 H0 <0 80 40 00 ,0 (0 $0 0 0 D PK@ HK@4 t$0$  00C000D -LM@Pr0 `0"cpM b0@SB  L  `       h             1 b 0`ip1 h _\!000`01@ m0U>0(!S 10`00!0`00 0@TQ  P 0 R T@DG  0;T@DlzX T0 R !H@p'<D4|'(X'<`^|^' p-L@M P`K+0S 0S  j p' -LM`t`ğ QS, @ DdI 0S 0Sm p P0S 3 ,0S ,s 0ṢģL0S/ P먓0S 0S0\CS 0S 70S 0S @C 1 R,9 Qh;Pe@0 ! PPZ @@TP|6#1@DT PM\1 R 0  | P+ h1 !0/o (K0  @0 ,?0S 0S P 00S(< HP0S Xm P D <I ttp(*&*<D**}8*++,+D+\+l++6`# -LM@P4Ppc`VWW1 0S>000 0. $0`F0V$0@X L0 S00*ƅP (@ R00  0R 0S R0R0S P 0 R P` gX0 S00Dŏ<</0/+++<+@0+6`# -La8M0&0Q 0  p 0KL P H D @ < 8 4 0 , ( $ @0(0PU *0T0 T00SP (0@U:6pW<0P 40H@ PK0S  p -LM`VPڴp崀S@PT 0S  0T @T R 0S `FVP 0  0P 00/ -ML M0,0   BR""""xt P d$ PTDT$E>K0C4  L44 $0ß 3 R( K#d `$ *B>KMK0CL0C L4 p0 R X:p# X*pCp\  X:_$3 ,0S <, 0S 0 S s S # P"   00C0 " P  000 00C0  TR0S-@<2VV@j P  B2(K_KK@$ (@0\4  X$ sM!Q& B0O0  0l 6`X!0SV Eo0 H5@"%$1 R]0 P P. Pd P D0:90|f댑p,,@H0-#,,,@d,,pD,< ##6`#, ,#+8,T, -MLM$p\0,0 (`; R 0S  L0 S8(K 4  `0 A?(K  A?(K D KKIk0((K0Q 0@^^>KMK I P$ $\ 0S  R0.S $0'$00Q0Q0 Q00SpG h'di X (,0 S <,00 00CS񟗳%%l'l',(,($0S&&L0S6 `03  00C SK\&4'\'<'\'D'\'L'\'T'\'d' 0S 00C S'&&$''$' '$''$''$','00&c P%00C00000000      0S $\NK @D@D0,: S^K PE03 0%z5 R $\00 PO$0SL0 R$ 4 RO$\ P; 0: S0   4$009$\R  0.S  00 PS L0S|3(K4!  `0A?( K A?(K KK j$\0 0 Q0hNK0ᴀ$00$03  0`0C0 $@@Q @T; Q 0S+ 0 SP $00$0P "00C0"t>KMK Ӈ PH"dD000.S "X P00L Rm `0j 0Sg <\@P^>KMK @d$00$0@1  0`0C0 ᯈ崀=@t?P(5P( j50.SR 00Ph L0S# `0 0S 0<0P$0  댑 -p,,L-(-0-<-H-X--<-----@d,-.<.T..... ((0c -!0L1pCW:@`V QЀ Ȁ0 R 0pGW*0 R PQ 0 R x0 UP`@H000<0 00C000@H 0-L8M`Q QT!00 @D H0 @0 <0 80 40 00 ,0 (0 $0 0 0 K0DS0@T0@@ 00CS..8//8/// 0QP 0S P0  00wdHK HKtHK4 00  908,#//. -LM`VP$Pq 0S8 @T 0S @T0 \( 00C0`FVP 0  @00 T0 -LuMĆ0,0 5 p! 01PW1 1 1  6 \pP  (` ,6&iPq !,6"! 0&]& $&  rK f?KP4 Z(1P*P0Q0 Q00S 0`F' 2 0P:6P P0ş 0P1!5% Q5@!0R# 0<0QK0S   1, 0S  0h` K_KH$1aC,6 1R rK P0S#1MC& )BPl0SV1#>C&BP<6 PA0S 0S ) `1 0S DrK P & $Ÿ,0 S ,C1! 0 ,000S  ReK~ P !&001&AP dPeK] P & !00! &APq t1zn ue,6KQ01,&K `,6xAQ000L0SD1 S@D0S!1 S* 0Q15021 5:0Q 0ׇ 0@0CS2x7l7l7l7x7101 0`F4,6 0 ,6! yX@0 L;댑p(/X////0$0P,080@0L0T0 -PULp`:4@$@TPZ 㧶U:t0|0 0 YY0Y0 Y --L Bx p-PLM@P`l0l R mT D0 Rp80U j 0  L^Y@Y`L0 --L  --L  -LM@\& h  --L / p-LtM/P#@TK .P0: S p0`rS. ⁃ 0-/L@PU+D0 00e/00(+l&+h&000 -LUMpPKPP@lK80S(0: S  SU P U@P P@0 R000K@P h1: SD c$^ Yt 000 P-L U}P R0 -QLM@ GP T A~1 -L!P 31 -kMLM6 6@, @6K0A A 6 PhP6: S OPK ̫&P0S{ x6 Rp 0 S hX%0S` H6H&@DfDv@@ @@@@|0 0|0S P5P(0%<00PC0S0S T5 ,0S ,'H%e.K B BP XP @0@T H6<4"D0# rP@0@Tşş%5@0T06 v4 R̔3S (0 ତ4 @@TZ0Q $R xP0S $4 R ~P, ,4@ &PT6&  S0"",3 0P@ Uh 6T#00/>10@s~3PL i~x3PTChG ^~T3P= V~P03$- 6SR ,@!0@T00 "2 4~B00.~0"S P x2 lPP\H=e,(PPP@4hT J/ Rm녁1  LPP?, m&R0S&#0!S$ ׳pvLPL)$ ,!$  뚙?AL8(1+D<HH1PPT1,4|111112(2D2l22(pL2223(34@H<L3p33333$4,484H4P4d46`# -LM$d, Xğ ?ሁ3 ;P + 3#R, ? #pW3+0 l@W4 Tß0Ea.O8 8 60 & 680@6FV@ß 3 &$6(~r0 2D(&~00~8\ 4 00B+ 0SPU l2 00  0 0 00 ,0,0 00000 330330 33033 @0!@0L D0PD00 550550 55d00d0d0d 0 d  ,1`d0  $1 R, d0\~+<P 0 R,.P@kU*0 Q@PU:aAY H0 80,<4DPpSx4PL(444,5D5p5@-@0 0   0 0 0$  (@$, (@0@, 0000 D@0HD LH0L 330## 330## 330%% p -PLM@ 00 R$h\<5@ -LMp@9-`@vm Pa0@S p1P  0PUZ c qh10  00S 2WnC` `F R R010!,!]c.㍀ 0P3 00C .  }p_%[EUPv}0GOa.U&`n  0 6 & `@i}0PV6@a} p$PTY55 -0LM@H H@P0T t! edA56-L0(&S  d0 P0S\P P1 Pa S\Q 60Qp -L: S  S  S H0 R4 S S  S S(T6 -2L pRxU,P@@ T1 Re1 Ra0ST 1 R |Q|aXtQ0SD00CS0X0@ӤX08FT2 T$ 0S*00CS0"0 R0 0S0   P yTYT nTNT 㢰YT00yTPD/ P!/00XH:/@XH/8n,$<+H8@h6ȑt666 0 -@@@0 ܠpL @@ppT|`V`T  x@xP00TQP  0X0@@xxXpp6 0-PL@T 0&"0S @T@T# 0 @TT  d 000X 0000 0 @P@0cpp6 p-l0LM@Ɠ0\S` @088 000 0 `Ppp8D p-LM0@S` PU 0 {0U ZP 0 PPt0T p 6 Ul`P6@ S6& "," Z 6T `#$606Pp8 0-L0P LR @  ($rP 0t <6+6 -LM8pP(2G 2 R b  ? @_v}To 1 RP a@T T rPwwUp@ U QW!0Z00 lQ3L1 R% PZD1 R 1庤o鷤 1 !@Pz0 @C@0PP  ?}@0@ 0P PPUgHE8DPL<pp 7((7H7`7P|7 -L$M0 !0P@`_ᖄ@K &" $"40 D @K0, SQd4 ,4 P[ 0@0K,0BQM@4 8@ l}Hz4P8pT54 , R0,# @K@_@K0  0`Q 00Vs# \z@Xz0P J88 x 4@0pW V8@Bz0@580 077,777 -PLM, 00 ]@_l!@K0/a,@@K,< NJQG 0 0PP< ,@`K 0㶊Q.0pZ o @ 0R  @@K0 `@0PK_tp ᓊ y,\0 Z<,S00 ,K7777p@-l@00CP XPX`  Q2 00CPp02 0  p0 -L8M 0@K0 ,0  -RSL4M@ Ppl h\\1  BRH %]T 0, P \0 , K X T L H D @ < 8 4 0 `HH\KP@ 0 P0 X T0 PP 0p  0U0?00f f {k|`` {/00f V:TPU L0L X0 0 TP \ U \Kt  ZĪ@d -L > 0-LMMpPANK@D0@D` 0 8/| 80 ρ 0S 00錑8P8 -LM0@嵇㷁㴁 @ -LM0@S _`_`00S lh0 R \P00080Ĉ<\8d8p8 -L`Po똡嘁q@!opb@1 P`````````````````a a(a8a@@1@@@0 00@0 0QQ0 R|0 R 0 R|0 RP0 R X*P LH0`#8 `Lx8 k -0`P0@LpP 'PP00'U X*0Sd0 R0`00 ]<PP($0 ȑtĈ -TuTLM` P0SI00CS00@Ӥ0=tQ U T T 4 R T0S0M CR 000S0- CR 00@tp4 0 0 0Se 0S^0^ CR P000SD0T C@?R 000p P0S!0@0S0@ G|P|3|(0 Sh3 0`00 tP 0R P hT@?H0R]p^=0S0 CR 0@0R P\P0Ro9po(-0RW.pWM 2 R 0S%0^ CR 000S0I CR 00j0R`I0Rp^8^ݲL1 R 0S0$ CR 000RpA$0 R T 0 R 0T0Q0S d 0S0@ 8P ZZ)@6) kĈ 8 -LM`0PSp@3䀟00P %P0S@00-0S0T0Sh}TXy@ P@840 pf@ꈑȑtĈ -1LpM R1`;q0S%  @p@ PP  PP p @TP0x0 KᜠPL@ P 3qP8 `ꈑ ZkĈ\F -PLM@ 6   P@0 -SP0 `SpE 0A0C&S7pllllllllllllllllllllllllllllllll\lllllll 5` %00%`0` p0SV PEU@  .YP PEU@ڀd0S $PPE@ $0S@4<4 44 X U40S yY U  X#0Up0t0 ڬ$P,PU \#QUl$PLU 830S@ U{0c0S }$P 0S0S20S p ` 0pGS D W R0SP 4Q0S 0lrS N$P 0SX 3,2QP    0PE03@1QP Q   0PE03@| 0030PEU@U L10S 0S04600S1Q 10S  ,X0 c|P 01S00S00S @ X0 J|Px&d(Z$Z(EP> Zh<EEE8EEFZ d FZ,F 0-TPL0@S s<0 㝦 0P@0000,Z -`1LM0TqP0S8ݝ4A4w Pr 100000S  {P`"X@  {P0@& {P00 {P0| 00t {P0` 00 P{P0D 000Zj(i zi i `~i i  -L,MD0P`K@p,0 (l$ v PW {p 0S 0S 0S%@PqP<   k{pG<@TU  @00PEU00Sp< p,0 S,錑i$8FDF8F p-L,M`0P@@K0 $ 3v V`0` -{0sHD 2,8/ E 0S gp錑i$TFdF|F -L8M0@(0 LKPp`$ u VU0 @ PK:P @RpS0h-S`@dc"P8@ {D0D zp0 (0S (錑FFi$FF -3L M0pSP0 ` P`  uP 0 Sr200000S0p,KdP ty,PU V" X 0 Sr8200000S "P n t Ph0 r1000P^ 00S .du  AR #  Yu  xAR #,t hV V 00S 8P2 ip,Z  !P% 0 00RSY 0@T 0R @0S 0 0S$0S 0p0SPUx,AVnW@@, W!(ZFFhx( P>xF -L0 ,U(0( yp (hzi G -4L ,U(0( yp (hyi G p-L M$@K Qtx ypd $oP`L $00 0 ` yp } 0$ PS 0@U!U0 0S0 CR 0 R00ꢭ ᅭ 0PU@l0l0S 00CS00  ä0  ㆭ  hnpxi $G@GhG Ĉ -P0LMH@D0  \ (0$0   Zd -0L0   -0L0   -<0<L00, y0Shhi G -80L4000 0x0Shh`#i G -L 0000 0Zd -0LM0@S/ h00S00S P00  r,0T, @00 0 0 0 dZG -$$ 0L00    -L(Mp0@PK` @ 0 H x0S MT3[x DT 0 T KzxP@V 0S, 錑hi (G i GG -L(Mp0@PK` @ 0 QH RxP T3[p DT 0 L K> -L(Mp0` 0 PP, gyP@ 0S`  XyP@D@KPch jOt sP`X (` sPDu 0S0 錑F5K(i$Ji$JK -L,M⠀0@$0 `HPKVp  tא 1Ol isP\ T(` `sP<< $0S($錑(Ki$i$JJK 0-L@MP~P0K8 K 0 P Px P0 S0 d㘐L@KX <0 NH0H $sP4 0S$g0錑KL(i4,L@L p-L$M`0P@0  @0S00S 00QP 4K<9 4 PR h僦 0@K\ NP0P RKrp< 0S, p錑$LL(idLxL -40L0S 00S W 0 $ -L(Mؠ0@PKЀ @`p(0 Dp hN r0s Tv 1 DK D0, S \00L 00 rp<L (0S((錑(iLLiLL p-PLM`L LP@Dphp00P (0!g @Tp`#>@pr>5 -'L}M0 ,0 AmP0Kw0 N'9r눐K8 0m M| +r@K4 "mH M Dr@K   m M r@K  m M rLK Pl M qFOK `lh M tqOOK $ l4 M@ qXZ 2\S VU "RPk"ZP@[ T @OKU[Q 5Q ?KV " CPKK 2(P< ?K K`nOK\| ljK A QM$ qP 5(K@Q O?( K`V LDLQTPjSPQSpS2ksXqx0Snڐ` @~?K2lpK1p`K01@T4 Nqp< UtPP@1@SPTUpPl r300000S 0:SP Pڬl gPPU t'@T|380S0, CR 0R00*, p0KQX U @T 2S0S G 0SxA K \*,1S' D4 (1 (t- p(1h`% $1D H 4$180  E$ @"R0S2S1PK!\ (1!pP!1S h1$0S0  CR 0R00ꥤ ㈤0L 10S 00CS00  ä0 ㎤ q00S =00S,0 S,錑h(i i8i4iiiii$L LLLi|LCBLM M\JM M,M`#J58M@MLDLMXMhM|MMMi M$M -LMq04@Ka  0 kh!k` $` KP1P pP <@444!41 P!@0S2 0  00S0- CR 0R00-00S 00CS00  ä0  УP U 0SD 錑(iMMPDMNN$N 4N ->MLDM1帑0 ,   >KK(@DD@D ခj| RKl oP` ¾0SBH߾?>{KL@K(pG $pG>[tj pj 8P 4p 1K ioP@ 0"<0S <0Tgd000 S @ 00CS00  ä0kO<0TZT ,0S@, F(i HNi|`NtN|N NN -x0L`( @H T @' 0200S0  CR 0R00*  x0 ^^SpRW LDL1OTP|PP)OLQ`PhTd0SHB0S 0B000S0  CR 0R00ܢ 㿢505P  00S0  CR 0R00꾢 㡢x07@ hN NNNNCBNNNNO 0-0L0MP0@@K( 0 ji -J|0| dnP0SX=0 P0 H00<$  0S(0(6i(OOO 0-d0dP0LX@X  L0L00 00I00 $&n0h(85i p-PLMP@0S 00pd00\`TH <e@P$NP^PpOP,P -Lkd0d0`pTH0@#nPp@@Np0 8 0\PP -LM@ED004 ( 00PP8 -LM@'D004 ( 00P Q -L M0p$0  @pp`0h\܊$KP`@$0@@S ̊LQxQQ40S 0S0S>V-L0S 00  S\0S? V 0-@PL0 Np0 ㉊0?4V 0-@PL0 9p0 t00ZTV -Lp9PP`@lێd0p0`@0 @U8r@T( aFpV5B p-LM0@S`P 00  SPp@0Sp -QLMPp W@cX0$  A0S 0 0 SP @0S@0S$ 00 S0P QWl`||Xt H{ H00p@0S% 4in{VV`#pr0ZB5VV -LBM MCNK@D0P @D/㋏KKoKt,0 PPh -LMt0pr$0 0Sq0+S D@B@ <E4PK r.  DE DjP 1` N01S eA0 ! iP 801S `dxP LEWrX<1P 8#"0! 40K@   DiP 01S d EP (r00S 00CS00  ä0 Н 㳝 $0SX$錑jx(h@X%i LX "i \XlXtX#i XX X -(0L00S 0  Z0S 00S "48<#80  -TLM0H@,0 70S0+S 6`p㓏Kpp <幙P,EK30: SOK.2d DO_K0t %iP^01ST@ d<3 (K @OOK <zP,D SOK.c DOK0 hP$01S xMKM`.c, DO_K0 hPp01S <1<1<1<1<1<1@Y 10SB .c4 ZD0P hPķ01S) ,O&81S<1S @8P PdzzwuP Pdkkh ~0 ,0S,錑j`#X ("i XX%i XXIi XYY(Y4Y@YLYXY ZQi hYYиĈYYY -L,M08PK@` $0 c Ph0LpKs  cp php 2[XS80[S 8[@0\#[0  $0S$$F錑h:i i YYY -L$M0 , DKD P)@0D8#H0@K\㨠p`  @  040pb| gph ` CKgpHᖉ ,0S4,錑pZhYtZ:i 9i Z ZZ -L(Mؠ0 ( @K@ P@@0 CR 0R00hʙ>h鬙ZZ  p-LMQ@ hPS @0SO 0CV3B U $1$0S0, CR 0R00ꚙ,}P P,00SP000ӑ0 CR 0R0 S 00 \xPP0H00ӑV P0 S0 S0Sp鈑  -LMMp0UK,0 d1`@ Q%`0VP1 L / P MK!@AP / 00>0@` V?KHP ?g 0gX1 R  _^0S 00S Q0S !"4 40X+ ,0S$,%錑ZZиjEZ -LMK,p0 Q` 0@S  W0000T00TQP  _ _T@D0T0T0 d20ZZ@-^@ 0S\\  P2  RR P2 R\ 0S\ -LM@  zx[ -L(MHq0D@K$ 4a 0 G_,  @ Bdp{0S5 w0S1 4P%UZP0   *dp0@`TU PPE V|`# p @00U00SV -0X 0S, M錑(i$`[l[|[`[ - @LM0  W 0-LYS@TlPll 0hu? 003404 c0S 0h鑽0h[(i [DD: D0D5 0@-@@@((0P\ P, ,0PRP0@00@-@@@((0P\P, ,0PRP00@0@-@@@ 0P\ P$ $0PRP0@00@-@@@ 0P\P$ $0PRP00@0@-@@@000P\ P4 40PRP0@00@-@@@000P\P4 40PRP00@|@-@@< <0@R8 80R < <0@R8 80R@`@-@@< <0@R8 80R < <0@R8 80R@H -LM`p2 P8  P\P{ :@6<&<000婇P(6(( P@ &< p< 10@GS񟗳dX`h$4$P@4$@@@@4Px4$P@4|$@@x4h4d$P\4 P4P$PH40$@4<$0 s4 $4 #3@@@@n44 ;8 0d#003P#x3@@#3P@@p#p3P338333H#00BD3<#< <;#3@@"2P@@ #0$#s"00"q0`aS'2 R2 R 2 R2 R|"0S\"0Sl2 RD2 R,"0S`2 R 80S8Z 0/;40("0S: !0S4 &S " !0S!1 R! !0S!p1 R!!1V   x11 S<1 R!$1 Rx!x!t! 0S SX!S0 R@!0 R0!0!,!Ā4K< v< 0 KqaP"[R40 {D 00+[Py 0u[Z$[  Z(|<Z` d ht@ -1LM1\0@ >Ppm ^u1 Ra0SP@P 30CS|hhhD0.S( 0Q0S X 2`'0PE0SU00V0S  00۹3S 0 R Dx]HD0 SDTSP0 0S0㍂[[[j \ -LM H 0R,0 0 0 0 $5 R5 R 5 R @@ ` 0KV㼐 嬐 娐 夐 堐 尐 崐 帐  @  QQ \  D0.S (0^1Q o @p0 D0S@@@P 80 @T@1Y1Q@ 80S @K 3 R E 3@T PPK0 #\@K0 #P @ \[PY[l QR P   SP@ 0 0;0 0 0;0: S S 00R0 d@ `Vw R 0@S |@ p2KL"0 ST2  `V T`V2 ,0S ,D@K"0 dZx !0t p WZ! 0l NZ1h R0d0  ` `!0;Zd  000 G;0-S 6TLct 0R@@@ Z P [允 ᵁ ?0 R0 0p Q0 R D `\0 ](댑  \Wtj -LP# \ \ P  \  Ph` P 3S40 RP \ 0 0-@LTP 0S@T0  H0H R  00CS00  ä0ꈑ  -L M ( 3S 2 R2 R 2@VͷpQ_ 0SY 2@` Rh2 R<@K$ 0L@崷D2 Rm  0嬷,2 R`0: S SR 0SJ (080c!0蘷1 R 1 R0(D01 R-1 R* : S% : S 1 Rx00CS00  ä0 pW (0S 8( y [680( "88 #$H C, x>X@ 0B ?qX@0 l.n  \)eꌑ \\h\(p\`# \ ,\8\D\L\T\ 0-0P R 0L0x0 R00d0 RX0 R H0 @TUU00Z -LM,KPp |R 0QP0U00  0S H00!0  RP,@0U4 0UP4  4 3S 1 R1 R 1@U堶40S80 Ca8P|! 0 40P_0@U ,0X P@0 S<0 CR 00T@0Rj0S00CS00  ä08 40 R8  m O\ SP 0D @0p00Q$0@ @0 %Z \\  -0LP@p`(0 RD0` R 0 R : S `\@ 0B ??W0 4 ` `L\T\ -L 0KM#f봂r`P0S0 CR 00P Uh2 PP2 0LS+0 CR 00PU0S0  CR 000RÐ 㥐0 R \皐$@HLT0hS0 CR 00PU0 R \w0S,0  CR  00P0S0 CR 00PUښ0 R \iL0Ra 4C0 R \dUe8bꈑ  -LM,KP`e 3S 1 R1 R 1@TPQ||q6 ppq 0S. ,0Z 0 SI0@0C S00  ä0<  ,0Z@P@0 S)0 CR 00T@PU0S 00CS00  0  Pď0Rُ꽏 ԏ 嶏 \\  -2 `R 0@1P LR001 RTСq2 ġq 0S* U#0Sa0, CR U00(Pt!000S1:0S*0D0CS00  ä0P  7P@T0S 00CS00  0 mk mM e G0S0  CR l00P0RM 8/0RD,& Z:  S-LK 5 S I 41 R(*0 CR 000R*0 R|0 CR 000R|| S  S\0 RP==80 R0@ @0 R/ /ꈑ  -MLM@pA^K PEPE\D0 D` !NNK @D@D a r 00硳D 0S h ũ 0HHA^K PEPE0$ `#ꌑĈx\\x@ -h0LM$pK\P@`  @N0s,  d0 ^\L\ - PR@L! p`0S&q0  00S0 R?0 CR 00 PR0R PT?qD00  00S(0 R?ꈑ  -0L N`Lx\S 0-LMP@ K 0K PPSp ,0,0S 00,] -LMp `4KP 0ppRp 4M@T0  ppRp <0<0S  (04x ˅,]  -L@P nP0   0 qp00@TQ P``VP@Dt x0`hp0\0P`Vp@Dt~, ]x|Z0 -LMp W@P<  0S刔判` %p1@T <PL`< 00H3``8#`$3 3 Pb0A QU 0ŸS2  0S "0S}   2Pp PP"S000 8 KP`d"H0SXT PCP:5< R P 2 R 00S P0S RR P 1/2a@#b! 8KpPڲ3[ h0S T0`![<P!VTP@ 0S0 !E{@9 yP uP |ދ/[P  l00Sb0@\hS0PdS T0<0 0 ^<[@[8[4[D[0[<],^D^ Mbd^p^^^^_ -Lp P`H QPP=\KP@0 \ PR `VMP0`  (`T(0S<0 0P0` P0000$| 0S0@LLLL L,0 00   D] _(_L_00P 0 RP  p-LM`zPP@0  0T0pK\0dh  z00TXPPPPPPP p\epbP]x__ -LM,Kp2嘢@ 4pKT ' D,0DPQ h2 R00S 4\\*P0 P0 000D40Q9 @T40Q& , Q ៵00 0cP l  1 Rʄxx!=9 B = 0 0R 0S(,! 0R`fV `0 0000 R  Q $0< 0bS$0$0000Q40STd 0004000,@ m 0Rd ([@[4\]__ `D[0`P` 0-LM0 0@@0<0RF( X  800 S807ڐ0l` g0/STR `Q0.SK R pGy< 0ꌑ ]bbx bc,c`cccccd0    -L(Mq0@PKa @ 0 . SPb3[0 3KSPV .h RPD3[1 LL!0MP"P  0 S  , 00 0  0 3KRPBXt 0:8X 0LvDsꌑ i i i ](dDdTdhdxddi ddHG -LPM␡0H@Kp℁P `(0 HP DP @P s(0 S (徾L dP @0S0S 00S.WL { NK)K NQPL s8ꁠPP 0,]w(, q ꌑLeIi ]Xetee 0-@0P0LSD0S 0' ; {0P&P 0x 00P 00;8H 01|$ t[]0   eb -!LWM0,0  㲀^{PpQaKJ/ KT ,D PP9WoK0PS  @X 0]KS  P U @ʶ0Ssr0 ,0S , \\ K.0 ނ0  \ ǟD0D r꾟  0$ iꌑeJi(e^eeb -LdM┑@q, KⲠP0K0`0 ` p@ 0K K` `0P` 0 R  )0.0 PPPP0 R /  \ Ksl`K@ B0 0p $P ,0S X,d )@M0 ꌑ ^f 0fb -SML ,8 M4% @% L% , 8P)( ȟh,   8 < D H P  ' ~pG E0@2S%**%%****%***%%***&********* $& ''''''X(**`)))*) *******0Ɵ:;;@00S VA0C2SED%t%P%t%t%t%\%t%t%t%t%h%t%t%t%t%t%t%|%t%t%t%t%t%t%t%t%t%t%t%t%t%(%t%P%t%t%t%\%t%t%t%t%h%t%t%t%t%t%t%|%0<00Sy090;0:0;0:050d08@şD0:4 D 07lGKLL48EG.K B :  B0| x 2P 0 H5 R09=Qd fl0:;830TNKA A Z@ '0S 0 R 4%RQ #NKA A \4Pژß0 R 4 R t 0@006}~sP00L0<0 8 "NKA A 23 R 4 R0 S  "NKA AOt2p0S2 4 R./ P+P"1S@.0 3{/ 31T  2P0010 UsP M sPx!NKA A OP( P0 R 4 R\ ,dln\}PP R080 00G00NKA A $2Pڠ0 R 4 R Pø+d0 0:;70<0:;:?.ALg<(/tgggg gh0h'Dh'hhhhhh/ih/ji4iTiHtii@/i iij jK8 @: B0C D 0Pj$0S |0 >00 )4TPV"0  ONKT2@D@DP)`' 0T `TPl2)( 0`TPq XSp d 0S  #0 R0S$3 #0 @>0>$5 $@P0 < #0 $5@T,@$@T, T$0 00000000@5D@T@0E @l4 @0RO~KpG5 pG PPw P)* 0 SpH \KNK@D @D0t% R44:0  4 $: 0 {SPe0 (DlP<0 < s<% <% <5S D%R @5@ 00) .00   ,0S  H @ 4%R H5P4% 0s @00) /0 <  0Q@ Z&0)) %R p0S LK&@D @DT'P0PSPl6,'0PSP&@)$ 0 @RP7)% 0@RP_(@] @Ф@ ʤ (50C(5 (| (@( X(q(L8LP(0` x00KNKMK h嘨QKL@AI L@A 0I\ T X PUx@Tq0Sj(0 bt@0 5 @cPR T8X04 \\5 4 0$5 4 TC>K0C D 4 dzP- X%0  R 0S)9  0 aBQ9 90S ~XP(0  8 6c0S P RZ0Sl   @PxK:EK0E>KL0C L0C 0 0RR: RS`Q 徤& 廤 l ~0 S O>K0Cɠ@0CP+ @Q` p~05 UuPP;(@H\+0@0 )H5. QP0s ); QP0s ),< QPDLP 0)3 QP8%bP,K B` B?lP5lpPJL@%@ 0 L% 0) 30  L0 LPL * @TRlK`F`F  0-P@ 5L 0S LP T5qL2>=P <@ =@K0C0C QR.00$ t}q}$> ?P   1 PPI\ GJhKPL 00 0<5 4N 0K8%0xgPǶP0  P$ 000P  / -LM8P |0 R 0 l00 .L 0-P 00 @4 @ @ @ XJ K P@@0/[$Z<00    0 $/|[ -3L$M R 0SS@@@@@@@@@pp3  4A\\!00j0Kvg_3 3 .$(," \"(!̠0!0 `.2 p22@80K8P  0 0@ ,@ 4p w0P0?@ P`2 X00P 8 t,嫢@Kw<@@<4 Ġ̌(<"4!Č ̌$1 1LQⰀ\(0pW `Ѝ@-A\.b 2l20@\@=B\2a20\0 -0LM`pP@000s 0s!,K P,00CS onooo(o@@TT(00T (00 -LM@ KPP"<p` 0 p70s 0H 0@0P* 6$^st/LWp/tt0\F -T0LML @K0*0$i6000 <0s Sp/0t/LWt -LMH0HD@|@ 0@ p<Ph0^I^Dax/l/$W t -L> -PLdMPt^p6Phw\^T&PHFH A<P,6,6, P6<P=`Ɵ*(7%%5@@@5 F?%@@ş5ş!p%P0K@@iA?@{Gz?~@tt/ttl/x/%W ADa$W qp/[V*^Ha\a_ttuu? O ( O \ X XTd ͠` \0N @厓$P@$p`P\ -0L ~`Lx0u -LM`0X"XB00P0H0PPE 0S00(2( rP000 b32 .0S S,Q,O,M,P u@0SPE =,U 0+S-S0S.P.P %.U@PE PxU`@PE0SPfP wPr P ~00S 00SQ-1 @)<;aPBPcj_FGv`LThGGvvvwwwwaGw p-LM@4P ``p -LM/@T00.0@w0 S S0 S S0@-S@  TAN Ra0NS\ 0RAC\ 0^0 S -d0LMP@@L0 ;<00S 000SY/ <a0 G|aG -L0MԂԢ 0Pp(0 PTPK 2b 0S @@oPH nP6 2P- PD2[KP) XP/ P) RP, KP- M P< 1P/ KP) CP, K P- > P3 K P- 8 P0 1P0 21 .1 +|1 (p1 %d1 "X1 L1 @1 41 (1 1 1 1 0 0 0 0 0A[?[0HP @@[0G @0H P 40K9K3K6Kd<@T K\bp (0S4(ϥa Ha0@G0GlGw p-LMP`0,@KHP 0 , G 0Sp錑ww -LM@P  00R0R  00Sh/L5 -LM@P h~00Sh.L5 0-LP@P $00S0h. 0L5 -L M K 8P@![A[R0 ʐP Hx0td P00TT0@LP 4400 PP00ht@,Gww\G[w -LM 000000000000 0000 `0`圢0A> 06 pIpq QcPa 4S4S 4?0 <pP@u*`0A>@t 0 001 0*l%(pP|j*?T A.0O0P000B>0,10S 4PU-/0K000 *9040 00S 00S" 00 0000000`0` 0 0 0 0000000 0000 `0`0 $4SY*0T5GaxaxpGĈH -pLM@ 00s)0@ax@-`@? 0"00\ 0S0S000\T5 -LMZIp q  Z0Y0:H!O 4  6y†04 S4 S* P%0 4 S4 S0 4 S4 S*p 00 0 4 S4 S:T0O YA. P ` `6& 0I6Y$T5H -x0LM@ 4 +BN@Ap@0t hz 00NpT5H 0-LgP" 0P0Q  0R 0R Q(00A> 000 $$0T5(00S00B>0pGT5@-(0A> 0$Đ6I T5 -LM@$0AR 0  0R0$$R 005:| L0$$R0$4 A  0@0 0$4 T5 0-PL $4S0C! 4S4S 4 A> 0@0P0 A 0@d0 $4T0$0AR 0  0R$$0R* 000hcT55=?0/9P6 0S000a p- LM 4B>0 pQ 0P@00QP`@BN@0 A>0A> 00$d0(@K B>R0  40 40 09pqph)(pT5x -LM&Px 404@0  0000 0 00 0 T50 00  0?\00T5 -LMX@ 0S 00 08% @0S0 04hT5 -LM@0 59pq @ -LM̀p`7P@TC@!t&A>B.A 0 0$D4 dD P  40 40 4stotaT5 0-tP@0L 4@ 4@Q 40 04T$0@0h0T5ta00 T5pD0 00000Sp00000S p0 000  -p000L00 0S0  Pt tuP@ qL0 0000 0S8 0(0$ ] `dxX5xx(0 $ 00 0 p7`5h7`7l7 -L 00 0`7d7 p-LMP%*$`$@000*000p`7d7*`5 -`Lp00S 0P@*x 0 0S %*0 0 00(`S@0S0Sh7`7\G 0-L@LP 0LR0 0CS00 00 00`7d7l7`5h7 -鐠p0 刀0b? |`PUL@0S 2L*0 P0b?U0S( 0f0@m\Gd7l7`5h7 -錀p0 儠0b? x`@TLP U u *0 @0b?TU,0@ 00c0m^\Gd7l7`5h7 -PL0`0pS @) 0 R ) 0 0CR00S 000$)000h7`7\G p-LM|` x0RR@)`0`P0 0R00C0)00`00S c0Sph7`5d7`7 0-p@LP)`0P0)D P:00@P*0P0`5h7 0-t@tP0LS 0S 0S0800 P0S00h7`5t7 - 0L00S Wh7 0-xPx@0LS 0S S0S0S S 0S 0S S 0S0S S0h7`5 -LML@00 S00 S S 00 SSh7 -H0LM0@S ,0@$ 0@]00`5l7h7t7 00at7 0-L@dP|DLT,P0h0hlA00S S y00S SLM0.0?.00e=@]@0 S=@= +=0S?0SeXC`0SeX@e dM0S P P 0S#0K$`K$K P P 0(K(0 F@(P]T0DcS&TPldоdH|||@(,,|D4d 4PL̻H 0Lg,+0S0S ; K0S0S-:0S:  *0S0S : |J0S0S  P` bP 0|S`@ 6@Pp8@ 80S0%S 0sS R080 @p00@T:@dTY 00SP ЋP)K ‹P v)[40D@00PPv0SGGd{t -,1LMP, UBRvQPp; @ 0,@`@Z0 %S0sSZ  ݻ , ׻,|P@00PtU:@T oLvGp{ -LtMK@OP@x0: S@@ p-LtMP0SK` C@i `)0S4`d00S0: S &*@L `  sp\dGld -LtMK@{APH0K00SG 0-d0L0ST00pP@u TU 0000pGHxG 0S00>|G -L M@000 p`P00T,0  300CW 30SW200CW 9B2 R 200CWUV T0S x20S C,UVP i; R Rj -20S pWWJZZ`P#p`Pv0X,0 p@q>P ,PL1AP-00Y000 # 1 00S0uv   00S00S0   00S 00S 00SpWZ00S0   ,0S 00p 000 00SYk 0 o~ ,GGGGd|{he|GPG HpGxGH -LM@`PpTW 000CT0 @T Jp`PvY Ztz@@TZXZ!o7 ,GxG -01L M0pS` 10S P; i9pP@+u)V 0AP 00S PP@ 0pP@u l0 000 0GxG,GpG -LMp`pP@uV iE 0S<00S,00S 0 0S00CdGG',GI{ P000Pd -P0Q0L00 00 000dd - L00 00C0d p-LMP`(@0  000p P0-L@P@ 0TC0h@0ta0PPd0PPd -LM@0S00d p-DPLM@`T Pp@Tpd 0-LP@P000P0000000000   -pLMP@u) 10S1!00`Q0 'P+vPp@ =P@< P00 P8p0t T %  P 0`V00S"00 P``V 0P@` P@@P @Fx00S00 S 0 P@ P p+P@GdpGHGGGG -pL MXrPp20S200QPW0 P@P v20S @ T T10: P@ P p1@0`PP` x!0$ P@ p|`PP,  0,0 @7Qtp@ 0000  &0 P` P S @0Q P 0Px00Sl00 @,@ |@0PU`XW,x  GdGHGGG p-pLM`Pv KP#p P P@0P`40`@0P`p P P0`paa -L0SH hp0 s 0 0  Bh{,G -LMp`pP@u P |00Sh0 tW V P@(0 f K!GG{{ -L M@Kq O p-LM`pP@ux-}pP@uPph UT0 ph| |G p-LM`P@P  P pj[P@$00S/ phG -L M`P, , SP,0@cT A dx]P@ Ho1pw0x00XW0A ,0@T)y z  V0 U0 1 ,0c@0;p`Pv ,0@T| ,1 ,0@d@ 0@ܠ,@00CT Tp`Pv XW  000S o60@0CTA }D0@@Y 0 0@@<|,GxG|GtGG -hL` 0S 0 0S<0040   0+0 `|,8:ddd -p嬀0L`PPጠ @T0 0P0:  c  bP@`dddL0 0DS@0 80 40 00 ,0 00 0 G88 888 88 -L M@@0 S( P@p`p`20S, 2Ÿ  00 r0s 0SR !0S0S1 01 00p 0 00 0S/@@K 0 $1P a,1UP0!c0@PP 0 0P00 0 0  0Rph0 00d0 0000 S 0 (0S8(GGd8aad 8d\8t| p-LM0`SQP@0SPE P P@P0SUfp0SQ 0S0ASQ 00S0 0S  -qaQL 0@ l0T@lT@S   0^ࠡ0nP 0 000 h0 00000nP0<0 0n d0  888addG@P ,$8H@$0 0004GXG8GTG@P $0 000$GLG`GPC <P2 10S ST0 )0P0 @@0@0@0TP 0 PX 000P 0 yP  000G88add`eGa 8\G 0-@1@LP T00 P0S1b Q 1 Rb\0 00R 00S 00S00S 0 000 00000 00 p00S d00S *00 00T000 8$8GG 8\GhGdGG8ddG8P00S 00<0< 80Q0(0000008G|p6dd0 0 8G p-pLM@0`t TPP+p@ p@0t T T000CUP800@P@0 V000pdd -@0LMTpPP $@0ꌀ0P0PE P@ p U `ZP @0<0Pf (0PE0@W0000dd@-p@T* R  :P0b0D 6@0@@0@0 T8>08P8< @-P 0S 00Q 08 -L``P@ T 0S0S*0 S0SB @ T 0S0S:p R000 0  `0St0 @ R0 0S0S@@0 S$0 0 0 08P8> -L^ 0 |de -LMH@0S dR 00 000P00>> -2LM0pS px} XW"Z 0S 0S *Z 0S0S:0S0S0$2Z 2 00`PQ PU`R?Q=PP;1 `XW f1`P0 00pv  0x@0XW4  0 V;U9@04P 0 `VU a0`P0 00pv  09@0VU80   G08>>Hde -LMZP,"PU 0 S 0 S *PU 0 S0 S:0 S0 S01U 00 p ` Q `VpR+Q)PpP(0`ZGYE $1p0 00px  0@0P`Z,Y)pP ` V U x0p0 00px  0@0P` V U0 08H -LM P@xp` P@t0u00X00S T00XtuP@tTU@0,G -L M0-S MGECF, ",2`3P #LPp% 0S" 0S1PP`  @ @@0P 0`mxU0S Plv2  r2lY L H40 , odp6jX{L|tG 400S A>a0@S<0 -A @L2$0R208@<| -'PLM! $P .P ^P@0 00 HP|@000C 0`@`000T@P@ 0s0s(>{,GtaA| -LP 0-LM@ PKT 00000ta -L M@K0,sώ0s 00@3>ta -L M^@K |0^0s 0s\0000 H00 0400 S P AtaG -LZP ,0, 0S ta|@-, (02 S@04R>> 0-PLMP0K K@XP# 0S00R0S$ 00  w0t|he P-L0 i hfhet  0-PLM@Y P 0P[0=0C:SG&4&4&4&4&4&4&4&4&4&4&4&4&4&4&4&&4&4&4&4&4&4&4&4&4&4&4&4&4&4&4&4&4&4&4&4&4&4&4&4&4&4& &4&4&4&4&&4&4&4&4&4&&4&4&4&(&lPhPdP`P\PXP@8Pg040K 0(10 e0HHHjjjGĈPPP0GPPPA -@LMTd ThL0 !@<840,hn}|a k }D}}}} -LMЁ0P@$0 * TTbA`' 00B S10 0C00B S0hQQ@`0,SVVE1C B(1`$1 <qK L0S#T`VPK K @ 0@1` 0`V@K 0@  ` PK @ P0@`0P KHP  $0S4${錑ddXe\e$~5X0~<~ĈL~ -PLM! P P( R0 0 0S 0S l|T0T Q0000K (0,0 K0K00K0K0 eaaT~x~ -l0LM@QT T@ hNu$0  hG~|a0 R00G,G -PLM$ \ R 00S S  P$K ?0000@0pS $0@ D$0 0RV.P-P-P-P-P-P-P-P-P-P-P-P-P-P-P-P-P-P-P-P-P-P-.P-P-P-.P-P-P-P-P-P-,P-,P-P-@-@-@-@-@-@-@-@-@-@-$ 0+SppW0$0 q1 +P0 (K$( $ 0+S0(0 1[GX$0z@0C$0 6a0DPS``-P@<0K0P 0(0 000CS4-..d..... W'P000"W $00Se S$0 $ 0 S 0$ (K8$ $00SR $K 00S($00SHBhepa~ -LMP( `P@p@@P0U 0@ 0$K$0 1U0  0 0S SU(00SPPU`  000CSW/40,10,1,1,10UF U IU F 0 0 S008U4 U 7U 4v1 0000vp1 0 00X0ESDU U U (K, K,0S 0 000S U(U 0 W000CS111111110010$K0$0 U 0  0  ~~~DtGQ PP -LM2@0 Bh -LP0 0S00 -LP  0   0PB -LM0K0 =l -0L0hB -`LPp@i`0PSE 0$S T; 1P80 0C$S'X4d4d4d4d4d4d4d4d4d4d4d4d4d4d4d4d4d4d4d4d4d4d4X4d4d4d4X4d4d4d4d4d4d4d4d4X400@f 5 000S -L Mp`P0-S@@000C S U 00V(KX(`  00B S10 0C00B SU0@0X` -LM@ R |00S dR 00X0 0P0 0H00 R 000 $ RteGG0L\0S R 0 R000000ӑS$0SteȐA0@Sa @0R0-P00 p-LM@P`  wX0@0P SP000000SwT Z0SppGj -LMKڛ -LMpYC`@@@ 0P`Uj -L  M0KA 1@ _P1$a0d P@00KT0d  U0K 0  -L`P@M\0K0 0鐆P@ !) 0 K4\0d 0\ 0 K00PKF" $0K p-D1LM00@`1 (1 p0S! 0DS 999::00CS 0:8:@:L:H:}@T U7`KPP0DS :::::l 0@pHtG H p-LMD`DP0@S 00P5P0  Ppj B|atG 0-@ L08PS@00 0R+0@00Hj F -LM@P P -Lp`$M姯Z, H0  `vp0.0K.K0 J0 P@0@@hp`0Z-00hH  C,0 S ,v錑d -Lp`$M姯Z, H0  `vp0.0K.K0 0 P@0@@hp`0Z-00hH   ,0 S ,v錑l p-LMP0ϰ0 0@` 0K K\0/cC!b10@00R0a\-00a  0Sgvp錑gfffx 0-LM@P0$@K 0 OB 0S Nv0錑 0-L M@P0@K 0 }7* 0S 6v0錑 -`LPPp% %P0 `p`0nS dS sS@P pPpP -LMx qP@N T T Tt h{ -0p L \ `P@ 00S 0@0 S @ \00ShLD000@r000T(0 hH|aGTGjp|aG\GtGpT00C p p000C 000C?001,Gj0@-H 0\8001000\0 010,Gj0@-<00 CR,0010 BR0 000,Gj0@-8 0R (0P@0100 R0,Gj p-L MP` 0@R$K0S ]r0 00$0s 0s 0 01$ Kp,G Fj0@-P 0S0S0X@0^! 00S 0SN00^0j,G 0A,GP<00 r0s  Pj@-p@0\`0 0r0s 00000\0 ,Gj 0P PPB@,G -LM\X@T|LyDv@0 8q40 ,l(0DuHxuu,vjvjvj p-LM@?@`P8 0S BPl   Y10  pFF -0LMK0K00K 0-L M8P0@K 0 . 0S t0錑 0-L M8P0@K 0 N 0S  t0錑 0-LM8P0(@K 0 n 0S s0錑Ī -LM@u q0r00T00S 800T@qr ,G -LMB@6P񟗓JKJKKKKKKKJKKKJKKKKKKKKKKKKKKKKIIIIIIKKKKKI4JHJKPJKKJKKKKJt1 p1RDT10SD1@18妭B01$1@0S, ]pq' P0mp@q IQP@@ <0 SPO@@.p q  (0\PFFGxGtatGG p-LMB@6PN\OL\O\O\O\O\O\O\OxM\O\O\ODN\O\O\O,O\O\O\O\O\O\O\O\O\O\O\O\O\O8LXLdL\O@M\O\OLM\O\O\MM\O\OM\O\ONN\O\O\O4OpP@u3HP@UʴP2 R B@0`PP`VUP@UʖP\2  B?@0% 2~2S P@@v@0`PP`VlUjP@UdPbph\0P@ft0 u SRCP@0= Mp0 s6  4 _0 S.P,Rph=7p0 s ph 0S 0S S00CS00S S L0 00p@,0NP phph)pG,GtaFF{ 0:S S@.S ?S  \SR R 0-0LP0CP@ SfPQQQQQQQQQQQQQQQQQPQPQQQQQQQPQQQP0B0C2S=pQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQhQQQQQQQQxQQQ`QQQQQQQQ0 00 0PE000G -<<LM0pSP0:S %S .S) ?S \S + `V $K00!c(PPDP`VPE $K@@!O(P $0S PW00P:gFF`#0j -D0L<080`00 ,0b A0 \GTGG0 ` PP` h P00 R00SH0  0K 0P 鸈FGFGFFG -L4MP@pß00K @KP  R0S `  D `VD r0s tu h20S R0S0S *tu $200@_0 K0tu 0S0S*100@_10!0S0S00 ?SRp00pWÏ0K D1t u  y0z 0 U T P @t u  U0T0 " 0 @0K@  Pl q0s  ,0S00S0K@0K0 K0@ K 0FFdp@-`^@P  \\ 0S 0\ 0SP@Up^p 000H 000H 000H -@LMTP oDl< gdah]k k8k -81LMXH @@ Kj`C@L T:R80  @`Pp 0S0S 0 0?00`0  X 0S L0DS$0   iH ktG\G,GGdeG -LM0$ KK 0 0 6P$ - L P00 H -LML0K =p@T0[S00KT[ H -GMLM7GnK, 7ǟ`F `F@0pxX D D d'+p 20@FSoouuuuuuuuuuuuuuuunuuuupuunuuunudpuppuuuuuuuuuuupq0q0$000QK1 Lԓ4S (0,0dQK1 L4S d0 0QK1L 讓4S000 1 bXq$B^KPEPE@8VP  3P $0@P vJ0-S | Nh댑'Hkxk|k<4Llkpkdhk|4tkȋnt0@Y.@P?/@@B@DRPN`,0 @H`VP$@Z -@L MX &>uopn00uX$`pZ p-LM&> @`@K NP PU$@p, -LM@_d0q,' vPQ P@   ^,` Jv  V  A0 0@n -LM4@_d0q,' ?PQ IPP  b  ^p00P0S@,0  ,O  ,0P @t  T @A zA0 0Q  ;@@nsd -GMLM⼀0p`,0 MK@D@D 0P^0 )K oOn@P0 ` QPU@$`Z ,0S ,H_錑@ -LM堐OAZ>,0 }nP 0  @hP@J,0X H0^S ,0 J,00XP`p,0  Ld|8 - 0 S^Rdn -LM P@ ?0 1<00 ! 0! 0 QQ?  0 1<00@0 o0S 0<?S 0S 0S0?S0S  M-LMPT00\,0 `00S S00\ ,0 !0SS:P% 0@0@ 0? <#! 00!  00 0? <#! 00g,0S 0@0 @   !0$0   k@p -L1 SB  N! 0@!0!! PpR \!!!!!!!!! HH,rP) 0 !\! 0  ` S ! 1 R !!PP@ @ PE0Nd0 , P@ ^,!00p@ ^0 0p@  ^0pP@ ^, 0p@ ^0 0tp@0^ p ,Xt԰0H\ p-L MPq00  0`0S Gp}@11Tl^= t @@o! 00@6!0!P`,Xt -LM`|0@ 0 0p0S$ }11.QQQt@0SPU`=PHGHEG@ ?_09G,np̱ 0-@LP&G>0逫 -LMⴠ0`(0 @K _ G 0sp  (0S <(9[&=0(@G=@ꌑ -LZ 0-@L0S P0  PF0S00 -0LM@  &> =U< -`q00 L 0p0S2 @| P P#Uw 11>p F11>.QQ$ DF<< xpsFT|X 0-LM >P R|@|K  0S@ pX C@0TD  < ZD 0нؽД p-MLM`@0 0 Pp* AK@@+0MP! T*AKAA 0r00000S  r\00000S 0S@\:E0 S9Zp錑L{-Q* rh000000S  r@00000S0S QQ: p-PLMU`x x0bd X]3 0@0ၼPP0PX0pвH p-LM 0@Px: 0`0X0S 00 0 0區@P @- pĈH -0 SL0S S h0 hr  -0LS S h h  -LM0@S S 化   h -0L xBY`Lx( -2LM0, S Q 10S 1 0 RA000Z ,  00S SJ10S? t1 R;,00 ^SZ 00S$S0000 0 a@!T@@@@pPV0 0`Y P00QP 0 Q`,  i pa Pp P`^lPd0`@/P 0, z00 0!0 0 000M8O,OM@OxOTOHO`#@lT@t  0-LPcP @Te0hU 0-LMPP@0 SEKPH00S0@{:P  0 ᣕ0Ĉ -9LM䙟 000`fS0  eS gS )))000P@00GS񟗲TTTTTTTTTTмммммммȹȹ$м̺ммммм м(мHTммммммммммpxммлмммм0(8мԼ@HPлммммммммммммммммммммммммммммммммммммммммммммммммммммммммммммммммммммммммммммммммммммммммммммммммммммммммммммммммммммммммммммммммммммммXмԼT u6 0 00 R5 5 5R95 ! 0 B 5E ,K:0, R( P00R0S p AW`5 `EPH%00D%6 ,K0, R P00R0Sp44t44  44 4 F$4 4<$$000jxx0 0 0' \4\XX 0D4R@4P47OA30000E3 3<3   83 33/3)3 |3$3"3 333,C P83dP LP 803 C 3P0@S@ # 30Qpp6L20 P2U0!0 `c  TPV00 SV00 S00`F00 1h0dS"0T00H2 0@T03 0 h1R0S040  00CP \1 P !<^x!d04@T<10S\[?V00S0  VTP0P 0 p `Fvp 0 `F0 ?vpWU`LlOHOTOdOM M<HOLOOhO0O$O Mnx`DO4OPOM\O(OXO|OMxOMtt|`OnnMOtO@O MĈ  -LM@P0 pK# 4 p P0Sʄ0 Q T p`p  00 05 ,  -LM@^ h@- 0@R:T 0 S* 0R S R  :0 0b0000L 00 0LL -@L0P00   T00 0D S0<PP4 0 0PS0hLLLM8 4R00C0 R0 LLL -LM@T- -LP p-0LM0Q 0R0SP  P` 3S S S5 0TPP@60S y pOhO0Oj \ -PLM`bPP20S|GA P `20S+DD"0@S82@@ 00K0` <@ @@ &0K@  0@@pK0 K\ , * 1@ <0R0 0S B S@ < lP@tZ00 R00S H!000 810S,10S 10S@q0S 00S0@ @P0SXd6@X00 R00SY6X 0S0S0SL 0Y0 R00S <00SD? в|OĈnMM00S_S:   P0S r200000S(0_S% 0S! 0R rT200000S0_S0 Sr200000So00S_Sk  Uv 0b00S10PcUmp]0O00O0SO 4SL @0 0 SrT100000SA00S_S=   P0S r000000S+0_S( 0S$ 0R  r000000S0_S0 Srh000000S00S_S@,@  0 S 0 b10PU, -LUPT \F -LPJ ` -LBP@ a0@-@TP* ^ \00S.^ H0 0S \4000 ӑ^ 0@T:0TO\OȐ-\0Q 0\ a p-02LM0`S@P zP20S U 10S0 CR 0R0 S 0@0$<P10S U `1T0S0 CR 0R0 S 0@00;PU 00S0 CR 0R0 S 0@0l@0 〙\00S 00CS0 ph0  0p phPO XOXDO -LM@P1됁q`!jpa@. P&44444444444444444<`1' 0`00 R1R0 0 @b0Q T00S B|0 R |0 R V @PD0P@S@, O<ȵOpOqP 0SpO -L 0KM#+㙉 -L 0P|MxD\x -OML M\3PJK@@| ,  0c(#ph 90@?S_HTht804004 0408 0404 Q.K B B< 040tq 0S BnK`F1`FQM:PB 0 4 04 $ 0* ) T XQKA{Kp* Z5<4 Y584 X5;;44 J>K 0C<Pr.P P| i.{0$\-PPL 0<1 7L댑<8huxwHww`n -LM@P L  q0@0  R\:n Th -LM@P L  q0@0  R\n 3 0-LM0P00CSK @ 0$ ϓ0 R  00@tꔷ< -L0Q oK묷x -LM`PvP( @(K,pK 0  (0@S;^ -L M0@p00 0Si b7PP 0S nSZ =؅P0`0@Q ~oP QLQJ  0V0P 1 0* Y0  0000V 0`0k-00 ,K6t, ?R0S@p @Y-0"Sl 0~Y000 LPH00D 0oSP g5noo,oHo -L$M<@K`P]PD  P40KPsC圃 -0,0K * K# pr ?0L:Sl88888888888888888888888888888888888p88888888888 8,880000S  @@Kp| @ ?@*l2000,K +K.0Se D 00|!0`VQF `Fv  AnPPp   0z`Fv P@ p妄P 塄P 圄P XP@D0S  Dp\0l 0 a6#40K`X^0XSSpp<pT}(knrs0p -LM0@S\ RPH MP8PBP (knr -ML M0ß0`@( ,0 @*3P`d088 B~KpGpGP"04 0X C048"qP0 T  TPP KA >KA B0Ck048\480   82X4"@ ,0w508@Tn p@` P- U4X@ 1 ,0S ,IKAA Q5P<8#4P   \P50f {\2 T2w!0PU  0R0RQM"0!PU  Rw{PU t!0!S30S- 8!0!S$0h0PUz #PUu  0K@?0j0 R< "yy} 0!S0ps0$ CPUS j{hX 0!S0|^0E?$W`#pHZ\WWxZWWV4W^tX{Լq V$r4WPZHrlн p-@@LMTP`& 0-S4 @P+\d8t|`@DTL0ph`40 ``7!`rW-P000 R b0P P51:P13:4S<4<,!4$ <,0!$d.,0 00 0rS R0l008#8S \W|Z 0-LM@0 S  0S 0S0S0SP 00 S 0 S |>00 K 0 (0 $0 0 ԇPDPU <xP , 000ꌑи \W -L$MğP`P4 4E @ Q"""""""""""""""""""""""""""""""t3 @ mxPU U ß 000U000DS!l"l"l"l"l"l"l"l"l"l"l"l"l"l"D"\"l"l"l"l"l"l"l"l"l"l"l"l"l"x"HKLK 0D@ H @ < 8 4 0 , SP7L R/0S ,hL_ R R H0S U  00S S0S 1#$0$0 0 00S  0H P X00U @ ``P ̮P X0 XP1Z@ 0X P P 0 ( "# m >P P0 R   $00i*t lldp `p \pXp@PLpWr\WTZxZи E@WPd|V|Z8W`WW -LM(K0@` ph(P(<x,Ġ"$Č$U `@. ,V00H@0<00 !0 0  0\WZTZ -LM\q0S  S〠FK0C0C p) 0 0R };nK`F`F+:@t _0K@ @$8 ?E `'0S <P`ꌑHZjLZ,W( -LM0P,0 XpH/aZ cZ gZ# 4@`ğ@PPP@ `4Pp@x4, p4 0X $P0  LT H4@T0S0C0@@$ 0S0 30S0C0@@ 0S0 30S0C0@@ 0ST#0 l30`S0C0@@ 0S0 $30S0C0@@ 0S0  20S0C0@@ 0Smp"0  20S0C0@@ 0SV$0  L20@S0C0@@ 0S?0@gS@62 R Q P Z a/9P@ 0SP 0R 0Rt hdX'\1 R HO',, v_H1tx 1H0`h0S( 0  00HXS\WWX(Wrr,WTZV|Z8W`WWWZLZHZWVH4Wd@-0\000|S 0n00\0  0S S @0 0 Q00a Q@0\0| q\00S\W -` LP 0 S S0S  0S0 僄頻S p-L$MBb0 S P Q \ 0S :p1 %0 0CS11/$1,@K%Ph%``!< D% 8% 0 $%!%0S 8^0(0 L @L@40P@y%}]800`80l%p  |d%0Q S d]% sTX%L,Wr 0< sP\l0s@8PF222222222222222222222222222222222222222222222222222222222@<840,($ @h `# -LM`L@+@$pQP,p  o`Q P 0P   R RP Rp0S0C00 UZ00U l$Z `B0P 0H$PW 0fY  $X $ @QC $$! , R s$(0m$004 L f$8Q,00 L ]$t1 R 0 XS$T! H1 R 00CS00  0 oV o8o>=\800`80w*$ Rj Rg0Sd0S` R, ]g lo `?TZ$8WL`t 0s,W@t4 p-LMLPL`@H#0 4#$ |0 @ph rht -QLM`p㐁0S0t0CS00  ä0Po  4(,$#!H0S<00CS00  ä0/ P@ WT% T# 0B00RPP@ P@ W T T h# 0B00RPP@pp  l @t -QLMP@pI \F 0LX3Y |aW0,<SN0 CR @000p \0 S10 CR %000 \\@W 0 R0> CR 000Ri0>i0R \% 0R \  0 S0 Sꈑ 0-,@LP0S ]qP@0p 0-LBMP0\0 @ \ x  0S d 70( L"\F/K < $ ꌑ  -0`PL@ p 00B S0B a0BSWBA0BS7BR@P<<<<<<<` `Q:0e0b``` -L@LM "00 P 0;0W\W -L M0 K@a 0Rr -QLM@ p 5!gP~ -LP,MDKHK`@  0D @ ,@ !P( T0 T0   0 W!0 R0 R00xxtll dttt t0t7!ddd@ `00\@+!PX`hlpxpW (LT@-@T<0 1  0B0R \ -L@MDr0 0 @0PS \ K 2 R X0 R 0S  5 0S W\@T`T A 0p: 0<0XS0L  aD( 8< 4,aQ((( 0S/A00  B LR 000K  0S 00CS00  ä0  0R Pd00T@ Lp@0 R00ꌑWxxtt W p-LM@0`SPK& >L@\P XH@XP NTQ@@P 0w Dp000|t0@ S,FFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFG<0S88,0(0$000[ p-QLMP@`" ?0S S Ul0 R \0ph0 @`p0ph "48<#hW Ĉ p-LM@ `PT=  0K0ES0HhHIIIIIII00CSHHHHHH R| Rttphlhd`\XTP(D@i$,48@L\ht|@ -LM\@ !\ "10Q0S T0 R h;0 h5h1 R R 00S S "48<#800000SWD\Ĉ -LBMp@!^ @ `@  0S d 93T00SPNK( 0} ꌑtD\ p-L,M` 0@@KR0 P !KT*00 R ^:00 0S 2p p-L$MŸb0 S @0 R| 0!S-LLLLLLLLLLLLLLLLLL $W2SPKPP 2P 2  R  v2(,KP  "RU 00S S S  B0" 0"R0G 0S S S 2S@  OP"VO0`0K  V2S1 2S  OP1B0 `S1 Z(RU h|1s|+x$t!B  tePX ttt  1SXtfꌑ(LT\d0Lto`tXjtjkĈ`#, 48D3Z\| xo؍ȓ0p<00Sh0p&* 0|1 1 kP 1S̾1S ž0P@0 0! pǏ劲 㭱P  202 婾2 ST ":(0! b0@PP  p` P PU10S4 10S0!0S)0S%:1#0S10 CR 0 R00282,0 pÏR0S*T2岊2SM20SF 20SBP=0S:20/P0S*20S2#0 CR 0R00`43#AT30S T3 00CS00ä0K3 ,3aQ+p0s 2S#0S 0R 30S 4[Y 40SٽP R H P t\ʽp|(\ 2g|1s|厱x匱励$刱 $,0 S,* -LM$@YAȓ -LM$@Y/ȓ -MLML70H ,0 @0L P$ D4 P@ 70SD4i fEP\  0S\ ;P`  0 S `$ D4HdD SD4L$:cP D4L$X T TXtPH D MP 4  MP 6`P$   MP `\4S P$ pLH`/c:Pc@@cPT/ T-*P0#03U0S& Td `p@p@XD c@@XcPTT*$5TQ 0SD4L$TQT XNX 0[S]ccP@ P0#03U0S  R 0:S@00`@@T :Gc/pCcWP Pp3W U  R0305p1:p :.cPV 0S U U 0S /P@P\30St3 0W@4 10S 1U!  0mWV BNK@D@D0!r1 @4 < 8  dACK`1APA@4 PP4CKSAA4$ 84 1!0?2cS D40d4 ᜯD4d$0RD4 D4HSpD0d$0Sr-d ,0 S,(錑<`L\ZTt `Lx܍0T\w\tȓ`#d@HxQ P-L`7 صyP@w 0pSP' +Q 00 %Q r00000D0S  r\00000D0S PP0pS@00gp000000S00@ p0 00000S70@W0@ 20rP000000S00@r$000000S70@W0@ -LMl @lK0SX  eK0S<  ^K0S$ 60P 0TL\ -LMP0  -x -PL 0 d  -P- L0  r0 -$LYM0@,0 4p@` [K˴ Ǵp4Kl  0h d `A opP4"0L@K4aP /aP $LK 0%aP#LK P0JqL0[S LK 0IPU u  Ȼ #3 p1Q,,d\>pAP#P3T U p10S S_K <P,$20S2 UP`Т. PP0S U$ 20S 0S S_K <PH,<fPb$P`@TV 1 p cH\Q 0pt1 @XH]/KpA PC0S x ^?K PlhNd`A00XHd0LQS P8{ 00S 0 0*U!PP$cP c _?K| ,p0\0 }0 ,0S,%錑`tXjZăȓjtkĈ<k\(< -LM0 0|Sx@ 0 0CS00  ä0~00峅,0 0R00鈑ȓttX --Pp@L0T0`0  / @ptT儅h0 `_P0PST队tDX@@h 0-LPL0 H@ L X0$S0 0 00ttt - 00LS I0tt p-LM`PQ@p0S hDT(0 0 00P@T&0@T0 p队ttt 0-TPL0L@S 0S H0 0cS0hH0tt -LAM M|B>K0C0C0 +, 坲P%L@$ 倸 < 8 4 BK J(5`Jp U0@SꈄDP 0DP 0PS屄up04SXx40S lDlS埄\$ UC <$0SS5V<W:4UV 4V00V00S30S+30S W W0S33 S30S0 CR 0R0 S 0P0<WuD3 00000S "01000C0X2 0BSRdX00W00S u2 00000SX)0U0 U00S@$0 @d2QP4@ 5dX(UW-U848S1  8 V-0K`ZP4 B  PP*10SS5V#4Vڴ10S10S0 CR 0R0 S 0P0,1҃4$RB>K 0C c R+#(G8Q 00 S Y44044 1V 0  <S 0 YR[ 00S <$`0RR0F<,0 S |,#<6 0 錑HXpȓxăG\@t -LMT00 (@(0 Rh嫶tȓ -LMXϟ@`0 _X0K, 0` 4` <` 0,?,,ϟ0$ϟp0 ?ϟ0p0 P` w]PH H0S > 0RS ,0S X,00-S ?, 0RQ? )Rt>0S H0S , m H.0 80 R@0  D0 H0 S L 6P! >0S t>0ShNPm00@0S@<0S<l= p l=p*w|0@0 r< X,X]PS ,00|SO ,P@0S 0 S , <@R<O`= ,/P00,0@T  T, T/0p0W<0S 0 S,PT<0S z0 S 0<0S ,- , ,0S HQ<0S  ; ;R ;P 咵PH0S  0S  P0S  ` T P@@ K4 40S{ pW%,k\P;00 :p) ,00|S õD ,S 0 00S,  D*0SD:: ,H0 00S:,8 F80 :0S000 K\P0S;0 Z0 SJ\P0`0 e`!0: S H)0S00D9 `h9@T 0DSP9 0S |90S000  90:QppiPp,90S000 8 ap@0 S pWPdU\<ȟ80OPD 80S 80S<'T0S4T0S X0S-X0P8#0SH80 CR 0 R00?8!L7XK Lǟ0OT0ST0S X0S7C70S404* X7L7  P`v00W0S $ 70SJ 60S 60SBpƟP=0S:@60/P0S*60S6#0 CR 0R00l6#P60S L6 00CS00ä06 6ۀV  Q P(<5 WW,Xe 0S 0 iIP#PU0pP50S000@0P00 P@0S@0 EIP0S ,p ,`80pS 4p4  080k VP00P0  Vu"X40ST4#0 CR 0R00C4#$4YL3XK 0O30S $30S (30S #T0ST0SX0 SX0Ÿ@04 = P`L0S' ,30S000@G0PB20S0 0 CR 0R000 V v" V 20S00 CR 0R0 S 0`001P@ 4p`\10S400@4P 10S000@0P  P0S xA\P NLN810Sw 00S 00So T0ST0SOX0 SX0J00SB0#0 CR 0R007g5긓؍~t t ,|Tt,tĈ [[\F8H| ȓ؍~@t(0#D00S H0 00CS00ä0 |0 0600S400@4 P  Q iNx0p10S000@ 0P SN, Ha80SX1`1080@㙲<㖲D0SD 4\ RqH0Sn R0S10Sb 8 2R^lp X B00 0,K0 pMK3&W+p"0t, MD0 S2p 2pD OL20S 2 @ B<?R42@P@@80S 00S08040S4[@#0S0S?@< -PLM0D S 01 `0, 1 a 0 S00SS  0S ̟ Pp 00< 0S S. Kd<0S" Xl0SL̟LL0P 0 {4< ,<P?B1cSQ <  ! (M1S< 00aV˟  3 Y; ;?B1cSQ ; ! M1S pka A  ^ HK0S kXʟ 00 x h^ XP<0S::?B1cSQ RKgK Kj/Ki?KmOK @P 0 ]!1 (,10$10 <4< 4"<    0>WP99a?B1cSQ Z  Z@ 'jKiKKgK Kx K|n/Ko?KmOK@弶 PW1S_1S\1SY !1 (,10$10 < ȟ4<K^ 4"<  0jKiKKgK fKeKKcKbK aK$K(_K,^K0]K4K8[K<K@K n/Ko?KmoKHD`dP 1S1S1S  l嬪Q0 81 1A<1 P1Xt\@1HLx1ap1!0 l1 TD|!0  <P@!4<1 K 0CQ< @ <10S@s41( K4 @CK@@!P@00S0  @$R 0(K0 0@0SMBKAA+?P`PT00SY W ,0 SD,L队tX̷pp\' -AMLMX&0 P6P&P L&L6, 0ᢣ<&P 0 S 606+ 6 6PP&6PP%5P%5euPPP{P@ 0S -QPP &QP QPP QPPPl.h5hQP0X0PP%P 0S850U0S 0@T@ :PP@ 0S PP PP PPPD0S.y4P<$000dS| yP UP0#40NBS񟗢갾00000000000ľ040000000000000000 0000000000ؾ04440000P\d00 0  ,3X"00"43K""0-|"BKBL L1 #A42\  -842 2 "2 FPP20*2 1 !P2!00BK8BL L1 @42\  =2  T1 0! ypP11 10 1l10 P@ mP9봖P BNK@D@D+2P1@o @L04S 3P 0  P{0 ,0S,錑\~Hx؍LDlt W| n`L`#wȑē ȓt܍<t tx(P@ȍ@tļ -L5 嗨먒 p-LMCQ0`' 0S @P 00S( HR00@P0000tP0S `@P T00S'R0000( 00`p鼍t -,0ML  0D`Lx p-PLMP@a@A 8C00!S 0 C0!S0 CP0 C 0 p@0S NP 0S0Sx0 C R 0S l`P 4 @0 <0 pȓt`#prLs|T -pP0@P@TL`# Q0S 0T 0S0SXhTD 0S 4(P@`|t 00Yut- 0 @ 0^ 0t( -ML M葟 P, 0@0``pWP1  ` VPE 10S1 0 R rp10000S P 0BKLLS0  0 r1000 0S R00000ӑ00S0V 00S 00S F RQx00 S 0d`iX0 W8,0 S0,錑Ht, -L p0p0S 00CS00  ä0 | ^ 0s0  Ӧ눑ȓ -BMLM|1H H4 C>K0C, <$ D @$ 0CC>K0C<1BKL01L@ @P L 嗦$ R0  00S BKAAqP0 ZB04D R 0 0S0 0CKA|0H WP@LΦ 0, 0R0@<,-錑4ȓD(ut(x 0-L@iPpP0}S d00S\0\BPYP @0R80 0P$0  0lȓt& 0-@@L08PS4 8PO 0  0鼍ht@-p0@S @ T00R00S0S `P0S  0SQ0ѷ  Q00R00SU000S 00r̗ p-LPlM@ `K01 R R; 0S8 0$S \S0S@+0^ 0R 1N 10 1<0K  R 0S`0K  0R@T 0S0 SR 0S0S0K Ac000S 0[S@ $S \S0S0$\( r$300000S 00S 0 S 000S1C0K 1SQ <0K`K ! 1R 00 1R@D0 S,S : ]S8 0\S- $S' rP200000S 00S 0 S 000S1C0K 1S <0K`K ! 1R 00 1R0S 0 0S,S ]S0SU @@T0 0 RK ]R \S0S0 R ]R0S2:0,Sq ]S@n) r000000S 00S 0 S 000S1C0K 1S <0K`K ! 1R 00 1R000S1000S(0(@pp̓vȓ -LMR0`S 22 ^@2 B0S22P0S p2P 0STXP 0S 4P(20S 12 /@@ @1 @1 @1 @1 1P0S1@1P tT0`0HPV | KP@p` KP@ 0T.S@DpP04(!?Tp   4P10S11  V  `0 ? R00 V   c4P0? `鼍ȓăD0<dXp{Ѝtx|Tx< -L`M`"0pVQ@,0 #820S *^K$"_oK,LP@SPA@m20!ZX`A AT&4P@;P@ T  0G?l1C?|PKP`!4PT 300|0[S@T ,yPV` oPWpdP 0W0Z00S XP OXX00Sx00Sl0  0 ,0ST,錑܍! ȓ(ȑp68@LT`h| -AML M@ß@@0 Tp, 8 3 0S 3@ P L@0S 0S 00@T@0SP@ 0SBᇝ00SP/S  0 S R?>HmBnK`F`F+}00S/S/00P+e}YPT100ZQ  44 \0 0 1P0S 81\ x00\ST1T!0?2cS Z8100Q 1PBNK44 @D@D050SZ000+> P 3P@L@200,0 Sh,~h p \x\Qȓzp6 -LM0,u 0-0L0M0@PKS@,  {0 h0S\@0S  009PD  0鐃  -0LMp@00P`P HP $K9$0`P R r`000000S`PT 4@(= 鈃0ȓ -0LTMqԑ`PPPA[ 0r10000S@ Prx1000PU@\ 1P H1HL=000 00200`KdKhK\0KX K T@KlK {, ӛl0X T0 h0\P0 d0v.BL0 `0A BH0 040 D @ p00V00S00PP `0hH =V @@0 = bu鈃8@ȓD -MLMBNK0@D+p$0 O|ᑠ`HP ^KPEjP@Et0 K0/S ᫛@ d1P0S/S$0 S$ 錑, 0-LMH@0Ps0 KGp 0SPP00uwt@ -LMs@0S00sf@؍ -LMH LH"0r,0 `p G7'7荟K 70S x\l'%NK %K H7%>K%NK %NK dP '&K  P2#%>K A@ _P$&NK "PFH0UPdUdPS|NP 760StfP  P@\ @PP@!p0K8&P PYW0pK&0QW60`gVڕ5OK/rbӚ0@Ϛş`şg0%5W%K`p`Pp%5VF%x5UWXK ᪚@ ᧚@5@` \ B0$%@P W 04bQ c<" =9 B =<" $8 82 0LS0PBS*<%K\D8" 0 < (4020bS aD"  BD" @2 =9 =D@2 P@@|/ 贅0 oH"R83/C0ur J@ G@`0#V >@ ;@`#V yx3OK0ua2g 2crB'0@#D#?` 2cc,#y0S0S/ {P ڜL"0S 0PBS* @ @" <2S @ @"`]VNŸ P"P@ 0 30 . 0 1oCP0uv ʙ@ Ǚ@`0!2V ᾙ@ ộ@`!'V1OK0uf2g2crEଙ0@ਙX!?` 2ccL! G V1 P@@PR50S1:PP@ ᘖK 0 @K 鵂π01@o0ef2f2c BD~P {0Ϡ#PE0l 2lADd`0 @T0SP 00S0P V P@K[ #<@,0 Sl,b .A>P?~`#L4}tų(ȓ@ -L M1T0@0LS0  K4p, P0 1[SP00@鈑ȓht@ -0L M@K 0 K  " -T4LK0C(PY>K(0C NK@D@h!h1$Q<D1 05RC P=,10S9 0VA(4` @5R.0@ 0T S00S# T0T0S 0 000Sl0 05R x@t P00Q`?  T2 $0SD$t錑Luduj  (0D -4LM@P  `'P#\4 X4 T4 @4 D4`84 9($pc@40@cTQ,XsP bؓP ģP  ytPl0S00#px Vp3  hC| P`) ᕓ0000<3``C<P0nPPP U2  4..e0"P0UK@0ST0 Uڀl4x l2pdXX \CP`PR 0Kʚp@M ,00,$2" ݺp@Q; D,1P1 0Q4   Ap ʠ40K4  3pt el)pd  `ApX  p@ p,  bp Oס0T0S H0 00E `L<8uK0C0C@^d F l6 zό< NK0 ,6 p@ 00K?0S  066KSK?6 0@00 0A00 0B00C ,0D0000L0P0T0X \9p餯p p-LMP$P(P @`40S8`V@Zph p-LMP0SB `~]$0 @T "@T0P``j]0S@ R@ (0SFph醺  -QLM`PDB0S00ڸ`00@r0S  Q,00L,1  =, 0 4,( R/,$ R*,, R $,`@4 Q 0 8h!0!\,`V@ 0 @ v> 0+  0 v>  0+ 0 v>  0\+P+h\餠  0Dl p- LM0Qq`P$0  $ 0 0 劊$0000 X K@ m$K i$ Rdu(K0 (0 \( X 0mp騯 -Pd 0`&@L6Sp<06S I'0 6h 060S  0P&00D0D  V $,$ h꤯`#b -MLM P, zp < 0BS8@<K⨈<0@pK@0 @G 00T`K0T0 S" DW 1 S@KHK0hPK0h0 S X< ( R h{$ R XvT` Pg D@ QN 40S0@L 18SG(((8)8@4@1 0@冡940!1ZsNK@D0 @D31804 04 1`1Z\H1X!{sNK@D @D8 1 40!0 04 R8@Z ZK'P  0X 7`0V P7 {NK@D @D0h E  T,0 S@,N錑 (<HXhX| -LM( 0R@40 ,0 00  , $P 0 X 4 , K 04 (pK0!=0 ( $0  `40`V0 Z0  P  ,K (, 0K $0 4K 4 `4 84 `V@Z0鰯4 -LM0 @ 0$0 @ tp$`KP 0 0 $0 $4Qi 0( Se (K(鰯 -LMf0p 00@00f$@ p 廷PPC(p  (KP00P@@TP D2(@ $K ԫ$)'[鴯$ -L MLq`0P60S 0 6 P@0610=S 0`61SQ0&P 0AV2pÂP@0嗁0(F0F0F0v0 61 p 0V@ 0@@@ᝀ061S @0@$S `S0Td : @ ݇0@ه0@6@ 0 ?D餯,` p-LMd`0P60S 0@660&010P61S 0 06p餯-00S ^0 0-S_0 000S0 0 p-0LM0 S@PTl`d0P@*pTD 0s 哼吼00p錯xuDu@u -LM⁁@P4 8 0P 4 8`@U6L66L6L6L6L6L6L6L6L6L6x666x6L666666666666L666666666666x6L6L66L6L666L666666L6666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666^@Th090pW 0<. 084p0%00Hu -LMP@T. p, .T`% .V00.R0SV t0000PtX0000P-T_T _TW$pV @ 0-LM@P@ .R r0\00000S0S0 S0 S K PP 0 -PLMp Qi@0T3* Rr000000S 0RQ 0  Bᙅ``P0'S"S $S `S \S`F\000`F0@0T:V00o騠DmdV p-L M`P᧴p P 1-dp( 0@ wtq׫ի PK0  ` 1K[p@@0DST 0 p|t Du p-LMa 1 1<  1  1P1K/ 1@P 1@ 1!1 0 ,00 ` 0 00,000 0< 0 0< @  0 ,00P  0 00,000 ̃0< P@ PK 0s ?L 3D0Pp8u ($ԯ -LMp@g dgP@ K& r 40R ,v3\?x????P@l@@@@@@>(?@@@ @8@>>?@@?T2j0K0C 0C1 BS 1Sq@T0 ,0SP,Q錑`# T(04LP0-H0@0 80840400,0 ȯXԯ\̯į -0L0 S 00CS00Ӥ0'o' ^00# P 0 000x0 00p TPQ< 00C 0000鈑l̯\X p-LM@T1PL1`P p001 0000S#Q"Q0P0`pQ q0 00000S-Q0P0`pQqt0 00000S T0PL0`p408 P,0`(0 00p\XЯp 0-PL0@S| p0 h0R`0 X0 T00040 ,0 T(0 000hЯd`įp -LM℠0SxpxxPx`0 0 Z@^L0 D0 @Y(000hЯ`d̯įp -LM@p P p-LM@`PppX UP\PP "P H0D0@T80T0D@D0   0pt,p -pL`P@xP000PP px0000D0SkX0 L0@T<0T4 @D0  0tlXp -pLPBo@wP -P_P p0 00000S20 pt0 000D\0Q`T0@TH0T@@D0  , 0h tl `p3  -LM$@" 0|P\v --LM| np@0` d:\T }0S @v8 , 0SHP@uPĈp6x --Ll C0T TLD SD080S u$ 㺦 㶦PPĈ@up6 --Ll 0T TLD -D080S u$ 㔦 㐦PPĈ@up6 -L`@P pR %R0mS0L 2p` PD"@`PT@D ń R00Ĉ --LP ` aP0U@@bapP] 0U 0, W0# `"48<#80C00 00p0 PRP aU0@@87pP3 r,0#$(,"(  @㶀0  pTT0PP t`U0@@  pP DD`,`ptx|0 -LMK q   8#"  -LMK q   8#"  -LMK q0[#  -LMK |q0[# @ -<4(<L"4!<M K 0!hq -<4(<L"4!<M K 0!Yq -!L!44M K 0aKq -!L!44M K 0a=q p-LMP@`Ka0}ST *@T p{S@ ;ST Sppp -LM@K 0;S  0-LM@K0 R 0QrjPPP Hr R@Tk00 - LM  .0` p-L MP`K@CP ʤ0P 0P 0000 0000`ufp :03P ;P bSp% 0-LM@PK\\ 0 DI:0F0,$,!$#, T08 -LMRQP@` pW$,KW 0 SL ,KI`\ 0P YB\p, WWXx -LM`-Q@TpP00S xR@ Rr100000S@0\ @ `RW B @R7 B/R0 BhMR0&&SX0 E0220CVT T !X  X X 'X U U U 0f0fipfiOi U U U `!iJi($t`#<h -L0MPTpKĂ@PcT080 }P@WT2< Pv>@ 0C<0 m/P@\HfP@`@@T0@@0 Z/P@5S P@.T0D0 HP@#T0H0 =:P@6P@T0L0 +:P@p$P@ T;TT`0P0 0` 4` ;P@ <@E0L!!!?!C!c,B^ B^DHL@PP 010000012c12c1 C @00012c12c1 C @l<T0v 0-LP kP@4 h0S0i P0L p-RLMP@` 0S(0 n000p\ p-LM`@ 0 cṠPPh u 0 0bU *H0#S 0S u PiphMih -Lp`P P@H tT;t 0S 0#S hw -MLM$0KA ,0 `hQR Q Q d8 SYKAA ld8 S:qXJlPP `jPP0? l(KA Al K+B 0d(0Rp8:s(pP@ >jP@ p(hh>K0C0C`#8 od8! SD5;<#jKA Adt(d8!M@S:rtP jP t( KKA Fxd(0@R:q|xP iPT x( -KA A'|(d8@S:r|Pp iPp |(PゎKd8H@ HS( ;KA A01(81(Rd8@ST:ri0P1(} (PUڈ< 8  #h !hhP(1S>K0ChPU!d8PSZ 0 ( hX d8 \P@tN KA lKA A f|4=0 ,0S ,~錑4L 1 P-L` 1 㤁 0 @R 0R 0x1 00P@P`DP Q/0a0q0 Q@L00hP(H00CS0@00 0@0CS0@00t``00 <PP L 0O00ܯ0vwv wH -LPfP@0p S 0 S`ev ࠟ0S Ԁ zP:g00000 C)PP `0 L@P0` 0O`0p 0-DP@L,0000@@0 0 0 0̲Dd R-0L R R RP 0R }ܯ p-hLdaM00P0@P <1 0P Q6$0 0 S 0,10R0 %0 0 BR0 P Qڬ0 0C S 0 0R0 0 0 R0 00CS0<@000pvwDvܯ w |00-PPp0pL PdsM\H)p@P H0 R0e $00<v -LMd@0S 0SLD0,0`( 00 v -(0LM@P  Fv -LM@@ P@$0000@@Tȑ@ܯHp@-D`@PQ 0PE0U0PE0pv -LMQ0@ T TzPp Ȁ0S0@0@0PT!P@` 0 xQ 0 ޹0S00 SP0PT4P(< -PLM@`2SPb ,KP`!xh2PZt qP<20S0`00{P , 2Ÿ0 00S SR R1Pf ,0S 1PV1`C,KrP` ,0 Q/pQdq0 Q@L00OfP<00CS0$A0E0 0@0CS0@030n@,  j`d@`0S 8P~ PH0P00SP@h4p63̲$ȑ(vww w -`00SL-Pp0L00eP;[00CS0@000@0CS0P@00$ 0 00 w wPp@-`# P0Q|0|@ 1S 010 0 BS000 0C^00Q0Pp-pp R `01S00 S01S $0P 0 0 -P@0|`00t0L@l0@d0dp@`0@*d0@0CS0 0K0 hw w  -0L!SPp\P@}'P` 0!SXPjD80840P (z $00g,Dw`#x̲ -L M, @2"0 T0 2"P@!1`pPP3A1  JP `W`! Pp00CS0xA00 00CS08A00 P,HPU00S 00ZS  0S X 0 0 0S l 0( R00SPUH0  ` 04 X 00R000cPD̲<w wx\p w -LMP*2Xb䒟0 X@L00FdPV 00CS@0B0<0wp20  pd2 \B0S 00CS00pӤ0pw0S0 ᳐P 0S0@JP W R/ڈa刁0 R@L00cPEde00CS00 2PrP10Sl@T10S`aX TW 0nSP lS0 pSP0 P0\ 0 R0 500S HPn0sP.4yywhx6x<,x w4x w@xDxHx(8@\x\,w wp̲(8xPD,4 0nSP lS0 pSP0 P0\ 0 R0 0 0, P0P 0nSP lS0 pSP0 P0\ 0 R0 h1 |1PO10Sڠ 0nSP lS0 pSP0 P0\ 0 R0 8l"0S20S20`20SpY 0nS lSpS00\ 0 R0 @30S 30SqXu Pv0 rd300000S&P30S`3 l3 P@ 0nSP lS0 pSP0 P0\ 0 R0 T40S Pd0S0!S Q> R0St4R#P 40P4   0gS  S "00C SpS rS0p p0p0p0$ ]pPE %p000W |W |500 S50S6   0 S 0 ST|`fW000h6@  P@00CS0F00' 6T P v6V6 @7 00CS0 G00 WDDR PPGd'0S0000Y0'00#0'00# 00 0\nS000 lS   pS0 0 0 00Z 7KP 0nSP lS0 pSP0 P0\ 0 R0 0S 888 P8PH\P90S` pW090S  T 0nSP lS0 pSP0 P0\ 0 R0 $:0SE #P:0S p $ 0nSP lS0 pSP0 P0\ 0 R0 ON P qZ QZ: P0 r8;00000ST 1P@<;0SP; Rt; h;  p;gP 0nSP lS0 pSP0 P0\ 0 R0  Hl0S0!S S<Q0S <Q |< WX0 P<,0P00 0S <0SqZP<0S  0nS lSpS00\ 0 R0 t  = = P010CS  6MpP|00 0nSP lS0 pSP0 P0\ 0 R0 X>.00Q0 PP 0nSP lS0 pSP0 P0\ 0 R0 X$X?h0Sp?p?͸\|?0SڈXPp 0nSP lS0 pSP0 P0\ 0 R0 W00i00Sޮ0 |0 Pd0 *P D8000wd̲(PHG -d0 0LST0T P0@0 @0RR,0 0Qڗ ,(PD -LMԠPp@X 0 S@@T0EE@T `PP \00S  0  0P 0TV̲D< -,2LM00 S5 0 r2000Q 0  R1A00 S KPe 0!S 00jP |1l1 0SXLqQ-@Q@a0L00TP00CS0A00 0@0CS0@0m0p 0 0 S 0l  0 0  0 S<@ 0  P40PxwLx w -5LM0pS,p ,K=ĥP u,0 QڤUe0 Q@L00TP! 0@0CS0\E00K45p !0000 S  0!S7 %S 줟 RTd0 R@L00SP 0@0CS0D00`h0 0 D$0p\S 0$0pX+ `VS0 V@L00SP 0@0CS0C00#0 l0pl0S 0STH,0 QSc0 Q@L00vSP~ 0@0CS0B0m00 0X *2 0 0 p0X:T000?\0Se X$ , QRb0 Q@L004SP< 0@0CS0A0+0f,00Cs,0 1 0 ,0p0Cs,0 X!T0 003rX ڄc儓0 X@L00KP 0H0CS@08C0030S 0`2  vO "0K P32rXڔb唒0 X@L00cKPJ 0XŸ0CS@0HB0Y020S 0$2  :O"0S Q 2 1    ?K6Po 們 pe0 Q/hah0 Q@L00KPn<00CS0&A00 H0@0CS0@007W K 0S" bh00S 0T@ NH  N2S 0<wز wXp6 -L M0 \, 40 0&S30 p@0 dQ|c|0 QP\00JP@ 0@0CSP00S00Tz,0 2@0T0o\SF00SC9SA400CS=02 p@ 0dQ%xbx0 QP\00[JPL00CS0e00CSP0 R0I0T1,0 1@0T0&ꨑ`VژQq0 V@L00#JP. 0@0CS0PA00U(!0 00 0cSPp R/P`0 R@L00IPJj00CS0@00%0@0CS0H@00 0 00ܲwز w -LMؠpdP`01 ^, @PIP@ 0@00@0 A0@0,A0 00(dH@@yyy -LM"0 s8 <  0sB堢0S2  d`0V00`FNچ0dŸ00S=((00 0 0 00  0+00 0 00 0!0`F0 0000 000 000 0000 0 00 @ T1V `F00#0 @` 0?V`Fچ0q Q04@K f 1 0C 0 f 1 0C0`F0?\ pGʜ00S~h0 `0C 8L H <S0L@00 y̲Dytyw y8 w p- LM00Cs0 0` 0 1Q 0@PT 0@wGT0< 0Cs000 (00 00pyy̲Dyy -LM@`A렃0#Pp 1 0#spN H0@*SF 0@T`p  0 1 x"Pt2pP"\"pP2QD2@2 @bTaz$"0S "0Sn ! 0 g!0S ZY v1 `~1@D\~Qq+- PP*CM0S0E= 0 0!K)pp-40S?T%w  q  0S 0S  BK 1: S 0S 0S BKv0: S.  0 0 \$o Do 8s`# y Ĉ -LM/@ᷭP 0SP :0/S P:0/S @P:0/S@P:0/S  -0L|M$ ᐆP  00 {PP  30CS\t8tt8tt800   0S9 3SP$    ` P0$00  $ t0 p`/S @ 0T/S/0000a`0 S,$孄0 u`K4p 3S @0 Sq 0: S 0: Sd 0: S; * S  S QP00wd2 R Q=Pm QPe 2 R Q S  S S-gQ1 R1 R 0S 0: S; 00hX!rL{eP.@/  LJD $ &? 0S @ 00 0: S  㮇 0: S0 R0S @0z@P3S0@0eꔟ0S 1</r!j[@dy yĈDd \0# R00R\R0  QQQRQ -LM,0  SP $@TC$P ( K 1 rpp 1U@C0S3 R( Cc#G0SPD00CS00Ӥ0 Pp@ 0TS0 0CS00Ӥ0 PpyTYT  lrpP BKprP `1: S``( P@V 2|2<\/0a  { r00T0S H8eT00SFT>Y6 2 R,0  "0S FqDqP DKrP  0R1 !P dT, Pqq  !80Wq@Xp qpp\ZFPDBp 0S'  Xp,R !PBP<p xyȑĈ\F -LMMpA^K PE0PE` @ 0 (Vp 0T0 ˩PxphgP\0P 0 S @  @(ᘨꌑy -QLM@l 0S\TH}0S@4 40 0Rh.m0y -QLM@p v0S`X Hi0S@4 40 0RhE0y p-LM0AP: #:0$ h?`L3c0(  ,0D?B3c 0VP@BV;  cP 0S @0<0V$ P @p0V0 LP f0-S |l@pL0S LDW4x an$٧@Mby(4@ -L 8cP40 R  yL 0-,@,PL $9 5`LxX -ML,M::K@(L:L , @0gS*K:KpKHLP0 `KDZDH00800($-P 00*K00L0 0uS 0nS0 0 000JK(@D@D P P>K@@ A)\9hYY(K00T :GJK(@D@DP jK0(`F(K`F$ 0SP@ ?hZKK0T(PE(LPEL #% *01RP@0C0*K( B BS1p@ 10DES񟗽.........00000000000000000000/000000000000000000..4/D/0L/T/0000/0//0/00X00x0<K@@ (0D$8兀mJK,W(@D@D *KH00S_ @j:KLW&M&KꤖK@@ (KHHh0 0 00  <6h6BK@@+t( P#T%g*0*KP0,@6 (VKJKL(@DL@D0.S 0.  0 l bU(00  5 %%000$Lş%5!a{p@.l50Xq5(K0SzK(pGD5pGKPQ 50XS5 0X0Q000*KP 0Sid$0sX40S000 SPn pꀄ00:KL0d$0P0-S 0SKPDT0\00a30C SIl2l3l3H3l35H3l3l3230S  50S'.:K(0C0CP KAAmP NK@DK@DLLh#0 P *@P@00: SP WpW e@00: S S0S2"2P  4B0S 0SP BjKP^+H20S BK@\+@\' 0BK@S@ +P10SOGNK@D!@D0@' P! !%*xA0S ڐ10SP10S  0@BK1PAK| AH0 P P 10S0S00S(P 0SWpp IP``00S K댑`LPTD##H%####<$L84$<\H}tL$@$X$prj$`#"#k,#H#x\#<76d# - L~$ -LMK P @0S  [0R 0[S 0S -MLM% R pK9K, $ Q \mP@850S"(} ş0S P 40SK KP 40S.~Vl[K`+K0(PE,`BPE0`K 0|  PD40S8A8lW80S  K,0PS /ユP `++&3 30S`G30S Q K(AAtP3p(K0 : SKR SAPk< lP`20SK  0v vP 20S٣IK(@D@D9K) 4P Uʥ?Y00S 020S -0S@ (s (}!0SKK(@D @DK 0P Y10Sg}0S 1Q 1(K R9K4d1( , $ Y9K$Y v rkP Y00SoY$10S (K0SK(K(00)K -00S +K( B0 0C00(K B0  K4Y00SW ,0 SP,X<ĈL$%P@\x8%j8D% p-PLM`P@O <10SK010SG$10S u0@up00 0E~P h0S0;0۱PLQ jP|$, l0Ϡ/ (@@#bCl(K( $ @  OP(ʢp@\X T%`%l%Mb|% p-LM`0PSP/ @ 50DS 00CS00Ӥ0 Pp@ 0\S 00CS00Ӥ0l PpyTp鈑xȑ -pLQ  P@ XP0@S P`PD1SQ%} -Lp@`PU 0 >$0f0@L0Sr00a000 Pr0000D0%% -L$MB0, S`20S||Ŭx媗0, P P2c 0S ̾0 S0 00000 A0<0 <0  P0K aAm/ -0 KAPRA @0 ?@GA0 X-0 .,P@0K040 p0 0@<0@ 0@0S(R&SŤ6ˬ0000P AT B-P@A0 P.0P@ @0p Y@4<% %%&$,$&D& M-LM01, 0p`S  o00S P@ -P@ @0 .,0 txp `0pS  0S P@P@0 ,0oY@\l&xXp&T& 0-0LM0PS :S X@BP0 HH ,08 ,0 SD`L`#&x'H' -`QLMY0rSwS ?RPPU XK00G *=P@@ 1,PP10PP4PPPPPPDP 0p000wS  @0P` ;H0090`0wS  0  P  0 @X@H@L@P@T@h' -PLM@Pp`(0S 00wS` rS"`U |0 0 0l000d0000  2VKh`Hh:;T@H@P@L@ -LM 0K# xrP p-LMD0@S PH`U P)僲P0 D0` 0C00  p 0-LP@@0D0HL0 -RLMP` @10@P]T@TSQT1Tq 00 @0D00@Dt p000 V@O@0P00 V4|p V00 0P00 lpX  ec8 000DP  O0 0H@L@ -L Mp@  T,KPt $+K*K < ^' K)K&K%0K(K  ^  $ K` 0# KT, K< 080  4@ @0000 T  <KK 0 pS ˲錑L@p' -LMD0PSp RRP @T @H@)㋱P0D0@ p` p P.  gsp0P  00P w 00$ 000 P@D`  L`VD0S0S$@  g<0 cP@L@ȠR0@-,ȠP @ 0"\LL ^NNQ0RPBu 0PEu |2\x2LL7&c2c0T2RCV]EH0PE0 0  0  0  0   0   0   0  P @l1'7c2Tb"U cbUI U30 0  0  0  0   0   0  0  PE U @PEu 0PEu 00'7cb2" cb0q[ -`PL p@?.0(Ã$H7c"( 2'H@`c\@^B^BN00QA>AAQAAq 0S 000  b0 QŒ00 , P080!Q,000S}8} -0L0S}8 p-QLMP@`p00SV@+00$0!0$D"0$0!0$D"0$0!0$D"0$0!0$D"0$0!0$D"0$0!0$D"0$0!0$D"0$01`FV$D#V 0 0$01`V$D#p}8Q  0 " p-LM`P@@Tp -`PLCM p4 7 0 (1 0JK1 R0ڨKKK 0SK p ?@`PK  R p ?@`P4!' P@-P $ RS΂@ 0p`809 PL0  (,08<lPP- $P Q <01 Q0C 80<<ࠓ80 p-RLM@` @0S01RPPU pPp(0 PS00P(0,0S00,0| (PpVF20`f$00FPS0,0$0p040$`phss0%0 0X00L0 0T00P0  ! -$@L40pS` $P0 (P4(Q$ 02(0,00( `cV:4bO<(0,0000004PcUP!f @<`V 4f 9<(00` 00( 0S00,00`S*0,0 -PL,M4 8 ] $`VZ 0SW 0S0SQ0 S 00440@  < 8 0JpWh: 0 Q7h威pG:hQ D*00 0Rh S.0L T0l pl0T/ PP0L 0Lh 94 094 000`0  h0S*T0 #L B ,K :+[0SZ0Jp[PW*Z 0JpW:+0[h pc8 VP0W*Z  0JpW:h +0[Rpc8 00P(pG*P0W*Z  0JpW:+0[8pc0P⨁pG0W*Z  0JpW:+0[8pc0 P⨃pGh` 0S|PEu PE0u h ` h0Sw:0S+ S 0l@LT0l` T/^p0PPL Gl0`P00X0d 0XpPP0L 0 64  03T 02L0C0,@K 9+0[SZ0Jp/,0[S ,000 /[0 [0 20C"[0L3  9/ [+0[0SZ0Jppb82[+ [@0,0[pbS80  0@54 00H000HQ W*Z 0JpW:01@ 0C0 @ pa800X 02P0C0,@K 9+0[SZ0Jp,0[,000 /[0 [0 20C"[0P3  x9/ [+0[0SZ0Jppb8,0[+ [@pb8&2[ D0,0[ 0H0HQ W*Z 0JpW:01D 0C0 D pa8H,0@D 00lR0034 0f@Qt H D0PaS<@P c 0 PeU(0@Pb40e0eU P@@0UP!0ee@0@ 0<PU0< @0S @ RK @0< B0< @ 030S4 WZ< 0JpW4H@ l0@H 0Q00 < H0c 48(4<,(<4 <@SH  14 000p00 L 0L0 <4@(08SR :%<,0RP0 e0e 0L P0l0W0e0l0 $0 4#74p$`0% -L|Mp t x0 p0pLK W R *t0  0 Z00: LK00SP Y!Q | x ,@K0P00@0,0K0 2K+PK6x0 006P|00SP| |pY100pcQWWQڀ p0R0P0SKKplK 0p Wj0K Z*t 00S 0 000峠 Z:p\ \   T#T3̠ 0 @@  9x0 p [S\!`0|p  0 0 l0 Q0+K,0KK `0,0KպKځ 0,0K0 "K0 | BPPd06 ,K ,6U G0B @T0DLK `0`0C`0 W< 00t 0p W0^ \ l0 R|00  *00cQ0 R:p [QR! C x0  00 0bC10@0 V,0K+K"K# \ 0S x  p +K06  ,K 5 G0B @T0D```Vx010  B""h' 0`"/ -Lh0 -L4M@P*&v0oS000 gR   0尖mS000 0fR   `X0 T0 P H p&djpH0@ 0S񟗇tuzzzuzzzuzuzzzzzuzzzzzzzzzzzzzuuuzzzzzzuzzuuuuzuu```H  P 0SB 8 1 -R1 0@cTQ6H0SL P R/V``X00L` L0 @T 0 000CSI00,K 0so@A0S0 t,0 R0 X@ 4@ PL pPP `pP@ 30C SDw\w\wx\wxx\w\wx\wxxH RI 0S 0S @ R4 @4 L00L0@8 L00L0@ LDP D~`0S @0SD %eP Z 0S0SPQ TX |PP ZTX Z@0<U q l`n0S <` n0SP 0!R0Ꟊ0Ss >\4K8 K0KqOP0 #80@ 080 Y`V+ `000CS,K@ NP@y0S ,0 R D@ @ = P W@  \f"00kUP< @@ +0S :@P` _X 2T .P@ 'pT IX 0S0S0L04]@UW `#`Ldhl`' (Ĉj \ (4( -LM0@Sp 'dP`^0   K  R W0Wl( -L M0@S l%^ 0 K R 0V|( 0-0LP0 R PP|0 0ttp@0S㘦 LTD@H(PP<0 00h``Lx(d((C)7 -Lp x@0 `P 0000\  00S 0S 0S  -LM"40Qp,0 w0Ps_`0@0 P`O 4d[$K4(@0 4 PN,\P4 T勏K` 20S 0 0P  0S0Q00,0@ f2 0 0 0'P 0S d0 ,0S \, 0S 0QO!t,+" -l2LM (40p  f,;;S0SQR0SJ, R, 0,0 ,0++PR- 0\ )0S(dP!,?;?00c$lcQ/\,0 8~/ ,0 X0000 000S0S0.P@$0S0 U/ ,0 X@0@@@ 080,  0,0S}zt"0@-@,0!?;?0c\<`?* Q< R:8\0P0S000 0SP P Q! 0/S0S*U 00SS 0 S /S R0S00p  -MLMp0P@AnK 0 `F  `F c 0.U|0 U l 0S X Ӥ@Z)P 0 : S$$$ ꌑ{p"""m" -LPH$HH0D(Sq`: !0Q1 0: S E 0DaP8C QQ0 R TQ 0S 0D8C0h |))P l分 Lc\a P 8h t}"m"4" ###,# -LCM0`$0 @<2A/ K0 0R00P00 P0eS&0eJ/K0P 0 0p 0S  0 K#20A?    0U 0SD0 R0 0  $0 S $ 錑,4# 0-P L@ =P  (0 0 S0 0#200 -LMM$E~KpG pG 0,            d$ `$ h `08: S(4X@i 0S4 R 0#\Q  0@0Sl #0S 嵅븓0S3 3(K 3PT4 L HT @D40 @Td 0@: S: Do@+(P2 ,0S ,t3 @PP 2 POR 2"(KT$ HD @A 00P2Vt2 8R00S X,BNK@D@D P@9 r X00C0 h~ !$0@007 00  h$r th4 0000S a<8q, 0S'PV 0 PN 0 TP@ d0SB ߄?< @0S7 a4m'PA ꌑm"<#4tT$}T####}#̿#@d$$0$p6X$p$x$H# -X0L8M40 0,  ( $ 0KD @ < 8 0    DK騇 -MLMԡ0Pp,0 @ 1Q  0P1#\Q:,0 S x,aFKI001( K$!PD X$ H D h d L S!0\Q00`0@0 0 \Q0@;D$kT`I BNK@D@D` 09+!P  p$`tT -LMhh0,0 \%X6R00PP -p`WpW,0 S ,ڡ V0%\Q11( p R 0%\Q 0  0S 08+*0O#K X5 T5\Q!(0,0 1p x00 %\Q41( #K1p04\%0R/4\%R$ 0 $0O@00@T000p$\Q1,  1x0 8 0SMOK,-0#K0 8 0S?,- 800L0T:  8B0R 0i000#\Q1,  1x0 8 0S T-H#D3 R 8682@ @H=%P0"\Q!,0(0 1x 0p000"\Q!0,0 1x02\%0RS/\2\%R 0 $0PO0#^K8 )00h4/@Q_h@ Q@P ,\%1R 0S:0S* 1\SL-P%K&.K `"0%K0h 0S:0 `( --80 0L T:J S@P M,\%0R 0S: 0S* 0\SL-P K%.K P"0 K0 0S:0 00hĠ/ 0h0ꌑtT+}$4$$ 0)-Lp}H2H"D2Q@@ pP(("0`\Q(0p004 0PS ,1 L40 T^:0 000EXM A 000CSglpp 0 0  00S$  0!000`\0Q\ p@@QtPP0 \`Qp@@0 \QtPP00 000h 00$@ J,0 4L T:~~tT̿} -@LMT 00C0h@-p0\ ` L00n^@` 4KR>K0C0C @@_`0 /K~KpGdPpGPU0\%S>R0(5 5^ p$=L0OT *(@$0\%R !040US  Z#08 3( #00\0P1Q>KR>K0C0CE.KpW B04% 0 45Po0C45 t0\%l3Rg 4!0- @#0\%83RM>K0C !? 41 @ 0 0t/1E $pWZ`P2 ,0S ,垞40 S00X' @BNK @D@D0L'Du@1#P"0\% 2R   0S@脀1 WM>K0C !RBNK @D@D0'H#PXb`1 \5S0000 /LWH1 iD0\%R0SR!P0uxttT & -LM@P00"x -LM 1\0P00 L` @_0 x* P``V1$,!P@] 1!%t1 X00@00 000\% 1R   V01 0#^ `*p쀟P$p \5S(0 ? ^ : VP` \5SX0 ? ^ ZlPlp0Q`` 0 A00@`d"P tT`,ȽԽ, -P0LM@$<0 P 0S PȽ& p-LM``0S TPT 01@CT*S!Q!000pK!0T*ȽԽ 0  Ἷ -LMp@PT, @0SmP 0S { @0`P``<0 0\Q| x,,&h 0000i0: S88 8 94&&`tTH t"m -L 0 R0   %0 0-@P0LS PP0 P 0p 0-LM@ T1 T0SP@0 \Qp)P# 0 R0 \Q000p \KQ0(00 Z \ׄL҄0$ \8Qp'pt'T{'4('4'@' -LM@ 0@ Wt 000CS<Tlhh 0000 0000,X' -X$L MP0  0 @ \>  p-L@M P`K\0S 0S  Kp' -LMh@PX P DP80SPxvqn(k -'LMG QS, @ǟ0S 0S)p P0SGp J00lGp J00@,0 S <,40  $'0@'S00 G0S V0S6 R 'xƟ0 @S D0S z 0S| 0Su K/0800 O^"b"`&& MK DƟ<P`0`| K !10.O@!#o%QP` %"| K2]B@TP  ]K$a0`ࡏpOP"0 $ P@ K20BT@_0S ğ%0;`A0u@pW0S $40,POs/o1xğE p$dD0@_040@4 4p80O ğ "` K"0@PU` Q 0Sc0S3PP3崓PPF0S|3 R% d 0S  p,0UP`  O0d  ʠ0 p ,0Wr0RS"002@}qb@m@Ri0@Lec2`P Ÿ0S) 0S2 RXvP HK6JP " 0S v v(?Kp x t |GP v@典pCN0 0ws@T m@T S^xe!@T `^@T qSKDVD`J ,O$vvvx vq0=1PvOvjP( 4н0''@̽ )<(t<- ``-pDܿԿ̿(t |(q(( ))---l))))$*(*<*> -80LM, ,0  @Pt- -LQZ 0SC0S? Y1 ɟ0S Y  90\ @Q@PK0OPo000 @PK0"Qp@T Y Y@ Y& TPȟ \5 S(0p 0S P U @DTP 0t`lP@PUp8\%RX0  0SPUP ` 0@H(000S Y| G 000000)40 7\ETM 7'P@000P0 0404d70 @_\P/ 0 S' 00'\0Qh  00X:<0S DMtI0&\pQ0 00h0 0@ 00ORP 0Sh0 ?R6 R 0s !0p\%R00p000&\Q00t00$0%\Q@0P(0SEE  0000000AnqP 5 \ PVLLU 0H    sPh 00000$\Q ,>45 R 0$\Q11Xe}4 R 0\% R1p(0\$\QE  H4\(Q8 0S:0S : (5S4\%Rh0  0S0#\Q  0@> S@ PCU@0t0PEU @ 0@#? 0S:0 3 R @  R0SR0;S0"\Qh0 0S 4c0\"0Q0# cP 4 d (p00 4kP2 R 0<"\Q004P4  00 2\Q 0`0l4 `|0!\pQ  4(u0!\Q0h0 0 J@`1 R 0X!\Q000|@uP 1\%pR4040 O l100 \Q 0S0s 1 R 0 \Q00\| 0S0 0S0 0S0 {= 9 댑tTT-|+&H ܾpؿ4`̿|-*},D*+* .8.нP.D+\+*x.Ĉ`# -L M`( p0P0 ,0 |(X00Sk8"> R,A2   00 PH0 `X00,0  ! 0 @Q6 P3 P' `| R0pl0  0R 0S R0R0S 10S0S P+  0 R q P0,0 0  0@YTn Xl)<<i Կ / +++4+@0|+Ĉ`# -80LM, ,0  @Pt. -1L8M1q 1 !00( L (0K\ X T P H D @ < 8 4 0 , ,0@Q 0PU `TP@  @0U ,0X00]P D0@@ \K00S  t<D -LM, (pW`!ؠ؀ u@PT 0S 0T @T R 0S @0PpG`W DP0 ,0 `0 ꐷ/ -LM$$ @0 @GP阷. -LM88 00 @40Sh阷. -MLMF0,0    BRm$D @]P] 0&TP 0000 &6 0\FKL0%ş `% `@5( Kş%5 VX$ 0h d *0P000Ss` V:$5D%`0ş0 V0 *(E0P00\'` V:ğ0 ` S00*PP  V:t4 ,0S ,:0S 0 P00S 0 S s S H$$8P0$   00C0 #P  000 00C0  [S;;SRVKH,p3ɠ \5`S00U.K @@ B @ R01 0#T*sp$#0\%R$0(0   @ R01 0#T: Rr@"0\%R0X0  @TZ0FKL4  AH$ .2BNK @D@D0,(2 R) 0̠ { B0S0?0?00 R*P0\%R00  @y{o0̠ |hZ h^<(0Pee0\%1R(( 0 4 PP& PP <0:0090M|댑p,,Խ<@̿,,,@d,tT.#4 ## /,Ĉ`#, ,#+8,T, -MLd8M \8Rp, `  Q 48 Q*(ȟ 0#200\C0S  P W0 41 R77 (K(K  (K0AO0KK,40S7(K (K ( K(K0 00RP^^>KMK )$JP0 0\0S$  R0.S 00&000\ &# 000CS񟗕d00SX @,0 S P,e00 0& _(6 R 0 "Q %M% 0#20P%00C0 0S$ 0\NK @D@D0\IS^K PE0@B08%405 R $#nP 0\0000Sڤ 00S$ 4 R4 R$ |P{ <$@0: S00084 0 0T0\FR( 0.S?00rPSS0 41 R33 (K(K  (K0AO0KK,"0SD3(K (K ( K(K0000\P000 Q0hNK0ᴀ000002  0`0C0 -@@\+0SP 00000P p"00C0|"d>KMK P<"T8>00@{P \ sP !=&0t!00S 0S *0L0P>KMK Pe00000$1  0`0C0 崀k(m@6PV c0S 00Pd0 RS 0SP D00D 0 ,p, -,-0-<-(-H-̿X--44/----@d,-.<.T.....@- 0$ $00S@T T S -LM$$ @0 @P@/ -|!LMt0l!1pCd1W0:X000@`V Q0 ( 00S 0pGW* 00 00S PQ 00S 0 UP>`@`P|000p0  00C0%0 @0 0 0  Խ<<̿ -LM$$ @0 @xPؿ\/ -!L8M䁟䡟0L  (0 ( K\0 X0 T0 P0 H0 D0 @0 <0 80 40 00 ,0 , `Sq 0!PUT 0P!@U `,0V00(@@ 000CS7$X 0QP 0S P0  00\K \K0p \Q  0  0S\KH D0 4Lt<4ؽ̿D,#T//. -LM(p, W`1 P , "冞0奡 0P @T 0S @T 0 (  0@@0PpG`W,0S0@00TԿ   -LM$$ @0 @P鬷t/ -MLIM0 K0!,0 K $ ϟK0(IKI41 t?h_ R?K0X^K0$ET@oT2T0,oV- (K0!K000P%P 0/>/1(K^00!1\$ł0W`0U30/>1 10S8K01$E(K0!Lq Qa<P.0\Q0 T (K0!K010X00P%0\0(K0!\0K0/>( `000/> (K,dK0$5S A h $5! l `0S10>!d d0 `8K=K !0K(A0A(K@1 K =(@0@L S X8 ZK(AD0A(KD1@ K0848 00C bPX 0 2X0\,8K01,H0-BKK4H(KL!00(K!K 0,00CR8K01;1 K<K f0$5S8p000$08K41K( 0,R0 Q 0( Q,0,00K0 :\%R KK04 x00Rx x0(K0!Q0t0Q0 ɟ0 RP04080<0@0D0H0L0\08K !0K0tL5(Ks K00! ! PX*4 000CSpXLLLX000  0(0CQ 0\0 0 020K 1PX(K!R 0R\0 0020 X B K8\*K08PUԧ0O!> 00R# PU^ ^ $0'0Q$0.`0!008K01K8 > b0Q0cP4 00GK088K`81SK<\K0$5S,l p@h0PX`P  ^ 8K01$%^ࠡ101p@0SX^ K0$%^ࠡ101K(@,@$K0O(LPK$KT1 (KK,1̠A/08K(K0 !P5LDA0S`j P 0S |K0KP%0 00@K/0>$1/01^ K0`0T30/>11K0=8K01L 0@KPo002D P Q$5SlB0S xk0S PK0X K$10 $52 X^[0  0 4~<~04~08~ --L .x p-PLM@P`l0l R T D0 Rp80o B 0  o<~@4~`L0 --L  --L  -LM@e2 h  --L 㺃 p-LtM/Pr@TK P0: S p0`rS   0-/L@rPU+D0 00-/00(++00鰷0 -LUMpPKP|P@lK8u0S(0: S  SU P U@P P@0 R000K@QP h1: SD (oc$^le8~t 000 P-L P 70 -QLM@ P T 7 1 -LP 71 -_MLMx/t?@, @h? d__K AX? A`PP5: S ,$PQ V8P0S > R 0 S> n0S} .@㸞>@ .@> @ @ @@h 0 0d 0dS PP.P(04.4<00uP]n0S@T = ,0S ,嫂=-K B BP LP]10MP \54 S Xd5PUt%x $O2,% 8@00.Pd5PU̟̟,< %nd5U `U< R0  V0S  C>000, 0x,0 t010C@_aK0Po0E" $`PaNK  0X Z0S0<cQ0K QQ  000S #d0Sr\ Pn  00H0cQ  000cH00S \ d0STP PP  40L0cQ ,  400cL00S c0S6 P2 0P0 PR @07n@P0S c0S qP 0P4 TR p @4n@T0S 4 c0S( XP Y,5S05 FS.S  0a.KS>0S c0S :P 0)\(5Qx@<@S  w0(E0S T c0SH P  hH080@_Q 0 ^ H0S.0O 0S kc0S{Pw  \hL0@0@_Qj @ L0-0O0S hNc0SU\PQ 8 dX0S0,%R0S0L%rx P%0 0p/>1/$E0ࠀ1TPo`0W30/>11=L 00@UOM GP%0 0P/>1/$E01T`0U30/>11=`L 00S b0SyP 6\%R0000#DC0xQ 0x@0S Hb0S<]P T6\%R0000A#A0tQ 00t@0S b0SAP dE 0S d5 R @ & Y L L3S 0X%48 p= 0000`d 0hLCV`# @0 `P FT 00 X@0`P`/>0@@!~ pāO_P``5!?VAQ!o |4PpP DPP4DC P(47 0,4P0,, 4#0#?>T(0 3S  3PC 3P ( 5 t3  *dkN"S@0@<F yPq}Rh N 52 2 '1 Q0 0 0V0S8 "0p00Lu 0P5?T5 V>X5P%0 0P/>1/$E01T`0U30/>11=`L 00 p0 pJP 0S} ]0 00,%0aKS><0(5 H0S.0O P L00O ꌑܽ0нȿ(1+4lH1tܿT1п(|11D)1102(2D2l22p011,81\111T11 2D2T\2t222Կ22̿2ؽ 3Խ43ȽX3|3h33,3t 404333$4X4840H4P4d4Ĉ`#TP1 ~\0 0 0D5S0 0 0<5Sj~0P Z@0 0 0;45S#6H0S0O L0-0O 1~(1 P,1 P<1\,rd0OSh" #& ? 2Ÿ`V<, 0 B0_@|r h0/~0S ("P! <2 R,,(_1P@h00`T*0 QP@T:aA;i!1\%R  1  0COL1H $0C.O (0O 0-O 0?O 0/O0O 0+O  S0LRK,!T't0lȟ 0 ʠ~P@8 <0\%40RR ,$(4)пtнTTx4d4x44444,5,5ܽT5 -PLM@ 00 R$hh45@ -L$Mp`P@u Pa0@S pt3@  0@T , q830  00S, ,2WC H R R2!" "_  0P 00C   k4 0C^Q0 0C#0 0 4`0080P40 00pp, (C@|>,000, 80D 0,  ?-0 @ (00P8 H $@ 04 < P U 00S  0E000D0@ @`0@ T0,d 0S d H08/>/1@ 01R`0@\30/>11< 0SU0 0Ŭ ũ,P0(  <0Q`,P~l5dп5 -0LM@H HP0T ] 밻edA56 0R  0R 0R 0R 0R 0R, ,0R0 00R4 40R8 80RH H0RL L0RP P0RT T0R` `0Rd d0Rh h0Rt t0Rx x0R 0R 0R 0R 0R\5\%R -L: S  S  S @0 R8!g S S  S ST6 -2L pR}zP@@ :T1 Rh1 Rdġ0ST 1 R fQaXf0SG00CS0X0@ӤX0;FT5 T8 0S-00CS0%0 R0 0S0  0 .0P yTYT nTNT 9YT00yT  R f PC00XH\@XH8Df80@0~4+l0\h6ȑt6̽66 -1!@@@L0BPP9 0p @ @ pp0 i`V`T$'0@0#P00T  RP0 X  p0 @@X+tĿ86 -PLM@Tp` 0d 0S' @T @T% 0 @TT  0h 000 00 0  @ P @0S 똿t 6 -P@LM `d p0P@S T0LL 0000 p[0p0St0$н -LM 0@Sp `V 0V `  `` T 0 V0 `8 = 00d Ls p0@0 j T@ŭ, 00 Zп`#$65t0 p-X0LM`\ P@ 0 ($AP ph8 F45+6 -L0 M(K0!0 K0pS좟2\%R PHbr2 R 2 ?`0St 2 R\ Bb\ @T T R PUp@ UQ~ " 0Y00 0 1 R+ &Y1 R AP-P-0K P1!@P0 |d0 ( TPDP 1 ?0P@00 00S04PJ 0 84$0@4(0 H4030 3040 40000WX@>-00K 0gHv0tTܽп48Ŀ 7н$ (7H75|7 -L$ML"@`_@0K< , )"0$"@@K< Q}, jwpPt  @K,0Qd 8 *8d8 0` Q4 J40@`KOA0 ,Ew R0,0 @pK@`K0@P` q$ 4R- @_dXy!?'% @K`p?P@4`0 pc80080 @4`00p`V4` 0 68H /Hc@ o$ hп775-7 -LM@@K  P, 0 eQD`/ᖁ0㒜,@) mQQ,0 60 PF @0K8:, 0[Q6`4` c0pV o6  ,6@ 0R, 4pPo@pK`p`@_ 64}@@KlP/lmc4`0p`V4` @PK@40 @pKп77-7ܿ -x2LMP`"08 PHb0SOT(2 800jP" 1S2 1 800jP!80Q/0ORQ \ 0!0R#S \`1` 0 0 p_B 0/ 0!S 3S  0 \@0 0 20 0 R!0`000 2 \0t\  /80Z0$00C0j0$0 \ Su8tԿU ,  0-LL0KP@8M0$ T0 -RSL00c0Q3@T TX0X  0S  R1 018ĠD`))p@-8`PL\ tB B \B B \B \B \B \B 0 Rp!>0  ARp" @0O0 \p @0#O1A-8pL\ |C C lC C lC lC lC lC  00!> ,A "`P?HA0?`P@0A-8pL\ PD xD @D D @D @D @D @D  00!> ,A "`P?HA0?`P@0-8Lp\ 0E XE E E E E E E 0 R!>0 R! "A"!?`P0HA01 ?0`P@0 -LDM@P+P 㲣@ <zpVP ( | oP(P fY sY !1 1 !5p10S  i P| 0 @PX0P @PP8 L  8K0` p  $( @8 4@Kp`,PL  j  0P ,P 4`  e(c(a(00sD6xP6h6666L lh66I J Z ] -p-L M$`K x0P$0 P @ P00 0 P XPp -0-L0PS @ CQ0 1Ñ0U000S0 --L nn&  --L nn --L M((K0(K 㳟 60 R p -LM@( M6 -LM   K 0KK p@9U儢6 -LM @ \K0   KpU`0 7 -L -LM@@0S  h`# -LM@ N(p$ pQ@P7 -LMM B~KpGnK0pG`F+`F(0 O+KrPÏ/PP"KAA NK@D,X - 4h 0X &k]|,`4 0X c]`L$> BpDa008 \^P6KAA S^p@T0S' T 880S@[T 0S 0@T8800 |  Spl QT(0 SH(]r錑@i$|7}7l78<8hN `88L 8 p-L$Mq/P`*4@K P 0` ,` 4P  *10AS1 0K(0 $@ ` (Kh\d\ {p H<0! ]P 8K ]p@ S0S  gpRT80[S [@[T80SS S 0 0R0<0 <KY)`!40LLL FDph8LL$888L 49lL] X9 h`#U 0-LMP0@S P SP 0@OPSӠ 00099 -l0LM@ 0K $0  K$ K 0P eS尠0 09 -X0L M00 0@0 K P HS哠 09 -\0LM K"@ 0$ KK@  P (K0$(00 p-LM@PP` H| P@`pp P`p(6 -LM@t0S pn0S j hhe - 0LP`p 0S 0S,w@, 0ll p6pXj% PPV0(0 0$`$`@(@prT}( p-LMP`P  06p=% rP@  @p0S P}P@PpUP@ ,@ppt9 :$: p-LM`@PT 0SR(0@VT00P <pbP@0PS 4p(L Z -LM@q- r`RK !P0 Z 0 D:p:: -LM@ 0`p`(KJpj @-pPP V $$(K nP( x$u$0[ 1S00 0V% (i$!A%pPQ0S Q0S Q0S$ .$P$) $.$I$G$` W0`S|1U 0S pN 0 ,K,0 !eZ0  :и:; p-LM`0S+ JP@'  # 0P00 $0( S ( ( R$0$0phoUp, ,0 p=php([ l@ P)Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z 00,00$0 000l[ _ ] ] L] p-LM`00P 0@T PU 0sp00 0(@T8@0S Zpd0S 0pl([ -LM`@pT? 00 0(@T8@pT`/ P `(@T$T" 0 0R 0 0Ap 0 0S 00 0P / 00 0W APP80@T 0  W (@T (<;9Z (0 R 00 0( R(Z 0 , 0:0t p-1LM@T 000 0W(@T@0!p6 +p`2 P#$@K  P  ` ` $P   8I K $! 1`[X  0*(K Y(0#40S 0:0@0UWpP0S P0 0 Ypv0SP0 SP0 S @TDx00 4p( `#LL$h;t,6,;L 0-L/0 R 00 0( R `@0 WpO0S P0 0 Yp*0SO0 SO0 S @T ,0( `#86,;L 82 P*0P!: -LMp`ዘP@ P." 0 K$K  0PS -L Mp0@00 0Sh %YP` 0S nS0oS` =㖧P0P00 @S* <P 0S!0S  0U0P P00 -0 X 0000X000  QU 0 O00 ,K, ?R0S@pO0"S< 03@P05oo,oHon -ML M8 8`0 ,0 |P` l tj  878Ph h|(7'Q p* N?0@5S[i i i i i i i i i i i i i i i 4e K0C\J d 1 (K 1(K 1(K <9 @09 ;9 99 p@9,9 0 (K   0 0(K (`LXuH;;;< <$<<<,T<|<<<<@<==xDDP4=p=q==ss= =pr=T}\}}j,{== >D>p>>$048> ( /YPl  0 KAAip 0ܠt00S0d: C Pd ~Lə  K@*PppL廙  X\  #P pWJXZ @0Sr0@0ᗤ0S PX*  X:pW>X: Z0S BP FP\  | \pk P` *Lu  \lKAA` PLg  ^0S 8:: S U 8:: S f0?Pl  P`Ph`0P p3000P(6` \ l  rL300000S\*\2W~Cp pG0 @@00@0l:  0 Sl    Q0 @@0@0Ƞ, 0@  0 S0SL40S ,lP@  P0|PD0S\ (0S0դ0/;`4O% "4\ 0@P 00C   D0S\(0 S;30(0S R1 0 # 0Sʀ501 S90%0S501050S ʼE0S 50s/00%0S50S00#1ѣ10'MK@D@D Vd: `*0S  `P \*d10Sd  ` h 00-x Lt@PdP \RX 000DP@8/ 0tU )04edA}}L p-d0LM0`S@P8&8 0S PUphpgd?$? -0-LPP@ 80 d dd/h`L -000 0LS    ph`LD?x? p-LM`0@K0 }Jp0P h0 \0,0T ߲l 4'hJP 0Srhp錑@A -LM p , 2dP +h4P$K0S! <4+P@U/J0 4  3p  80S3p3 ʔ#0S0s  }ß0S L#0 SO0 H0@S 0pT0 0pLu3DS 0$2 0$2 0B0A  뜂0Q  R: RÈ8R0t00 04 000cH0 400cL0 H0S.0O  L0-0O@0 P@4 T 00TS180@8P004 Ϡ΃ `@ȑ4?  d@d QCN@40/;4|00Xp0Pu0p $1\50 SS?  00#1t0 003x00 S<0(5(5  00,50 00 84$00@ <0D0 0000X8t A4A<@(XA$AAAB4BpBB,BC,CC04 0,50 ? 001t0 00#4x0 x0(5pPJ4 B ?8P0Eo0 5Р0P4 ?8@@00# 0 0800 00S.090CO000pǏtSΌ/1`G P$p`Y`Z11嬁 T0xR#R ` <4/S84S*8dq x00P`0xQe08@@]0 0S`P@Qx@@L0P`0xQD08@@<0 0S`P@0x@@+0P%00@/> 1$0.1^0 `0T30/>110SQ:0 40 c | R ,3 r ?C%PY @8 0`00P夀<@x@@0@PCU ?% ?WᣎVP%00/>$Ŕ101\0 `0U30/>1 10SQ8 00b0P @x@@l00 Q,ˀ50弐U@C B ?,``0xQu08@@m<4pǏS 84S*C>0( @`C>⼠0 ?@0XW0 80 0c0P @Ax@@<0Ħ0 Y +F0S 0|  00 00 ,00P%00@/> 1$0.1^`0T30/>11=L 000@W`0xQ0 00 0-O  ,@5L 2000P P@5LV>00h0 ph0 S:h0`8 0<0l8 0\ x8 0 0R0E>0XT0P0P0HU0р 00@10PP40@ ,C> `0]0SO0SOP=` p`8_@0VO 8C>0LP@+P@_  0`@_0 ,0+0C@0?> -0SO0 OC.0S 04 0 @4(0 H40 30 30 40 40*0S=PC>0 @4g / d p` X3P@0 @0P@p,JP4G/ p`P80 O C0SP@'*0\%2RxŸ*0\ń0R*Ϡ (",2Q0 r\50SF PP 1圐K0 00! S0:1A0w1P& 1*0`,0V<h1D`p吀KW,d1尠K 00@_0A0K d r P@0dP @cTc@#t0  PSz"^O0`0,0VT00S h" p00S! 80P[c>CC`TTHChu $D-Ĉ  @DPD`D$p0SP D@ 30 30 40 40DP  g`*0Ϡ 00YP=T0Ypd 0 0 i R 000 0Y00 ,@ @K00@_0,A@0K d ɟ9P@ɟ0/S0S*(t\,@P0 00 #  h04 h40@x 9 Y 0,@280 T000 /8 00h @0 0娀t0 x0 0Sx0x 00S0\& ,0p`0CT+ ! 0ȟ0000wq0t0x0T T0 1X0 X0 0\0ǟ00\0/>`00`0/>dd 0R%h[˸ 0,0^ 0,p4G4'0S\0ρ0 0! pW 00C 0,Pk4XgF`V86 R`0 10   p&0SG0dD6 RT000T000`6 R 0d @XPdP5P5p`PYd|@P0 r0P np000 508040XU 08@ZP# 4` !400400800`ZD$0S`0ρ0 0 ! $0Z0$0l4 80 0S 4j`@8?0T04 R`0  00030SG0d&3 RT000T000`3 R 0d @XPdP5P$3p`PZd@P0 0P p0002 80 0SژŸ 0X!0h14  4 0X0`" S!0`0@Ÿ0 0! $00$00X8@0a0 00 S 0x 00 Rpp@WP 0\%1Rl@ P\pW,Q,` 00O1d `pf 0@00S080Ճp&.ࠟP0U@l0Px0@U`,P0 0 O2d 0O<00 0080p `0x@`T:WhDU DT -LAMK@Pp,`1Y0A SA A Pp ` 00 ,K01B00S{FOK004P0  x0F?K-0L@P/ d@004 0A  -LAMK,@_0K0Q 0`004 00 080^,0@ d 0 000KU DDD  -T"LM0, Sp,0ll,PPbR@ d  0 1Q)( 00C 0 q0S\0000  10@ d  0 . ..archn catchmodnchgrpn cp dd df edexprnhostnameP: ksh sh ln lsmkdirn mtejectn mv pax tarcpion rmsha256sleepnsttynsyncn ... . ..chownndhclientP: disklabel:dmesgnfdisknfsckn fsck_ext2fsfsck_ffsP:ifconfigP:initnmknodnmountn mount_cd9660, mount_ext2fs, mount_ffs: mount_msdos mount_nfs:newfsn newfs_msdospingnping6nreboothaltnroutenrtsolnumountsysctl . .. tmp dbŦ runEempty\Fhash-\ƨtzlist ... ... ...  0@`1 00C0帠,0Y ! #4% +  P0@o%,p"P`@0 `  mx{`0P@`pd up0 0`P$l0@ d0R0x Q, x J,,'0 00 o/ U D(E -p`LtM\Ġ P0 @4i80D P0P*P0 "LE -LMp`\ h0K4iL0Ġ0S <0D[0PP0 $ lE -8L0@S"ꀣ T < ( 0S0 R00 #L10S0 #1W#E -8L0@S!< X X X X 00 R0  00B0  20 10&#E -8L0@S!     00 R0  00B0  20 10"E -L M@H KP0s4 A[TP ~@TP@ht@[ - L0R P E -LMP@Gp1儑儡`px!pP@4 "P-ܦ  Ц  0`0``p0 PbUAD0Sh0[㨾X0W 0 Rw`#($E,  -(bp0LS2 R2 pRpW #PPr ԡ$P@b #0B SOꌨ Ȩ p  0p 0S@ bP % 0S P  " 0S R R 0 R;IP 0SH=0Sw(0S@ #P #Wo=0Sm $  $ ,j(Ĉ \ -LpMP@T `KP 0 R I=0S G0S@: S p0S : S 0 RHP 0S P (0 Rp!,Ĉ(E -L&M쁟0Q@(0 Pp`i 0: S (0 S ([ 0S H! Hp` K"p 2 S!3 xPpE 8@ IP P TGK0  :0 E ,P P0 4 P POKP  .댑F FĈ,XF -LM@`P  7Vp@0V U@0 @/PPU`VUU -1L$MȁPUp$ `d1 R 0: S d P$0 S h$BZ/<0 S4K4@6+[ ! Q103 Kp/@a0S*PD00CS00Ӥ0 Pp@ 0S0 0CS00Ӥ0 PpYT00yT]zPDV 0$ dF`#xlFȑF p-LMP`P @@P0/S+ /HP0.S P0S@p0S .S0S`V d 00 Q P0S0P,  @@P0/S ,F -0L 嗈aY`LxF 8m - L 1Pm @0G -LM0P@/9H"P000h唓PX2Xb p HPp CR 0R00h>hZZ  -000 0LS    ΆW먅PGxH -LM`P|ဋᨋ\!CpLq mP pP P@= G!0AT0 T`4 㴑@P0/S Z  .P0S@C` XP#  @@P0/S U@  t*W`#8H<Ĉ -LtMp@ᘐKz@z 00 RPPV0S``0 0: S U P X*U /00IP V 0: S 80 0t  -0L V`Lx]yE$-_EGR)ɽ5ZCJ mauٹ-;Oح7-8?C[#+ͪ7"$bL7xN  ah4IIЈGЭ,#¦Xl}ۥv{R9Uedsvks0fZ8YO;mzwhtpKӨUN ^iƟD]Ej)hI7`}Q'D: F  R( (0pS0Z00 0PX(0\(   Qq00  R( 0S 0(0;Sx  ( KC (0\(   Qq00  R( | ( K* 0S P(0\(   Qq00  R(  s(0\(   Qq00  R( 0S  3 @T00pp#( p}@7勄( 0Ht8}(( ( 0\SS, 2(tP(  L( ( $P( t  Qq00  R( 0;S @lI(\D(0 ( P(   Qq00  R( 0;S S #( `_QZT(@(/P( `  Qq00  R( 0,S00\(   Qq00  R( (P( `\  Qq00  R( Z lTXdH̅tHHHHI$Io,I8IHI jTIhIIII,J@J 0-LM P@U W \UXQ UM  0S 0[S: \S1 0\S \R 0S 0 0 0S000 00\S  0S  0\S0nS 00  0[S KP@ KG0`J$J@-@000^S00]S00 R ]R0 0[S \S 0 R ]R00]S0nS 00.^ =^:^00 ]P P 0]S0PP p-LM`P@CPU 0S0 U X0 R P  <0S5p J -L M@Z, 0< ,0 `1 ,0 0 d 0fS*0fS:0s0 0 0PS4P  \S  R: YQ@D0S4 0b`{P@{jP \00, 0 S0pB 0W, 0Sp`\Q&Q\00 S SLQ 4 00b`@, 0\`JJK K -MLMr ` 0 $ P0 $P`Ÿ  Qq00  R$ 0gS{ 09S,1SUAK AA {pP@P@$S S $0$4 0 S x R;SpSD wSP$ 4  Qq00  R$ 0ANK @D@DS  S $ 0$0S0R0 l}0PU $ p b4孁 0td00U0P0$ꌑLKtKKK jK -LM0P\SSpN /6`PP" #*PEpPP 0Qq0  00SP@T I|z 000S0S   0Sdb(KL@LlL -LpM$K`p(P,K P@#  0fS*P0fS:p0 0S \S  0 0S0n\`(!000S S @ 0-LM0@9SP$0S$S /S  0P@  00D 000 K \S@LL R-`L@ ( 0pS S ;S p0 0 0 S S ;SR 0gPV@C @῿ \y0pS S 8p0 0 0 S S00L p-PLM@P& `0a0CS 000@Tp 0S0 C0S40 Y !L - P LR` 2P R 01@pT 0S @T0@00` 00 P dM p-LM PR` 2P RT0 AT 0S @Tp0 ĊP0 0pd -\pL`AT 0S<P U@`V0 d,M -Ԁ0S Pt! \ 0hqS70\ CR <+000xP 0S0 gC 1Q 00P0Q P  0g4Ps0R\lx.+PIhP k7P, KP2[S<00+4 MNNN {[ht@ -PLM؀`pP@) T 0 S R@D @00U00  0 p$P P D 0S J N -LMP, Up & &U0 \Ud 0SDb p9  0r1 P`0@0S*,0   000PU@0S*00K@ 0@ @K y@ 00s0s\U @0S*P000K@ Y0@ 0&S\SPq(00  00S00@  -LM@P P`p W00 ` 0 0   P0-L@P 0wS! sS @T0 p qP 0 0),w0 d!{Sp WP00)w 0 jyc00 0-PLP @/T000 0-LPHP@0 0R0 @@0I[ 0-SL@p  P`(P@4 U@@V@H h[ P0-LP 0@@S T 0S L0H R0000 R000hS0 [ -L,MS @P D #mp LP ?PPP|#0SA l_Hd2H \/L Q 0S 0S0#0S$ VP0 #PPe2p D 2`J"P  P0@ |"@ PPd2d ; 00 , -00 0<80 4 ߉1 LPl 0S0@  $0 S  1SqQ0S 1f0Sl> @P@c?0P0P00S` 0+0 0K@KKV0?0 0K00K?V00M0@ ;0 Q@ KƁ0P@@ RV  0ă 㰁 @, 0布0>(HPX_p_ 0____ -PL@p` cp lP ?PmPp`t 0P0 1PP =w0P0 #0PPSH_0fP p-0LM` P@Pc?P 0AT K03\0 S0 1 !0l p$=p= HP`` -LM0@P,0 #cp ?P SPP,0 S ,<3 AT #0 P 00LS!00LS0B \L c=]p[\ p]  Qf` {vXIP@PR  Q8 ovP3 0X0C SX' & & & & & & & & & & & & & & h' & & & & & & & p' & & P' & & x' & ' `' PI PQP'SP0-V +V ,Q@ )vP \ \ =V1h0lvP 0a0CS( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( Ispmk@hpU @@K`Pp 0 0=00 b200P B\,0000D<Y=3ꌑHw`P````````6 p-(QLM !@ b?P< 0aV< 0 0K8/P( 0Q0 R 00 0 S   0S  0wYPpCj Ps<P< (i<p}jpHP j$ 0-PLM @a?P 0PPKPKAP 0}A0 SR R 0HP -PL4M0p @P0 TP XP $ ap, rP' ?P pPLK=PX L<sP uP`PX  L KA=PX L <;0T0 0P0 0!R40*X<$Xe?@tP` 00XAPT0Sc 0 00 , 00R080 4 x 4`u U 0S C0 P0ŵU u 0  $0SuP0;0 T0S H00c RHK%\pP800c R8K\`Y U u P2 P$ R X P PX2 SP0\U00Su US 0"0  40VG 0S 004}0`71 R,4 ~P# 0SfT0S Xu XuX<\00 000D8D<e  0咀e U0S4V  V 00S`FV 0V0 R RgPF\`0  @0 < @0p0H0 D 4u;H`\$\ P`Ĉ -pLM P;`0?Sl@ YN0P 1 00S<0< `UX@HP L p-ALM!P`?P4 0P@!P 0SPU @Zp2; `-;tP``V 0-S PpsP@P 5u0S,t:p0S`HPP`Ta p-ALM P_?P`p0AT K\P 0 ! 0 rR @0S YXAP00`h0 R 00C8S` RV 0  :HP ` p-DAL Mi PC1 R p|!0@ 4@1T  tQ  R@01 !06S<1_ LDp -D0D L0\0 P G PLp P-L`N \ RT LR0S0f0QE$@F0t0f0Pp F@Dtp 䀟 ` 600H0 0 c@BTT@@DtP @D tu@ @Dt00X0 0PPu0ULP\dhx -L -L -LZ 00L -LNy - 1 LP@8 `00Cs0䠟p- P P r0 0  R0_S $S@@PP P  q00 0  R_S $S@@00Cs0SvLDp -1L @\7 `00Cs0ࠟp- \  r0 0  R0_S $S@P\ q00 0 R_S $S@00Cs0,LPp p-0LM@P: 00P:p0@ph`P0`P* 0B0R0T:pp00U0TTlL -LM@@t @Dt 0-@PPL 0PS0 P0 p(0  0 P00 -hP@L` P Lp0T*0V  0S 0T*0V `X - PLM@ pH 0 0  R ^T@?hh$r -D0D 0L0Q0 P`0TxLDp -D0D 0L0S0 P0<`LPp -p0 @L 8`P00Cs0 U0 T Ga @R 00Cs0(07aP@.PLpD 0-0PL@00Cs0 tϠ Qd0AQ 00S 0S0@0Cs00LpDP - L 0   P -$0L;  -0L? -0L6$ - 0L0@*p| - 0L0p| -D0L R80000 ,00@tp$ -0P LU:0` pUh0P0@  `͔ p0 ?` `00 0Rh?$ $DP|HTxL-000 0 0 bL1C 00N$|000 0Q 0 R LPDt -LCM`0JK $0 @ PTJ P/,1 P0' )S S1 S (0KU*0T0`pP@ g0^S@ (@T$0 S `$%U 00eU@   ꌑDh$h -pQL@@0 @dT` :%PP 0@DT*d0 XD0@s@0@^S@D} |$D 0- L^RP@ 5P00d0S  IP0 -p0xP @L@b\`00YD0 <0 40,0 !PDLXxT -0L,P -0L#D -L -lpLMP\r\`  P2 0Rs 4"42@PTǯ 0c0@0d0CS01 1E D 0RI 1`V# 0@S0P0cPcTp!h0 0CR& 0R 0R>P*Pt @Dt Q@0T 00t0T 0R P

R0@D?R0 00p\0 T 00 0S< ^00,P@0 ?00 0089 P0-L@P T $|0 0h S`0 ! XT0h$H0<$40 $\hQ6dh<Ĉ8 -LM⠢pQ, S |,@01Q 0` 0@:T]$Pp 0B,a dP00S S YS 0S@ WG@01 R;0@:T;T 01  l#00 RPq 00@ ,0T1 ?> 1 @  ?>1 @ p 0P l\P @, 6 ,Pd00@TTPUXxWT$7#Q6 lh@h p-LM<28!00( >$A 0 PP Ġ00 PPUP` 0P4GU  @PĠ 0PPU㚣P@ D[P80  p,[P@xTHh@-?>,1@LQ 00 -LM@Q  Q Q Q Q$ h0 L p-LMP` R @0@0R@PcPbS3@psL -L0Qg0 9L - LM0 0 p` P0@@cP0 PP t 00p 0L0L H0@ @0@p`ET TDHTPLhZ -Ls -Lk -Lc -L[ -LS -LK -LC p-0L$M` 0K K$K a0a(@K @PP 0@ 0K @}T$0焮$0P 0S@@TPphPLDlr T -h1L M`` 0(K n0n4@K0K,K @P@P? X04 <?0H0,0KpC"P00T0S`T XU U 04 P00  0R/S \P(0+ 00( ! PEPLDTlr -\0\X0X T0L0 L08\000 5 hd`lDLTx0@ -P L0HS00P0S P0@P p- P PP0PLM`0 0@R 0 R R00CRphp0DS ꠘ     00C000hd\ p-LM@,`PP 0S 0U p` 0-L@Pp0p0  0!0S 00@C_ 0 00000u0 @Ptp -LMPp0` ` K"`@T 0 0@0@ 'T g`DPHLT p-1LM `Vr 1 RPC0S S S "S 'SP0S0C00 R R R "R 'RP0S S S "S 'S00S0C0`@0S S S "S 'SP00@Z@pάP@U0Օ 0  R R "R 'RPEU  R R "R 'R0u0 S S "S 'S 0P$tpULC -,2,B L^P r00Cs0e b^  q00 0  R_S $S0^ LUT  r0 0  R Qp!B00X0^2  r0 0  R0_S $S#UU r0 0  R Q 00000 r0 0  R Q 00Cs03000 r0 0  R Q DLPpȐ -LMtQlh0h @ PT *Tp0Q`JTP*0U@00xXTPl -tt`0@0Lp2@@PP+ P47pN0mM h -LM0@S`p P$ ( +*(0  (0 P (PK x0S( 0Q *00 $0 `(0 $ @`DA A@ @ $ ( ` $ (  p-L Ml`0P0@0 $K 0 $0 9$ K 0B #1P Pp P p-L M`0@0P 0$K0 $ $ K 0B C1<@ S@  @ p P -PL`M@ ` `   /0S 0S0S @0  00 , P00p(0p 80 4 P@ Lp p p p  `K 800c R8K>PW񟗩  ` V񟗜h Ъ Ĭ ج Į ذ `X 00 "" " V  R X V X 08.0004, ` @[0T. @0T* @(0V0 0 0  00 , 004 080 PL=@` DA A0@0@0@0T * 00 \  < @`DA A0@0@+ 40 0c0 0C Vm Q 0 R00S 0S,0[W 剐Q   l!0F]Shꨨ Ԩ Ԩ Ԩ Ԩ Ԩ Ԩ Ԩ Ԩ T Ԩ | Ԩ Ԩ Ԩ Ԩ Ԩ Ԩ Ԩ Ԩ Ԩ Ԩ Ԩ Ԩ , Ԩ Ԩ < Ԩ T Ԩ Ԩ Ԩ Ԩ Ԩ Ԩ Ԩ Ԩ Ԩ Ԩ Ԩ Ԩ Ԩ Ԩ Ԩ Ԩ Ԩ Ԩ Ԩ Ԩ Ԩ Ԩ Ԩ Ԩ Ԩ Ԩ Ԩ Ԩ Ԩ Ԩ Ԩ Ԩ Ԩ Ԩ Ԩ Ԩ Ԩ Ԩ Ԩ Ԩ Ԩ Ԩ Ԩ Ԩ Ԩ Ԩ Ԩ Ԩ Ԩ Ԩ Ԩ Ԩ Ԩ Ԩ Ԩ Ԩ Ԩ | Ԩ |   0   0 00S 0  0 0 0 `0S0000 > S<   0 0  00 @ {V @ 0000W(  0 8K KP eP 0 UPuX p=40USFP  @0T*  0@8@` DA A0@0@h0`0  `   $00(   0 S 8  b R8K<P00 0S )00 HKPp >U  000  $00(   0S 8  b R8Kڢ<P00 0S )006 0 | dK@K 0U000 ^0@S 8  b R8Kt<0P00S00  00@0 T KHK 0KPp~ WX  PJ ([ 3[0cഠ00@ 0 R00#0C S-, p , p p p p p p p p p p p p p p p p p p p p p p p P p | 00 ?00A `@0  (CXUl4pZ C0  0A 0  00#0CSOꌯ X X X X X X X X X X X X X X X X X X X X X X X X X l 00)  000p 40P^  H R000 0p 40Pۧ"@) 0 c^]0p00 0 40@U ủ l  X 0 ` t0|`0 r)` np H0`VH0 f R 3[SD0 RD0 H p00C0 1`VQ 3[S ` RD 3[S0p0 >QA ` :D  0SC' D 0`0V V    0Svv  D D3[Sp0DF `A F`pN 40 U B GH0`VH0 vaPク ,  P`#[hj`Lhhh@D@ Y@P08 @mXPL  -L MPpQs 0#S  `P@@:T 0ş00 `@ 0`S VPT`0@@T*TQ%XJ K#XG (5  0S8  @T000@ ğ0 @" 0 R +X 4 R 4R 00 @T+X l@-X=X ?X @4R44@T0@@[0=X[RP 0@S*S0]S =X {[\@00  #0HSl | l | | | | | | | | | | | | | | | | | | | | | | | l | l 2 0,0 0 4 b@[P 0/Z40 0`CA 2020@S@@^,0\ *000 4  @0@S000MŸ  o10,0 0 4 4,0\* @ 4 \0 @` DA UA@,@ 4 0 0 T`V T0S@`@@T 0`SFP[RP 0@S*S0]S( @T*T0 @ T00Q00S V 00 $90890Z[l0`P`@]bZL0 0`S`Z Z P Ph -LMxP2,`aPP@p"OPUpH 0S ,K ,B@u`(P  [( 2p00@0 R0`V 0S 00S 00PAP@`4(0( V i,i0i -L@PFQ@%Tp? #T U@` :P`T`T TU@ :P@T0e  m8P@:p`p :P`DT*P@: :P@DT*  p-LM 0CP`CA)P @0T *00ᣤ TpX0 @`DA A0@@0@`Adph=꼱  -0LMpH`C 0 0 R` 0D `VL0@S D L 0L 0!RPU(7 ,0S 6 R /1JP2H, , 00CS ,    , 4 0044 6 y/, 0@3,0 R,0 R L ,0?<0 ~040 0,0 0-PH P 0, , 0 @@ ,0  005 p0S 0@SXUD0 ,0  bğ#080 , ,0#20#0 ,< ,0<0 00≢P@> @48$,,#0< <00, 0< S 0DS d d t t @4 4 c7/ <\0/a,0 , 00, 000,,0 P,00  s3@  00 0@(R V>, 0\ &E,0  ,0 R (9 ,0@>-B\ 00 Ÿ,0  0  0p00 0S B @cK`K <(kU,0 WS \0^U:QR( h=PV ,0S ,0 R 1[, 0 D L U ,0 0H0 1RC ,0! Q6 ,0! Q5@5!5pP@ p( TH  0 R0 0H0 01` Q H , ,0S ,0 R 0`|0S00p000 PU  , ,0S,P |DmHliTXpr@Lpiii i0i $j\*45p ,,ɾ?9@0 \ 0 |04 &*,巾,w94@ \P0P  LC 40S 45(: jkEdkPP 4O&00cP@@X 00P0 P S R  Y PP R Y Z 0 S P Y? pR p W00W030"#P``S( 弃0 gA!B3@ >P\ d0xx 3@ d 3 RpGp W00W030"S 902F/sP`U pR p W00W030"Sc/pY G HRX@"P@  0.PP= K vP`0 2 (00 O0@ d 0Pڨ@ 0dSʤ00c0l SKڢ%@ /00`,i$!3 xw/d3L $y2 RpGp W00W030"S2 Y "Y  0S  S0 0 R00`lHlt hsl[ll$l6mlm(mDmhmm -`LVP |p =P@  0S@00 T 0P0DP@"@6 -QLM@< @0 W 4D <1\1  000 , {00p0@80 4 `g0PP 0*8K @\0S 800c S$@D0 @p< ᙏ@Z.80`P cR8K$@P ဏ4, `Kr0p$ m p-LMPK`@&P* P1 000c0 PU OppPU )pVP pp0dP?SX0 b@@0@ vP 0p$mm -H0H 0 SL4:QSC $m -,0,  LQ$m p-h0LM`@ XPRT`: 0DRC 0˺00C0 p$D0D0D  0aC1P  / 00 $ -LMЀpPQ@Pl`EQT00? @AT, :0TZ,  %P 0 AT:0T00cCP $ -X0LMP 0 cBA# P0 P @ P  $ P-Lx@0lpPh 0af0lCQT a8 1@0P($ p-0LM @R! 0S`0PSpphp X0XPPH08 <0 B PP;Pp$ -LM8@04S} $0}/ 婹0 @ ($0 -LP@" `|;P000 RTpP@01Q*`P嵹010CQ*00 010CQ:$( -1L M R!001 DÉP "-YP@QPt剨 0rlaPJ = 0鿎p@ 0S 哿qP 0SQ)pA70 PTP 0XPr h Bg> 0'pP o|m (Aq  R      0S Aq 0S     -GML M,q,1IKL 0 $ 4 @HPP" P 쀟BnK`F0 /-㟵P@ 2P$4P ᴴ$0 S h$2\0IKA≵P$᜴ꌑ(,mm@-@@ P0S @ P0S P ^ @ P0l0c0 -RPpLM@` PER @ l     0S  U@PE0S0 0Q : 0FS   `` ]0 l0 h0 d0 `p$ p-d0LM\@00cC1@QP 0`Qa0(S!p$ -LMl`4  0 DP@P+ n0 8 p`>p`  0䠟S8   400C0W000 `@F̠F00K FD00K/K.K-@K,`K4$ 4 0㪚@00嶦 -LM@媦吳00 - L ȽPH --LMT0T @0S4*o - ,H --,@L^ - ,*H --LM0 @0 S*0 |0 R   h0  L0L0L 4R$ - ,Q-H8@ --L@<<?- ,v-$ l,u*TmH P0-L@ 0P PP |0x-S -T T@Q R 0<S08 - 000P8P H@n --,0L \*-,*H --00L R   -n -LpM|KℳPt0: S  -H@LM (0 (0@D ( 0  0-LPP@00 S U4n - PLM @ A>P@0 S 4n P0-@L@P UT  0h;0)H -L M@KP0P'0 RTn -LM@h p-LMPq 1@ 0 00S  R pP0S T00ppho0`@ήP 0%0P00S %10P00S00P00S T 4 P0000ppT0tnnnn0     l -LM,@0SP 妱00l -LM4@ P0SR 钱00l -LM$@0SP 邱00l$0 0PQ 00ln P0-Lp@ h@0S 0SP_000,PPW00PQ00l -0LM`0V`Pᵊ@@pP,@d  0Ppi+GP a'$0  00n, -1QL@P` @0Ǡ) 8Vpp 0S00 3'0 S 0S `P@†0 0 08@TZ0S40 Rh1>hid@ PHW -\1LM@`THQHqH 8Q8q8 0R @TV 0R 0S00i;@Q03㷕 0S S0 0S 0S0R`P 0SP ەؕ,L -RLQ 0SRX㜢 0S2 R0SClrlb@ 8@TZ0S @b@B0S ϾP"P 2 00X P PmK^* 1 * 00`1P0S ` 74A唕 R0R i* 00_* ~004=x 0 Sp`@ xpx`@ 7@TZ 0Sm}= 0# @TZ7HWPLdooooo -L Mp40 0  d|, K㉄p` PDP D$0``0,$00\:P0P@ 0#SUP3 RTPPU @0S @Q 0@0 3 RT  40S '30030 4AU3C ,K ,    8 000  0S  Q)0`V J)`V x(&" L,K 0S  DbDR@ 6@TZ0S@ @2!@@@ @@<6 0 T 0S 6 6_ᡯP@  AὮIL1/e;81 J(1 ` A 0,  0(  00008 P0P 0`` |m,K ohd|lH pupHWP$p,p,Hptpp -LM@K @I8 R A000"d 0-LMPK /x0p\ 0d 0 P }0 @0dppp -L M$`K@  pTpP, (KP 0PS  @ T0d0 ݂ ׂ( R p0!h`0\ @0 0S \ 0S\d,p4Wj -L M$pK` P娂(KP@$  R 0S P 㒂]( hAUU  x(0! +dj4W -L M, KDc0K PPP 0S X0@ pT `0ŸS0``pS" @T$W0 0qX 0SB0S  z0S pB hPW00H0 U00 0S X 2 R0">0,K  oPX`A00 R  0S AQnP ,K ' X \' 0,x1!0  ,KD'0 h 0 p 0< }9K,K 㟁lV,K 㘁T00 !HdpPprXpp q4qXq`q4Wj 0-0@ LR# P0\$ 0S 0S0Q RT p0phTd  0X00\ 0S@ 0S@,`#nooo 0-LMPK@ 580@0S 0@S (0d -L M,K`PD pV`pUF 0KP@3 X XT ,40#00 V  @  00CS0<0U@T@T 0 t@T  ۀ Ӏ000!(@dxq4Wj -LM pK` Ḁ@T P0S 0@  00CS0<0@T@T 0 H@T0# 㑀dHq -LM@K 8~00 \000t 0d -LMQ@P 0= S< 06 @`쀟40 0Qp@Q Q 0  T  0R@QT t3 0R0   0S 8@,i$qqqr00 000S  0S$4 0S000, -LMP00좟000 SQr`0 SV Q  Q  00. 00 R} `2 Ry 0Sv QDbj @BIPY 0SN P 0S? " 0S0;004 S 0S# ( 1 1`@ 0S Q !| " Q 0S V PP 412  00S0  X 0  <X4%0 `P0h;0l` 1P@j 0`00@0010@00Za Q_MxHPq -LM0` V 2 0S{ `VpKH뼠K  dPPhڸpK<`V 0@T 0S @T`VH V (0\Q=9A =C 0(l0c (( Q=9 =p 0( 0b @(( Q  =9A =C0d0  ch  Q=9b @ =  0H ԁ00 0S0 0SS000(0000  },?B p-LM P 00S QT 0PS4 0S 0 S0000 00CS A0Sa 8 R 0RS  @ a 0S0 * 0SD 0S$ 00S D1 R 0S 0S RA  C 0 0S 00S p 0S 0 U  ,00 000ppphP00CS0x00$phl qqq -L`\MD0V ,0 x 0 #@003# Q Yt +0 0Y 0-0p0 0PU5 0@S4F $H `H H lK@ bV 00Ul t #Va VR tŸTp"p Q0l KPx "U 0S UxQ1 ,0S ,/"0 SVt  V  PU 0S0 S t\h10"x 0P@LDT"l0[S (!T100l Kx` " " p0"V 0SlK~ lK@ "{0l0Kx @VT0 SS 02f 0lK2a R4P x Xc"ꌑ r,r4rĈPl 2 Z 0 00 0`d K 2 Z  0 2`0c 0{ K `X2 Z 00p7 ` R< R 0S BR RB B+R ' Kc  P\P ǟ0S00  $X "X 20c RKtpX 00\00" 00\X `X00" Z@ `@ K# \X P\P Ɵ0S00 X 005 2ş Z  0 K  P\P ş0S0P0 P(U 00 r h2 Z 0 K "`R 00~7P )K P 0@S " b RKp  00 R04⫧n0(20 00 < b K0& @)X (X0000S0C P\P ß0S0P0 6 P)U0020c RKp/KZ V`>X<XBVPW U V00W00SZ xO)X O&X+  X"t2 ,0S x,(XT2 R P\P lŸ0S0P0 P(U  P\P Ÿ0S0P0 PU |X&UF ;X |X 1&XK;X |X0x"`Ц|q0FSGLAz@T *Xl (Q d|X0A0EA0US2 " / AEU'2`A2&  'P@ 0 0S 0S <0S 0( @ 0, <0妦 `ꌑ j P r(AE n'P@  P0R }R\ x 300T*X 0S0 0 0'U0`00C >X000 P\P 0S0P0 PX< <X>U&P 000 0x8l1E` P\P 0S0P0 P-U0 0 0&U >X00  |U00S @0<X00>X'X2 JZ H ` 00C0 K "X|2 JZ `00 K}X`2 JZ `0 K0S b Xc 8c Xc `c (X( "X 'X @TV2 JZ `@ K p 00000)X \X  00C000"X \X0 0C'X0000C`X  " \X P\P H0S00 6$X "X X\0:20S\X `X2 JZ `# Kr(X000 )X00CS0 P\P (0S0P0 P)U b@P ax000( `p 2 JZ `  K5\X 'X "X 0 0m2 Z   &`000 K"X \X P\P x0S00 $X "X X  \00\X `X 00` )X |X (XO 00  2 Z 00` K 0 00T}X |X (X3 00  '000 P\P  0S  [X X'00C0D p-LM0P0`0@V:`p0T: -LM y0, !B0001 < 40 0 +408 0<0 @ 80,` pcP\P 1 R0P0 PUR W U p0U <00c R<Kk @P`S UU( P\P 0P 0R0 P U<K U$ <  b RE @P<00c R< @P8 0 08 @@0 `ܣ0 00C00, r --hLM 00CS0< 00CS0$@@ 8GPH p-LM@@`ባ0DSp0P B    $ < (`8 , 0 4 p<408`n400,P p-LM0``0T- X 1 R$ R 00S  RXiz  0S 00S 0S 00 (1  X0001, d(P  0R@ S 00@,0c aR, ,@@D0S    $0S R;T 00S %<0 0 嶃a<P\ 0-0LPp@PP0@0s -0@L MTP@ T ,-0,- 0, 000 X |@TP0H , c 0 0< s s -!MLM4ʟ` ,  PT( X8 \ d  @ 0 S\ @0S 1 !KLLl dQh S \SP p\Pc !P@3 X00 SH X\ h R$ 0 B 0d h(R`80`8 0S X\ T8Q ,0`S ,@!P@ 8!mK `F0`F(0 vXPX\d h(R`80 0(#XePh` @Q 8 R!0AVS񟗄$v v Xv v v v v v v v v v v v v xv xv xv xv xv xv xv xv v v v v v v v v v w v v @w v v v x v v v v v v v v v v v ,x v Px px v v v x x x v v v u v v x y v v Dy v y v y v y v z v 0z Tz hz z z z B^KPEpPE0K,0A+K0+0B[v`XP@p86B^K PE0PE0&2p6B^K PE 0C00AS00@SB^KPEPE%0 0 B^K1PEaPE0%2pl lB^KPEPEl%0l lB^KPEPE<%`}G" P00{RPPU B^KPEPE0$k2~KpGpG+{V}+"PPl ldB^KPEPE0 }"@p}B^KPEPE l lKB^KPEPE0$B^KPEPE +MVw*+B^KPEPEB^KPEKpPE,LSB^KPEpPE\0HB^KPE0+K pPE,0BDl{ lB^KPEPEt#{B^KPEpPE0K K,0L+ A0B^KPEPE .!P0p0"3B^KPEPE0)}P P@ B^KPEPEB^KPEpPEB^KPE pPE 0` 2B^K PER$0#0pPEB^K0PE`8 pPE 082B^KPEl lB^KPEPE "B^KPEPEo p!P  k!P B^KPE@PE+U -*?+@)*;+u`[!P l*1+S!P B^KPE~0KKpPE,0L+A$ *+  P0/S*+B^KPE0PE 0B^KPEPE0 U10 S Sh8`8  p S \Sd80#pd8 h Y`00`8 ꌑHsXs`d s,i$sdZd[0sh|D{t  ?U< [U) ]U" |U )UX IyWpGY00X00S |P X pX Y X R0!S@ R0]S@Hi -RPL MP@p`R *0U5#SP QT:U0S d?S^ *S 0TQ T PE0 P0PS:< S zP, 1 0TPES% ,0 S jZ0@00  00\ , 0Z,0XP , 0P,Q P@QSSڿ0CS +P, 0TPES,   U0@00  00U\ , 0Z,0XQE\  D0x U ;P r, 03Pk P, PEU0  0@ P ,0X , 0PGZ -LM:`PPp 0S 0E00x@0`eQp P0 R QPpQT -LM$ 0`S@p 0[Sx  R$ i Rc $0S@ R 00T00S `0S0]S' 0S0[S0:S$PK0 S  p P`p $0S0[S0:S 0S0]SV$0-S0S $ Q$  R$կ0$  Q0]S[T0$  R   R( 0:S$ 0!S$  P-L@Pp`*0S @T: `)\ 0W0|\00S V  P``FvHi0  0 0     -LM@\`p 1  PU$0Q-P0 Q -P 000#0+P0SPU00 -P  0  0 0:U?U0 ,U00;UX{#Uy XPt :P? ;P= ,P4 #P 1 pW !0p !0 00 ?PpP 0!0 00!p p(P 001  10 R 00%1S00! ;P :P 0 00 P 0?00P000:S00P 0X LH0P0-SG\D0 00 Pld`#4uPu 0-LP0 S@5 0  0S0h<0S 0\@ 'Se U 0S C  0  00SU0<0h8PP0PĈ%x, -LMx4 4  , 00 @|Dq8 bPPP@bTX` U`V`P40cbpU400\W@0 < ^ ~,@\8   00@T pWP8os, @ 0, T < 0 d(x0xP -QLM@ y:Pp `PP*PU e*0S h:0S0@e PdUp:0h0 -L`p PPZ 0#S0@Pʇ@ -LM @P 00 ݈P00 p-@LMTP` TP pU UeP0  ⺏P00Տ0[▏`  -`<LVM`0 0 /Q40 8 , P80 0D .Qq 00pW8p  8 R 0 S:S0 0S:S0S0g0 080YS 0/S , R 0S38 0RY 0c0 0 @ cRP @ c 0 SP/R/00040 d @0 bRP nc8 R00 4d0 cR@P ,Wc,  P0 S/R/000.S0S/S  8 P0@-S`G /SppW @/P/R7 ^/ .^ QP R/R0 00S/S /^^  .^0/SSQ000 QP@ Q AQ0/SQ.00 /R P-Lp@` QdP0 Ulp bT X0T L0hǎP塎0P@@@P  -LM@#d|0     m00 K 0  P 0P/0000 `n  -MLM0ܑ0c0SpP, @ PT? 0/Sb S: / P`dU VO V> 0/ c 0 0c RPBNK ` P@Dab@D` oP0`(K P/R P PP X@,0 S ,飷0S 0.S0.S U0u/S U0.Sc`0/S ꌑ4x -LM@p|0`00 0,0< (p0P NJP@20 P00S 0`` S`` og 㶆pωW@,̍  -PLM`lp@82 T& V`0 0,0$ (` p ` P |ꘀ[[x0\S00@0Pi aP PP PPPP Dx -pPLM`l@*$ T P (0S;0W< 00$  `  \ P P PPpPPPdxx -L^M\pP`@)T0㠀 0WB , 0 E 00p(Ppp PPP $0BRU@Pᶌkpl⯌@ x 0- 0PSL@FP ӈPP0 , 0,Ȍ 0- 0PSL@ +P 师 0P 0 P0 0-0L@P  0S0 0  00 0,啌 0- L @ 0  0 0S[ :Q0a0 /xo0 P0    0h ݵ$0 0F x -@L P 0 Sw p   0:0@ #  = S , @0  d0d@0 0 90   0p``V  OPp``V@ 90 00n0S@ ;0e 0W$ 0  _000@S$00@x -LM @   0S9 / &:0  P -0S0 0S0:00;00 00$ 0:p  $00o x -LMP `p* V# @T T@ _0 `d d0V0 pX f0;p @T 73x y -P Lp7 WpG2 @Tdp) @T!  Y5P @0a@T@` 4_pW00 V dP  X@ y -LM @T 0S  0C 0 P 0S 4y 0-L@P8 50u  0 Q)  Q000  0QS 0*A0 0 00: A0 PA 00 00Np  0S Ly p-LM @`A v" + 0`KS" PK  ÐP P0S   ;00 $0p  $0 0\I  R 0 B `0p   3dyxy P0-L@P _ 0h0 -LMP `pZ XS@T 0PI T@ 3^0 0 d0 `dpV&p" VQ@ A\@`T`d  DPp@`TV  ^ 0 0f0 d0S 0 ;0[ 00$ 0X yy --LM 2 -p-PQ LP@4MH`KH 0 0  @py --L4M@@K0B z  -L`M0VPD ,0 < @  @T %T  R 0 B @0D  D @T0D |8 ,0S l,@T 0DLS p @TYT A0DS 0@%0DSSkx x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x ,  x x x x  x x x x x   x x P x  x x  0 <0<00 <0 d0D,pK< S/                Q a@ @ 1!10A00R0guT @P-0+0 0(K0gC Y @Ѫ30#0 P0S X i @ = ShC @ @0@X+YD D I0S C  0  0YpIXDD 0S C0 @0 HXʨ}D00hD0 h0S C0 @0 Xj-P+P/ P- 0P 0@0S# 0C0 00 DIYpD 0xS0S 0C0 00 D p ID 960S 0C0 00 DpID $0gX0000gQ 00SN 00!10 ! g@ \pGX0x00<0倠 8pK0<0 8 K:<0p (1Wp< ]08@K8pK,}<00@0 <0@0<0 t@Xqhnlꀠi@fd0 b 0@D@@ @0  @10@00C @0 0@`FQ@ @E CꌑyyvzP 0-0@ LP0 SlPl0  R0S RR 0=0000 x -L!PP@`p 0S 0|R0P 0 T  0q@mP00T|P -LPP`p 0S0@0 p0T d0T 0P <T>P&@d -LMp, PP0@07 T`( U FT&T &T 0PX W  0pV000 ;T`,0S U(0P @ p-LM@0S( 0 ER p`0P0 Q@@Q$T00 0h 00`S000 L0RP4 5*p000EP>8 z -LML0@S 80  Q y0P -LM$`Kp@H P  0n -)L p-LM0PA~0`P@ 0T S0 0 R@0P@fDA _01p  -LMaQ @ !Q1!0 $d(T!Q  0  褀T@tPa4p0 @0 P@`|hT@tPa4p L @< oP{ {` 0{0p0 ) P p-LMkD`0@TP cPpc_P 00@ \_\ -LM0!0Pp@!`0P W -P   P 0w0DS     ( 0 T \ 0  0  0i 0S|  @t t ` X X T L L 30#0P |x{{||||||| `0-0L@P^$@0hS^$? -LP`p@ T` P d   D X h     W@ `T"T $T \$(P 0S)P$((P 0S)"p"p${P @T }@T}P(|) -- L 0 -- LP4M@@K B 0 0b -P LR`p %R e R ;0B:S                       L d |                                  p0  ;R   Z @T @DTʜ @DT  pa@p  p@P 0Sx ?dRX`eX@-00dpPg 0S` -PLM`G !x p 0 S P Y00P @0S`x@PP200P @0S`w@PP00 P0 00000SP p-LM`P@ew phK p-LM@`P0 S|   X X        0S Tdp@P0SVU@ PEP0TVU S| 0-L0MDPK@ B 0 P\ L L h     P ` x  0$(P 0S)$((P 0S)${P P P}P(| -Lp@PUjw0@S Pv`00 R 0S0S1SP01!  p-PLM`P5 P0P 0@S vPvP 0@S v0Sv P phvvp -P@LTp` P 0S0S v0S@hvvvv -LMLapPr00,Q, ppsP@, qoPP joP XWi|r 9 or00-x @@؟#T k Ppf P@ i꼈|}<}d} -LM@0S=r00鼈 p-LM`Pu0 0Pu0@0S000 L000 D@H@ 0 L 0Pp Y -pL `L0P0A@TJ0S 0 @TZ 0 (Huhuj  ~ 0 p-LMd`dd i0PSpAR ,P1 S0 0Y -LM@pP` 0[S 0S@┐ 00  @2Pu g  p,K0,  R* u } -L MB0( K!KP` 00Po![P`r00000  0   !0 0B0\0;00  H10 R 1! L0R'|% % % h% % % % % % % % % % % % % % % % % % % % % % % % % % % % 1 uP 0?00 00<0 0@ PpL0PS !0[pS 0002P0<0(p!0[S(I Ph -LM@0, K%K@p`;00  Q ! 000 TP 0@L@T " {P  0 00  0000%0[S 000P0<0,\P\ P -L0M\0 p(0 N@a<    0`7 (!(1+`K @ 0O#ODP0U0f PtF00fFP@ U 0 UBa1#  f0E  f00f 0S-00f  d`(0 S @(垻40ꌑP~(~gfffP~  -LMK @p q` -L@,50 R00SP`p@K B 0Q0*s0 V0   0 00 0W 0s0 00p`I 0V0 H冼 0 0@P .T X~|~P 0-@0pPL  0 000hI80/   v0  -L@ P`rM    RG  0 !@Up0 00SB Q/ \Q\-Qp% #Q, 0 % q0  0  R0Aq0 0  RWAq0 0  R7AQ00?$QW@d@T00S$T@` R XRxR00  0R `00S _PP 0-0LM @KrpPh  0 R  R0P  00 r0 -L M`@(H0P  0S082mrp   ` P P q00  R@PdU0n@P 0!0!!0eP@ 0S pL10  00S Q8!0000ӑ0Q 0S p00  00S Q 0000ӑ00S q00  R@ 0P  0L @\00S  ,F P~~PȐDp -LM0p yG` vG0P00q@ F@=  0 0c0 EZ oq -LMP, 00 AP` 0[S =S `@3 R  %0U p[0  , RV0 x-V h3q,  Q 0X40 @L , 4 @ )80 <   0T0 V0 S   v ,0   k 0 00 008 0 R00S@0    0T0V0S  <0S0  Y%@T4 R} V 0   W0S0 ?S 0S ) A <P 4  00 00400Z  q q ONDP PIP ,0h  `@P  @QL@00  Q 0 Q|~ P}u p p ! -PLM@ 0T0   R0 0Q [R P@P-0S00 0\00 Q\0[S 0S0 [S ]SQP -LM@P0 0S00 -LM@P  0S 0=S   -1L M o< ,0 0 4 Y ap`VJPU 0 0 S" `VZLY4,0Q *00010 0 `40 o0@` DA oA@,@ 0 4  kL@T   P000L@T0 4,0Q* 004 0X0@` DA oA@,@ 0 4 Q0<0  0 RR -LM@+ $P 0  -LM@ vP h -LM@@P:; 4< < < < P< < < < < < < < < < 0<00<00 b0 <00 <00S pRA0T <00< <040 0<00(  p-LtMPy@P `= = = > > 0> @> \> > > > > > > ? 0? ? BPt00pXop@ 42 p0<0C@ "@`@0<0p0<0xuXpq~p0<0I0<0Q!0<0wU뛴pQp<:0 ! P 0Ӫ0p p0  0 S0`P-0@/S1fPKP0: S`pLn000<0qD0 b< @0<0k`d  -LM@@P-@ @ (A A @ @ (A (A A A A A A A (A A (A @P0K00h/t:nld0 hh<@P %n00hDlv` -LM` pC0 :0W0 PU 0SPU 0SU 0S  m@  #0 A?U0@0 pP0@ 0 P]P [P P]P Ra -LM[@i0Sd 0  h  -LMpP%0`KW1S} @1S|~ -LM Q#p`a0S  @T 0 S 별@t 1 R Q 0T2 0T/ 0T! :P 㾄 㼄븄t @ XQ A 0  0 0  R X0 QF@B듄 T㻄=, -LMX0@ SE `H H DI I E E E I J LM g0Sr P0^@0DP\ XpR 0ǟS7 S 00+Sh7 0`GS\WXW0 RPF HF F E 7 R cQsQ CQ  P  600+PF F F F x6 R6  00P0S P 06  B P00 P``V10@%S00@``0  5p@p P 0 Sx@ @0 @A x \5/T \`T `  Pd p$%0 0  R$ 01000C0E$0@00f;10@S0 D0 0p$0@0T0 t$00v 0rp@$0 0  R$$Q4 4   PY #000 w#0  #0 00 Bt3 {  P00 PppWXP  0P``V 4@T (3 DR @ 0 0b 0  00 V@0Py 0PV 2'QP  2H 2 RD X 0 0S: 0M  0 0-0 @0 TT 0 0S 0^  0! 0@$ 0 0 0 00  0R 0 @DX0`80KLq@0(` 4p } P`PEU@ ` 0@H 0PE0`U 0 0` 0? 0@T 0 R `@0 p0 l( 0!00v|LP<,hZt Ī Z@T p-|0LM@`@P9\\0P P0D D0< <0@#ph<8|4P0 0 .PP Z p-xLM P00PPPU@C H4 R < P ,ğ0S0C00@0 00C 00  c Z> 3 ppß0 Q #0S0C000C0  0P0 0 ӷ0C 0 p0P 0P 4#0SP(3PT-P P P P P P P P P P P P P P P P P P P P P P P P Q P P Q pp2 S p2! RHR0 0CR0$b 82Q@  0 @00 R 1 0 S0 00  c= 00 0 0St1 `P`1   \\!0a00cSsS CS41@ ph`0 RA 0@  l =0 0d c 00dR0c00P@$h@0S\0PpH0P0  cm=0  A P|,<0484LP -LMPP`0  @P0 04? R 0LyS{$W 0V U U V U U U U _ U _ U U U U U U U V U U HV U U U U U U U TV U U U U U U V _ U _ U V U U U U U U U U U U U U U $W U 8W XW |X U X X U U 8Y U Y U U U U ` U Y U @Z lZ U Z U U Z d[ U U 0V U U ] U `_ U l[ l[ U U _ U \ _ _ U U ` U $` U ` (a U ta a U Tb l[ U U U U b -0S= R 0R0B00\=! R  04=" M  P 000k ,000,0 P 0?PPPlNS|P%< OP@,00X @< T \,0S000@L0 , r0PPS 0 ؋P .P 0S  0R =@Q0 0cc .h  pr<00@Q@@@pp` a<8Oh @;+;@@@;  :@G: +:*@@ *@8J0 0 @0S0C0)UP d:P*00ePc(j@ErP00 *, :ɟ9@@: @P9)i9@ HPPEU@T 9 0S0C0U X9<9<)0)0xY 4@0 Z9(8(XP HP0 0H0Sڈ8x(l8UPe0e, 00e0Th0 RV 0   QPc\' 00^P@0@%SP@c\Uy\ 0Pc\q7l'h7H7g0WSwS0 q@70  00S0GN q00  RcRP 0 @ PjPGcUFN @P t r0 0  R= P; Q @P6L%5 0R00 Q q00  R PP ?P  0S0C03PPU0 Q q00  R ^^$ PUD! R r0 0  R PQ q0 0  R PP PUP @84$4$ 0#S0 00Ue3P_CcP  00 {CceP  eh#t3弣\#T3 0dcS000P PPEU eX 0Sg 2"2\ 0 0SXP0  Pֵ 000C] -2 R@ \2H"D2@@ 0Qp"`05X  ' U 1 R1! 0b0P0U1! 1P"@[;0 0P 0000A 0S 01 !1 0QP`!0T00 R U@`p开P0 |0  0  R4 0P0Q 00 00CQ00P000Z|@܈TDD~T~Ĉ~Ȑ0LP,q00  R 0P0QP HX@ 000 9  0 0 0 00P9 Pb 0P0 P00S@K -LP0Lp`tS񟗀i g g g g g g g g g g g g g g g g g g g g g g g i g g g g 0g g g g g g g g g g g g g g g g g g g g g g g g g g g g g dh g g h j g g g g g g g g g g g g g j g g h g g g g g g i g g g f g g \i j g i g g g i g g g g g g g j g g $j g g g g Tj R3 Q PP3 P@0P 0U0P`P 0U V P 0U0 P@ pHXWVPPUZP P FP00fP``aP@@P2,R@$0 PPWT R2 Q CR!0 0SgWP 1 PR!0 0SdlP 0CUx0 q00  RPlR !0 0SeRࠟؠ0 RZ 0PSTZR㬠0  RK QE 0PUP@hh0 sRD 0 0S3-0 PPPUPE%,؈H p-PLM@@lPl` R  XP0@D S<0 0S0C000pp`<|4,-n$0 Q 0^7DD,(P)P{P]P}P 0-4@4P0L 970 0 0,, ,000 0 "7, p-\`LM@cPc S70 0 p 0-@P L?7 0 00h 0- P@Lc0hc -LtQM0l!d1d `1`@$K@` ```@ ``( 0 Q C$0 P0b!0 !0lq00 c`R 00CR@ 0@0C 0b0 b 8 7 0 0bd 0C0\0T0T P0,Ĉ0d p-QLM@PpR `0 Q 0Q 0  Q6 000ppD`  0S0 c;6 00 0, p-LM@`@P 0S d %6 0 e0b 0p,p@-P @Q` L| T  0P 0 QL|VT @pppPZ,E-@A`0 P.`Fv+ Qp0 0  00  0P0 q00  R 0 PP0`Fvq00  R0 0 q00  R0 P,P@- AP0P+PEu( p@P$0 r0 0  RP 00 ` PJ 00 PPEuPJ0 0 |0 0 Q ,PG-$P0 P1PEu. p`BP 0 r0 0  R 0LP0@ 0  P0 0@PPEu P0 0 q00  R ,PA-@P0 P)PEu`p# r0 0  R0 P0T q00  R 0 PPPEu,0@-@0P%@Dt" PP J0 r0 0  RTP 0 r00 Q@ P@Dt0,E-Ԁ@ 00CP-@Dt* p`P 0 r0 0  R 0APXP P 0 q00  R @P@Dt, Q-LP@,0 Q()0Pͥȥ`V Ttp@5 0P0C 0 >4 ,0PL,~ -PLM @`; 00CQU5 0U@@A^S`00 ᠥPpXქ~`P@5 0P0C 0 3 00TU (P, -l0LM` `0@ >5T 2404 00 cw aw 0-PT0P0L@@P8P 00` r00c00% 0-pPL0 0S0R@@0 P0 0B0@ T, -LM̠0@ `T,@ Ppᨐ0 g?R,`,@ 0p0@ PT0 h?R0` 0 0 `?R`, -0LM P@0 s0 -L M0, p^P"0p @7 0^40U0 ^00S00,0 0 P 0W PPĄ^00 pW@0 0Ĵp02 0^U Ÿ000C,0 0W 0!^0  ^!00,0 0W000   0pW 00PPEu`p @ 0 PER` \0 S S Wv000u@p 0 00S  R+@S<@P0S 0 16v@000,0S o"0Q @>@h0 Ru M00 pW-00Ĵp k  0pWur, p-LM`@PT# 0dR 0@P0@pu0S0C0 ut 0S00u0S00<0 P bPu0S00 -PLMpA0S_ PWa$K@0 (K,K @yPPB H1($01 $0T00 (0@cT  R 0000 0 0@@,03,0 z0S @TYP p300(Q 0pp,|Po T -PL$M@`P㼒 r0S㨒 T0S PV0 ,K0K4K8@K @xPs Ve `FVV80S940q3`@M,03,0!0zP00SP 1T0 S/R  P4x|1|!x1l1l!@@4@Px1UpU 4@x0P PU48 u4x540P``pxx0 @ x00qQk D0@@ P[  00,o T|P -L$MK0 K @KK @wP@ iuwx6 0 RPP -T0LM @R 8 TT^hAt@t@@$Lt@~0P00  -L'th"t -LM,@0(S\0000 - LK 00 P Lb H Db ?/@ 7* 3* /*T@0 ,0S D,ub~PT"(T"$ L댑(B ȅ܅$ 0-@PL8 B\P 0w20 -0LSM⤀ YOK0p $0 .0s `IKPK@dK 0< $0S $$!Ptd@ADdp -"MLMŸZ, p(  @ S< Px2PYh3P \P@Pz H2 RvKAACQp m hV8: SB^KPEPE hPW )P 0P S K`@Y& nK`F`F+0QP7 )@)TP@ +S)+O) ) G)) 0pP +7)0 ,0S ,+()PWB^KPEPE+0PP L~K댑x܆8dćԇ  -LMl`0@V,0  p删KCPK@ ( @060#0@?T@@ ፃ ៃ  ᛃ   ( @0\0#0@?T @@p  ႃ ~ T0 ,0S D,鈠K Y@K j ܃p`ꌑ  -LdM r @ Z^, l p t0 t t0sSp tpp|p b!Px h t U'ZB xtT`K@PKxt)Ƞ)D)||l p0p@`e 0@T0*hpKl p0pT000 0#0Q 0@T:Z @1@# 'pZpp | x1(x!0T0 P0 L0 H0 D0 h0 d0 `0 \0 X0 @0 <0 80 40 00 $,0 S ,fꌑ, -LMp@P,`-![p r1 @bTQk@0S.S p|10  00SR ! X0 B2?@1cS@`E0S.S.Q WV$` p $K53P |P@0P p0  00S 00Aq'BQ`U@0Q qd00 @ 00S 0S `# gfff -0L 㢙`Lx< -L. -GML M<2 88@Pp`, $"L[p fPp` iPp` 1 @bTQo)1IKaAAwPp4: S Tc_BKHH+ P: LIh'0Y/S/00@Tt p/8P`` 0SP :0/S$ V:0/S `FV:0/S`='0 S_0@T4 P  %P40`FV:0/S %ꌑ$8j P -LnMM\oKH0H`p,0 PP0;,3Q 'IP3 R3 RVڇP,0 S ,z0S  o6: S" KAA]PP 6: S tP XW6: S g `@LK@D@D_P _KNPKP^HP KAAᄗPaNK@D@DO |gM PxMH1( K@! Q@41400 ` 0S(Q00CS00Ӥ0 Pp@ 0S0 0CS00Ӥ0 PpyTYT_YpPiHPEP 8SꌑĈ$ t|`#xlFȑ -0L$M@  H0 < MH@PPD@ <_@-vMPp _Pb႓0S| t @T VP @@@啅PrLpL@ ragLD0SFVP=y00LP)$, 1ϠA/ 0(@@lN#b8K@80 4 0@ , 2PALP @LC<XP0<:$@5y0-S @-L0S @%yH@@ 0 R@@0;0<lH0\0P@q@myH D ^@zĈ̈Mb؈ -LM0 4 yP= ,K p# ,00#4 yP ,K p ,0 #4 ]]|屃|@0xx x0>hᤃ,@40(@4,8 ,0+LX`TiwĈ 0-,@,PL $ ϖ`Lx -LM@P 0{K 0-@LrPU 0ShK000 -LM0@S h20p@-0PS00p-\@@T \ P`r00 P 0 R0ATap -LM0@SK P  00 -LM@08SK  v\p 00  KX 0-0PSL@0S00 RP0P 0S 0- L0@T  0P0Q 0S =S Qh0 `0 00S<Q  !Q >Q  PLP e,(0 -L0F 0-XPL0S S 0@ S0 000( -LOM\0X,0 0P S ,0 S ,,OKKK`VT 3P W?K+eqPW?K \!QH1SD1 L1@=0P S Tb818S <@ E댑0(`#Ĉ -Lp`@T TT#6P0S! P T0  0S T  @T TT * yE00D -Lp`PU U @0S P U0 0 00b0bPU U GE0D -L MP`p@T T T TT T$KPKP@ (KFP; 0D S 8 P d | $ (0Rpp`$ (0Rpp$ (0Rpp$ (0pRp$ (0Rpp$ (0RppGE0D S $ 8 P l .Pppý.Ppp..pPp.PppӤ.p0 p-LM^`P0S p.T@0S 0S uP0S 0 p-LM``@0S pP0S {@0S t0 0-@LP|Tp0 \0@ R0S<5vSPP`#,0w -`L8MpP@ M\2@ N\2P "Up5&LKTpKPH P K0T LP P@$P00P0 rP`C P !0H P0 T @@P ]H<K O `800 pS080 80W@B0T@Z >\1<\00S+\) DPK 0  \(C0[S0D[0S0 CR 0R P 00\Z?Z<0 pW@X`0`0S 00CS00  ä0 >Z !Z<hp Ĉ -0L X"`LxĊ p-0LAM @P` Tp sP` /0 @bTQ!P !/PpGOK.PP V(u.=PPGꌑL4 -0L В`Lx -LM,4C8ᬃp <.K #h, ?KKK@D3 0#  @ Lq`P ,1? ?KK0, AP@ 0 q10000S@ R00.\0SRU  @,@DlPD3@#UD# @3 xPDpD P 00000 8 0 ,0S(,錑0D4 0 -BML Mؒ.0p, t+`P2p GCCNK@D @D  t2( K0Sd I 0PS CKH H0bS fSq wZuW C>K0C @0C!!P.| L $  BK@44!@"BK8@44!@8BK@<44t|!@ 8BK<@@44@8D!P@2 BK@Ƞ@ 0bP$ t`V 00W00S 00P00S B`PPU0Sx,0 S0,?錑 8@D\t -LAM‡.0p( *P`lpBHBNK@D @D  (1$ K0S  0pS4 B^KPE` `F0PEbS  fS q@T0  ȠI0S S PM]BPUpW0S(0 S (ΐ錑 8@ 0-P@LT a DA0DSR0D \8P.T0.S @T0 -ML M@H$ L4 .0, *LfH4 QP h$ l4  QLP!$Ɵ 4(8,<#8R`4 D \ P\$ 0 l  P@D06P 6 vL0PPP D40AD4`00Hd D4 %X$ `$0T R%d4 0 0`4d0C`4 N UL*D\ 0 l ūP@D<%P P U*@P U h*9P U x*2P U H*.VV WL4SS5V34TP*C~KpGğpG  0勫P@TP D4T$0T$ D4 00D4 D4`\P cVKD4#0D L QV!C~KpGßpG  0WP@P| D4`\P cVs$D0l D4 L$Vs V VV/ xDluD$P0%H$.\0b   "P@DP]dPQD$2  2T$RD45@#04T$ 5tM D^@FDrDEP D4D%㬊0 0T-V <K <0S80S40s d4SD407D400D4 D4\ 0b0SD :1XQ:h$ Rh$ PX4  X4 PD40D4 Xdd `4CS` X00 U0#02Sd$R% TP`0`XS`HD4@\ cTHsD$0D4 P0  CKA At P0`@0 0 ,0S@,ߎ錑 8d 0xȋ\ 0-0L@.pN(P 0s 0  0S00 8 -pLM.0`&(4 pW W0 0t3 up/00X. 0pP٣P` r 300000S9  0@T(0P.S0 ࢟ P2  էڸR,"< 00 @4 @P0 +`0K L2LŸ@t@20000S.R r20000D0S :NP0:S3 0PU0P.S*  ѰqP00[ڈA,}x1x`,0P0 @PPIu41 000D0S:R .R 40,@K  ,0[S V ,0[SP) ,K0bS fS `@T0  Ƞ \  0&PUX0S  80dx@ -BMLM3@0., '8 ڪp  ZY 0S00SS Q ZY0S R0s R S 0S S Z Z0 0Ho/0+ S&B.K B BZ<$  Z , 0  < TT" K0C 0C@4 0bS fS8 <P@7 Ƞ< 0ޠPP<$ 0CPpR"PN   0Z0P 8$0  N000 0|0   !p`VW@$0S0 ,0S8,錑 80@ 0-8P@0LS((]ᙳ0@0, 0-(PLP 0@T@0 -L M0.%댢0S||1P  ,KⷲPP L2 , 00S S0B,0 , 0B S*,0``0P#S #qP`P@ q` P P0 0,0  0,0 l0S S R ,0R@1 p 0,0 00 S S0 S S 1@0`᮴P@ 00T R R00 RPPU@0V@4P@ PT R@@0  +0K< 0 j0(@ 8,0,dx -`Lp0SᑯP @0S ሯP 0S)PPx0 -pL P` 0S  0S 0崆P P@d 0-LMPK @% 0 R0Z000 0 p-LM0PS`! 0S00@0 00S 00c b0R00p000000Sp 0 00d P0-L@@PP  @0 08G-pM< 8 040@0@P,P`p(`(` 0 @P$5j# "<,@ "00 08 <0(P .$P2@ Q <@8 g1$P0# g @@0#,P 0,4 U0?A @P`R : P!0@P`eP!0@?V  @<@`F ?V@V  P@!0@ -L$M@, P!> ?0S,08  PP8\0P lP0 ,@?\ P@ l,8 ,0P0, *L@4@ @0@ *H<@ @8@ *DD@ P@)(@@ X:D4 [L@ @H@ < [)< D [)Ġ L [ t < pP0**h*D 0-PL@U 1!#<11#801#401Q0 0hJ0 -L`H@KdMP 0 ; ph` d` `` \` X` P` T` L` h@KU8 0S 0S 0S0S0 `0S SS`P Q S R0S  R 0S PQ R0S  SS S00S PK0S00aP`舐K R0SO ^C \ 0= \; P 04 P R0 R 0) R Q%\P0S0R0S 0Z 0  P`gW 0S pW 0S0S,0SPZ`S 0`OX!0PS<K 0R/P 0( P Q$  R 0 R \PQR0S 00  %W` 0S pW 0S0S,0S`VS` ,0 0 `,Pg 00ԍ -L Mp00 .0|! PP` 铥,@Kp@   ,0[S  !V@,0[,PKS 0 bS  fS `@TV0S!V @  NPP@T00`\00S PPPV 8@0 -LP$MP@p $P EP@`Ki0S P<P hP 0  P @  P@$00$P㵩 -LK0C 0Cp( @x{Pv$6: Sg  S| PW(0 S (|BBnK`F`F|!|1_ 0S[ @aD1PP$[NK@D@D  P02W>C R0 RW W0h,^0S & @1PPW dhBnK`F`F+790)0KW ꌑЏ=T}edAȉ܏Ĉ -LM@X 0s ?? ?T0l0at -SL Mp@P]00!1/P`!  *1Vx ]0S@ 0P# P* 1W@]?00 \@a` X0P  P* 0W@]?00`# <{T} -LM@ K K 0K @@VP -LM8 < @ <P`pm 4KP@h 4 0R SB P`Z 4 40@#サP0PS ,KL PP 0 P@ U10 v PP 00S0 KP 0 R ;;S PP 8OP sPP 0< @0T gPP V k(lvT}4<PLl -ML M0$ , p P`:\?000!'v1 ,0S ,zAP@ 7P 0 -P \0S08\0S !0uBKHH F40@CGPP- Xz0@S" ʹ0S Ǵ0S+ 00Lѩ \ 0$ 0:q\?000, 0uG$ꌑT(`pt,@d -L`S$Mp0K,  Qq00  Rp0+S-S-S +S 0+S-S QLq430  00S.^A0.S7 Z0PC Z04 "O1@K00K @0KD@H L P K 00K\ 10(O @/[ "00Z [ 0V 40OSl,0`( &"0K`PP, P0 Q!000ӑP PU["00 pL1  0P81@@K1`E% 80 ,,8 p0@0KX0 4 W0K J40K5 B"0@Z$$ `JPU *0 K0 P00KU:@ K00K ,@ }V`-V`@H -L00K,M,P0K?Op#$pW4 @@K0 PX @P Oß$ 4Be!5P[ 00S1["0 0 /";0@@De#%P[0SY8<!!O1@K0@ oP P`O$  !5;B S<0 8 N 0,E @,P00Q 8 0,Puڼ!@@PK0 4K !0L 0d|8^,Q@00 KTPJK@P@ T T0W0P00S@PW40 P t(1 ,0S ,vL+R:eP` 0SPR 0UPE"*0S=P 0SBNK@D@DBNK@Dt@D0l  P:BNK@D@D|BNK@D@D,v(`eꌑD{@ 8 -$0LM K-XP -0L: SP p-l0L M0@ KP K0KK@K#WP`+ 0 000p -@PLp|cP p3 R %R XV 4 * R > > > > \@ > > d@ > > > @ > > > > > > > > > pA > > > A > A > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > A > > > > A > > > > 4@ > > > A `*`p'XP P1V0PUU U |VP4*hXd1 R XP1 H1Q@(  PP UVy*!?A1c000Vq* ?A1c10E000Ve* ?2c!!000QE0U0@PH0/A!b10ER@?#>00cPE: UcU pP/@xwgfffQ p-PLM@`PC ph10  00S H100PC r0 0  R1.\P' *\\ 0SU 0B8 S('08C?PPPڌ@PEUp pT00  0<0S000PC r0 0  R -"P@2L MR0@K0 p` UsLz\Ō\pG   a 0a>Ìp4G6pGƃ??p`F R bЮ?Ф@A P 00Q00S Q b`.^L2a?@ C_`0 Px 0 P0x0Ńƌz(p , 0 KV10U0 0 P@0 0 0 _?Rp@- b@0`P \02l`1^1b\@0pRp@- b@0`P \2lPnR0l@0pRp@- b@0`P \02loQ^Qb\@0pQP:  -P@Lh 1\ .p`T<  0 p`@A -0P@0@PPUL  t  0   x P@Xp`X 0 P@2p`@A? 0-L LP@\4 00A -LMO@U0S! -L M. p\G/ `P+P`0 `P8@0  KR70 Z p0SP`PU` K?@0 $= 0-H LP@0S0hp0 -LP@,M⌥0KQ0 @ ,@ WSO@S`8 RPRI*R4%0 0 0 s 8 0b038 b&x|@(8!8HT*@@*TI2@0@bePq8@8#8XU*P@*U@2 ȀP 0&@-O@d4xB 02d @-M0Ѝ@4=> 0 `+X -L MQ@0K00#  0 1 0T0P00S00#0 -LM K K!P -LM K K!P -L 0KM## -@@L0MP0  0 L0  00S00 K( KP(8N00  -LM`Rp @t%  P`F @pT`P0AS3 Q)0 0  00    p-LM @0`SPR0 S    0100p 0S Q0 S  0S0 .R@- P@0@ .\Q00Q0S@@ 0S0 .R𠁢Q00á?P R-LP`@p0V  :900@@@@@@ 0@-@TP Ž0P000 -LMp0 S P%0`0! @! V@2CP0@KPUN 0 S  =kꌑh0S 00Q -0S 0  0\\00Pk k k k l l l l l (l 0l 8l @l Hl k xtplhd`\XTPLHD@<|ܒD8`|(A*Q@-@Q*\?\ [\#\ q 30  00S+.10#0 \00S#10#0 \00S.20#0 \00S  \  0LS00S qX2  00S \\ 00@M \ Jn o o o o o o n n n xn n o o o o o o o o o o o o o o o o o o o o o \00n  0000D0\  S00000\00a \00b \00t \00v \00f \00r  R   ?\*\ #\[\ 0 \ #3 00000 00@\00M0 0qL00  0 0S-00 ^0\0?0@0\00s  p-LM@QP`0 f0p0  Q -LMP4 Q @pB8 | Pz*QP*Q?Q [Q#Q p10  00S+'10#0 Q00S#10#0 Q00S'20#0 Q00S : Q  0AS00Sp1  00S( \Q PQ T:`4P00 V Q 0K0  jQ@80c@ T4:@D`0K0  j` VPE  @` -@TL P`p T0g0 0l 0 e@DT -AMLM#0,0 3 㴍P@R ‘PPVBnK`F`F isP 0#S p ^` YP H*P 8 $P(3(3 0EP BKH H 0 ד4TU /P@ 0  Ǔ44S`2 ,0S t,hB^KPEPE\ 4rP 0#S 0     P { ``` P BKH H 0 @臓4dVd P 0 @x44SUBNK@D@D +8 P@G Ua0S  P@0S3T1 ꄢ0S㤐 }0S  w0S  q0SP kP<  `ꌑ,TDHxvLlv5nr(k -40L R4P P00 0-LP$P P$@ -P00 0-LPP P$@ P00 -LtM@0SK ׎0fP H K 0S x0@: S0 IO000ꀎP0ع -LM@0S鲤00 P0@-@P  0S ^ 0S^0 @0S SS00@00P0 -QLM@,0 oR P4 h 000 h 0p` V Vᘦ%i:$,0P  0\0 p` V000S00 YA080 4 0\08 0\0I` Vp Vᘦ%-:"0\0p` V`Wpᘦ%$ 4,0P 0\04 0\0Y4i @,0PP`@,0PP`H0 0U*Q*M*yyH* -4LMQ<@ 8#8Q8:0Q 4 %*0 0K Ġ̌.Č#̌ ! -p-LM`P@>KC/JK X1 0Q ,Q I_?K A xA D0 bKd1 t DQ mU 0S fp錑} XQQ*vv* 0wO -0LMSKK 0 00 zP  * 0-LP>H0 0p@ @ HPtT0%H0S 0  ==*ii*0 S-`L hCOH00::*))* -0L MK, K 0 0 0 P 0S$00$0 $'SSh* -LM KPwt@G-QMpP`+ @ 000 ##2 2!?! T0 pGJ0 0 ` 0`W`0`W/ 0S 000*00 R:0 "##2 2!! P0 0d `W0` =00 =0`0` V03071*Ѝ` -@PL`P p20  00S6 P=P UUl l ؂ P p0 0  R P=PP Pp00 Q PV 0S=P qLP U񟗽` ȃ V X*0g10PV  \*0 gB2"0 PV  \*0 gB1#0 PV X*0 g00P` 0-LM0P [[@[0[ P@00A* P0-L@ 0S0. @ 00 CR0S/S& R R0R/S AQ0Q/S0aP U*h@ $00F@?00/Q,0 @  BR0/S * 0-LMP@ 00l#0 4b14c021b!*9  ꠊ0᠊ -L(Mp0Q@ 0 `$ @PK 0 # 00 \ 0@0$0 @0 <0 80 40 00 ,0 (0 0 S ( .dAP@ꌑĔ -LMOK MLt t@Nt , p ``P:@E Z? 0~Q5BNK@D@D0 S U:0+bpW tڎVPUo0E@VEW@ tpy,0 S |,cU>YVKAAp R>K0C 0C`,ꌑД 0-P@ML0 00 -LMX0@K`P$0 p_ :3 $0S $c錑GϠ*""*jj*++** 0- LM@P K0  04p0..* -p-LMPU/ @0 㬭 0P0S0c 0C`PU 00 00p@ K$ K(0K ( P @ PP$00P 0 }`L0@,Ĉ77*88* * -LM^8K- 7<K@ K0 <0 d=Ep` P" PDK@ N `@KMvsvD@K ? @K70 8K&4$ -p0LpMS`K} } P@a w:?PPp 0000y P  b 00  P@0  R @H@0ZP0  408@@ @p(@,@0@<@@@D@- H@00C 02+ J 00C$0G Z  (0D 0L00 0 PP G 3  "@SEe -L@ PR*0|S S D R*0|S SP2 R"*0|S0Z0  g0 fpC" `~  e 0p`Z   f  g md  -0L@P$ Dp`0XR񟗎 ؖ ؖ ؖ ؖ ` ` ؖ ؖ < ؖ ؖ ؖ ؖ ؖ ؖ ؖ ؖ ؖ ؖ ؖ ؖ ؖ ؖ ؖ ؖ ` ؖ ؖ ؖ ؖ ؖ ؖ ؖ ؖ ؖ ؖ ؖ ؖ ؖ ؖ ؖ ؖ ؖ ؖ ؖ ؖ ؖ ؖ ؖ ؖ ؖ ؖ ؖ h p ؖ ؖ ؖ ؖ ؖ ؖ ؖ ؖ ؖ ؖ ؖ ؖ ؖ ؖ ؖ ؖ ؖ ؖ ؖ ؖ ؖ ؖ ؖ ؖ ؖ ؖ ؖ ؖ ؖ ( R*0D  D D@ T 1   R*0)S )' T 1H   R*0)S  E R*@*0D?TS{T 0S*q,40  00S 0W0+T 6*T  R*@*0D?TS{T0S*q30  00S  h 0 f   f  f 0  ft?TJ {TF pR*0,S) @ 0D R*0}S00 \  *0}S  R0 *0}SR*  00q(20  00SL W@  0 f :  f  fU"  AL    f 0  f sJp  (00(000000 0     R*@ tK  p(00(0 ,00,0 R*q000  00S  ) -LM @R *R: < R: -LP@\p`P*0^S+ \0` *S*0S -PP0SU0 S 00C0 b (00(00000000 T (00(0,00,0 -LM @P`\U  L4U .U *U  Q**P^ 0S*\P $U 0{S00 `R*0,S+ P 0Q*0S*0\S  Q *R*0R\S 0}S k g0}S000S0 *q20  00S\VP H 0 h00   h  h 0  hVy 'u[U< JUq0D  D D` V 1   R *0S*0\S \) V 1H  Q*0S*0\S C0)S00>0)Sn6 0  1/ `+0U# >E0CS <0pCaH0S  M H 1 D 0H0 L0U 0R*0 0\){} 0-@PL0\*ql0  0!0S T000@CT00^00S 0 x -LP0SPp:tP` P\&*0^S00p\*0]S -S \0* ]R S*-R P0]S-Rx \*0]S ;0SS 0 0@SJ0  t0d2  00SH@TZ 0S?W"  0SJ 0 @@000l 0\0Z 0  00 0 B 0SP u hp hHP  000  00 -00-0 -  Pz00 -00-0 -  h00 ]00]0 ] h PP & P0S.*8  CP( 000<D -@PP050#-SL [S0 :Sa =S1  pR*0-S `WW  0 00 \  X\*0]S -P0`0 `0S0%*00-S]S P*0S*0=S .0]S00$P*0S0"*00-S]S 'P *0S*0:S 0]SP*0S05l:o h -LM @$Ap\ *P q00  R@ `ePi kP0S PP PP  000   PP0S 0PS -LM@=>0 00  0- LR@%*0S*0[S 0 0.Q00PQ*0S*0.S [00]S00Q R* -PL@  R)* P*0PS 0]Sp`ePV , P0 R 0SDpx0   0 R PX 00p , 00  RP Ȑ p-LM0K KP` 0 ]0@K0K KeP`p -0L `@8pP Put00  00S P h =0S04  4  p-LM0K KP` 0 ^00K K]0 @0K K!P`p -LMP`@p0SGT1 T00W0 W00Si0 8 8 8 Ī Ȫ \ ` f 00   f  f"  A   i f0   f  f"  A   @`pG f 0  f  w@D q@D`q0 S 0% - L @P0 00T`%^  R ?>1&,1D #@0 000:0@@ 40@ 001MP 0 EP 0^ ?>1  ^0 f Jp@-0`@  ^R *0 00  n^ :0E\  00C 0p -L M, p0 0 S@"* 00T0R00S P*`P0 00 R0#S P: P @ T:`@ T*,,0p-0 R*0 R:@-0@P*0  \: -LMP@p0 000`V@  ` g io 0S  `i[- 00/>\ 0S0\ 0@- 00>Q\@ 0R0\00 -0LS8p`0S PU`P 40PU040@0 S @TP -`RL@PpR 0!000 p-LM0@S`P 0\ 0  !p/ p-LM`\P p@  A 0S0 0H0SHP Z  e! B 0A0S 1>3 01 0-0@SLP0 0S @ 00h 0-0P0@L 0S 0 0 00 0- LR@00>#R0 (R" R @0Q@PR@P0uP< @Q >3SAQ 00@0QLR RRL>31>#R R "RR R(00(000S0 0>3S S S\(00(0 P L -LM 0R  @T p0R000PP P<PheE*** p-LM@ 0PP! `@0  Q,00R0  0S 00S0 ^ @ 00pL -QL0 M4 0 0Z000(K00) CPP9 0 P0S pЀ`@D0S@ ` <P p WW0S 4 R 4 000Z0 000S40S 040锜LT*P* -LM`tIPPdq 0SL0HH!p P0P00@(K sP(0 R 0SMR- $GR R @Qʑ TppxKRdpKXpAkR gRmR,pF`#:%}(#**uu* * -LMa0Sp7PQ*0 2cR؀@P02c2>0P   0P"`0S00@ P PT%X%P%  10BS0)00 00 0 -LMp @GWT`P W6Y4UP00h00C0@` @@0P00 R0pp PRh 00@` P 0h1 0C 0 -LMP @EUTp` U,Z(V`00hE00C0@` @=@`P `h 00 @` ` 0h1 0C 0 0-0L)SP'010CS#\ 00 \:0@S0 0P*KP0000@P000 -0L)S`p%010CS!\ 00 \:0PS00@T *0S P@ T:00@P000S  \00 0S00 Q-0L AS  00 P  1Q0C 0 -0LMS,0 p`@2Y00DTST* T( 0PgP` PU00XQW Z@@ Z@0 J0 M 0@C,00 0@ -R0B0LM@@^ T lR0 0 R B0 0 $ 0-L@ P@0 -QLp RP@@T*`0S@ S CP@ T:00 6P `0g0 @  -LMQp` RP@@T *P 0S @T:00 0g0 @  0-@L P@0bbq*m*i*e* -L0S 33 "00V:`NP@ `8%0==0` 0 @ a0AS" @0>0@0 @ C. @ @00p+WP -W=W@0D =W << D @0 0X0C S񟗖    IPI< @\  @ R  @0<@0 X V:H   ₑ H P@N  j 0`@C80@ `< D0R0+W00=WSD  V:H   ₑ H P@(  j 0`@C8@ <0X~ `< V:H0 0⃑ H0 vP@  j 0`@C8@ 0c` &XD =WRD0=W0VD0 :H ⌑ H PP@  j 0`@C80@ =`< R V:H0 0qH0 4P@  j0`@C8<0X@ !`0S ,S 00 Y ꒀ;I9 l2 0@'͌@ d2 @-gQ@ =Q +Q -Q \ XQ0R0- 0+oQ uQ\00@ ! 0 00 0 +^00 -^00 =^000 0@-P 0+S -SXS S5 0+S -SXS @ 0-S" +S XS00 T-00@P^+00P\ X00P0  @0  @0!![* --LM p-P0LM@`P8 4~T  帚 1O`Lx@ - 0p@L` GPP0S @TP魌@ -L 0SL'$ 0-0@SPL((Ov 00 00v  0-0PS@LPP PP0vP -LM0`Sp (KuPP (QC 0#S@ S> 0 S RA(  #P0e(0 (P@} ( (0PPwP@ P0 S S0 S S wP0P0,K w,0S ?R0Sp0PB U 0@S  R00 RZ@ T 0S 000 ! BX @wP@ rPP 000  b00@N00@P0uP 0V, $0$ -L>0S$X'\\*;;* -Tp`LP6_P@ 0S 0S0S >8 -p`LFPP NrP @P FrP 0S0S 8 0-@P@0LS00u$ 0000Nud'08 -LM(@0S0 @00d'8 -LM0St (K xtQ@`Tg ( 0 S RL0L(  S *(0#` @Rq 5PU`@0S0T`ÅvPP `0 S S0 S S vP@00TP@ 0U ` 0S  R00 R@@TP U 0S |00x0V:\nvPP 00PP@Ņ,,wtPd'h'l+,|+,0@-Mp` @0\@X\x\@ Q $Qq0 0  R#0C'  Q .Q0V42:ЍQ q00  00S 0gC R17 1RTq00 D R q0 0   Ra0LA0L*2*2 -PLM@` %/00P,K0K 0, ( PPp VT000Pp  0 PPp  r.0@l.@p* -LM0PS=S0 0S=S=S/e( K+P 0 (0Q @0S 0S0x0cC a\P@Pp 0S J@@ Q0 0 .00, -L M0`S=SpP@ 0S=Sf, KP) U ! P,@P 0 ,0R 0=S 0S0 0=S=000 R0 @0S 0Sh h00cC1Q00 P@ 4 0S 0 @00@,0 00, -LM0@S=S0 0S=SS`pPd `K vP  0! 0S0 .0 0 0-! L0TT!P@-T @@ T 0-0 0, , -LMp`Pz@匀T '0S0d0 @ȥX00U@ <:e(`]"Z-,, -LM@(L@T0 @E,   B00! Br B0r000000000000000* *-  0Y,,+!00@  0 --LM -L@`pK-`0 XXP]zT  8?8 $0͔z  LzK`Lx@46 0-LMP@ 00* 0 ?0-1pQ LR@` 0S  P @@ ጹZ0@< k0 000S@8,85<5 ?0-1pQ LR@` 0S P @@ XZ0@< 70000S@L5L>P> 0-DPL @R 0R2@0QL ꈑ]]&*a`>*3*3IϠ$* -LMş !  \ ,  T 6 @01@ T!0R1 p! a 4@K K 0  K  K,K  K K K K KV0 \0 x X0 T0 P0 H0 D0 @0 <0 80 40 00 L 0 0 |0 t0 p0 l0 h0 d0 `0 X0SH T0SE Q ! @ 0pCⅠK  IP.0[  R) R' T*00K[p30  00S  Q"0000ӑ0K[ Q"0000ӑ0K[00+L0pa XKK, 'PPK K |K xK tK pK lK hK dK `V'@1S@ T!R'W xp1 ,0S p,I+p+2T 0DS   KPp|+0S ?p 8NKP(KXKL00L0 60[S0X K60K$+Q+00HP` D+ 0ꌑ? Ȑ@p6 0`?0 !? -L0Mp0P 0 `@ LKL@KD00D0 Q Q +00 0 S 8 I, Qꌑt,t,t,: Sb0 d Sc0 ] Sp0?0 0r0-00w0-00!=@SL CS-0> X! r0-0 0w0-0R00 &R-0! !r0-0 0w0-0R0 R-0 00 0 R 0Rt0T0x00 R 0Rs0S0x00 S ! Ss0S0x0 Sd0 Sl0  S-0 Ss0dd**%*%KK*oo* *R0S 0S0S0  R00''* -MLM00P 00 q 0@0A   00S*W00&0@0P P -QLMP` *@x1TX l1T 0S U:0S U  PP0TpW1 0RY 0@RP 0T 0R T0@RP XT0S#P \0 R1PPP?*[!]:- p-LM`P P0PEuA PEP@u00p p-MLM`ANK@D\P@D+ xw 0@  0S DCp6ANK@D@D+_P ꌑ,X -LMM|pANK @D0@D`P+ 0 HP 0@ $ 0S  C5ꌑd -LMM|pANK @D0@D`P+ 0 P 0@ ( 0S  CuBꌑl0PP0 Br 0 B\0 rp0  0p0  00 P Sp0  0 p0  0p0  0p0  0p0  0p0  0p0  0p0  0p0  0DP @ 40 R00CS00Ӥ0qPꈑR-0^0  R R0 R0__L*H*AB*//>*aa:* -LuMp0 (, 1 DP`_ ?PPQ 0@p1 0$P}K@X{K 0oK. ̡ ȑ q uuKU.P! 1@p@P oK 0 ,0S ,mB 010SD0 <׋ 0΋ꌑ|txP0ᐏ -LbMȠ0JK(0 Ddp! @)@KpZ_K`#$Pl0 \ TjKjK11 P 0L(0 S (B錑 -$0L!00  -LMp 0:S "0 R00 02"00 R2 0:S 00 S0!d2 l2d"X2Q  ,0:S DH<",@0:S:?0 "0 0 R00 S0101! Q , 0:S "!,@0 ,0 0@|-TT0 R, H1 R , 0:S 4$1?@0 R0000Sg0S4@0 0q0  0 0 a0b0000d@h d0qTP0 @P0s0`@P꬏@<`#} -LM 0c -L M@@Y -L M@@O*tt**PP***33* P-L h /00 -PL`0\p \=|# 0 0  R3 @ ,xh P1@rT%0\ \|`3  00SWpG3 /\00\0S@.\ \|3  00S0 0/\@- \ V t0j T ڊ>j1!W pG T (00 0S @S@S@@@0j!T@QQ10  00S VЁP@ wh1 P@ T0\ \|x1  00S`\!\1g0XSxSSQPq$10  0D0SG W0P 0\6 \4|00  0D0S+ |  0 0  R \ 00ӑ@ \wdP`a\ h000X0 WpGm 0002XpGJ̤(< -LM0  l8Px -L M@ 0@k(|xRRg*ZZc* -QLM  0K  0    -CML Mß@T, PT$  ` 0S  2 S 2SLß,0 S @,<X 0UX$ZW 00\4 P" KII2C.K B B 0P L #p <x P < a0Sp SN T4XS ( $XP BNK@D@D\ <]P RPT Ԫ \T$0`sP X$\ 塮PU ,PTX4P \T$0$P 0S0S  R 0s RS0S `S R 00S<4(<"4!<"RR`#< Na%48<_K#8X Q P030#? P* ^d*ꌑttD -LM젟OKpP <, P  0S`& 80S,0 S p,;KK,0 P @0S  .%0 0 ꌑ p-LM@\P`  \ 0t P030#?p00S SU?P ph`00SꜴ -LM` 0p@``PP0SX uP @TPNx@ - L00Sh@t  p-LMPK@dP`P R 0S Q@`f `p0UQ  ㅩp -PLM@  Th7/00h -L M⠠p@P8`K0 (P Pp?P030#P0S  L (0S $(:00ꌑ -LdM0p ,  |0 x0 t0 p0 l0 h0 d0 `0 @`P|K 0D0c!1@#T!pP@1SuP``@Tu w Vpw Xp.K\0K S\`K@*wB T@0T=T4 V0#03@T00Sw 0S 0 S*\ K0b@S@\K ШL1 ,0S 8,O:<00 R*:00` R:0305`1:T  R*:00`T Pf1 ሄPP`WX Xh h0R f P `uw w VpPoꌑ  --L]M qPM?KC/`KK \1 4Q 0Q  =K0K0u0S cK|1 1  x p@ 1P|bP 0S L 9|1S00 00$0|1 ꌑB --L 0-<0@ PL,,hT 劄 0h`L@x -h0LM R0@ CR 000R TQh4ꈑ 0-0L@P 0SP00S  R 1S010 CR 0P0 00R P3 0 0 p-LML`0PS@ 0PSpꈑ 0-00LS  R@P 1S010    RᇙP $0bPP00C0P0P 00 U00S P 0 P 0 0 -L M, ,P0 `@ t00  R-T0@40  +T4 @VV0TP V0T ``r^p$t0 0Q0@Dt0 0Q t0 0Q7 DW D@T\ W00 T00SG' sp"00@40S\00pgS \,00E0XSxS@`P 0-LP@p Pp U T 0\ pP XURU,$먿t {{*MϠ4* -0LM@`(PP0 0$@ $0 P tP@5 dP, 03pP1XY(ʐ SP p 03$0 Y   U< 9P$00$0\ GEC  p0S $  @TD0 003$  |3S03Xpp 0SW,0p@,@ ,@ 00s0 0`#, -LM( Dp$ ` /U&PP P Pl@ (@00 00 0S -PpPL 3@S0S0@Ⱦ3Sþ$0``PP巾ᵾv p2@.@駾 -@LT` $0* 0QP3 Q# R 0PU@G 3S3 3S S  $00 S/0/R@0( D G P 3S 03$0` BP3ա 03š0 #0$0@dP$0 :>$0P;3s7 0$ @Q$0@ 0 S003AP $0 :P3 $0p 2P  0@@$0 @2 | @@_Q $@ 0 0R 3 P0 3L00 P  *PP$0   30P0K0 ?PB3 03 PU 0  PU:$000# 0B8S 3S  $0H |P3ԡ 03ġ0 #0 ,@d R-#L 0 0 :Q0-Q@@TLP`?p@$0 5C T TP- U$0P:$03PS0 /R $0@ "p $Pp NP;7;00, -L,M , 4 `PZ , R0H0  $ 0S0H0 L C ,0H S@@PRP @ @0D0 4 $$00 S/RA  0T0 /00TT 4 4 Y0phP0 00 80 <0 Z !5PP $0 0.S  P@y Qc*  00S$0I:@ R H0S   #400000Q8 8@ @<00@ 8@ 0H R L0S P P $0 0D00$0D00 H Rں#0B8RSH00CH0 0( 0 DTKo0 4 #$0:$0?00pzP  W $0 P T 0phTPG0X 4 #$0:$0P 0S[ 040. ScU PQE$0 0< RXT00CT0 T00D R ,0<QS4 3S%$0 <0S 0<SQ00< 0 ,Q4 03<P 4 #$0:$040 0a0( 40WP D   4 @3D 03R00 @0 }DJ400420#4 0 BH  L ,0S R4 #3400@d -LpM$0@0PK@P0J 3P10: S S 0  S00D00.S, 040  3S,0Q  3S000P0 E0S D040. S00`mPp` p 0 0p\P 00 -0LRP@` V P  0[ @T` 0@T000(00DPpPpp -LM$0HPPp`*P@ 0 B$ 0I00D @0(` 0 -PLM@ @T 0-00L@ :0S00S?0 00ʺ0PP 0S P꺺 R D0P00c00 R3 SD0Q00c000S0 3S 0-@PPL0 0UP1S -LpM$`@P R KcPp 0 0R, 0R p00V@@eqp  9PP -P@0$pSL$0  0` : 80S2h;^ 0S Z V ꈑ -LpMpp`@ KPP90: S. p$ 8-P@ (0 0P (PP 0 P彔D0@000P `p$PPP1  a0 0 -L4Mp, W, Q8 , R0, & BX 0BX0 嗃#(R@40 F P14 P"`Y 00  Y  0Q0 X`P&TP @0P UN PUF P 0Y80 00  Y 0\0 `g@g' 0\0 Y 00  Y 0\0 P@g8 ' 0\0 8 RR 0 b0hP,0P㗃#40 Y0`8 0P0 4@d0fgP!P Y0` 0\0 ^ TV4 , d6O  0&  0\0   0P0 ,0T`P0 0V*@T#Pg PY 00  Y 0Q0 @' 0Q0 P`0V: 0Y80 00 0 0  0 PY0 0\0 0' 0\0 ' 0Q0 4 4P4 P4 40P01@<0  <P@ Ph PZ <00cD0 @ <PP? P10@4 ` aH <4 HPa P4 P4 y4H H 4P4 PH4 40H P D D0P0 PD D0P0 P   P P  `0VL *@T#Pg PY 00  Y 0Q0 @' 0Q0 L`0V: -LLM` d d@` @d@ h0 \`K$ h0 PpW:` <Q U@ * 0dR @T`05<5:T 0 00` 0 0Pp$0(0,0 0LPP d0S`@H0SW 0 P0P00 d\ Q D0^ "0D0^`H0S0 t `0L R0Sf R0S]  0_P@ E U 0 CPU 0; HP@ d\ 0hc/0cOdP^*hP@pD0^ 0  d0^p@P:PPܶڶTPP\ж `@L  0%0DPc`H0S[尶家`@0\ yxPPp -L M@0TP 1>3S S 0P>3S ? S S 0@U S SS S 0P` 0 P Fp, @E  0@ PP, P , 0@S8 S !S 0P` 0 P Fp@E  0@P 0 S S 0>" 0c O 0 > 0c" 0P` 0 P Fp 1>30@C0  @P @p1>3@!>#"R@D 1>3PLSJ1>3P!># RA -L$M@ ,@ 0 p RP`A>3S S  S PU00^ PE0A>3S aSV 4S1>  0 0r% 0 @Q00dS0  0dV0  NwP   1S P1S 0sS ,1V >3,@0ca0 0@P@D ,@  ,00C ,0 ,01 , `{S@ S > 0  0cO0K ,@00 VP000 KS>30@C 0,0 @>P0!@># R 1>3@!>#"R@D 0a @ K> B000 K@K ,00Ps000,00 P>30 z V  VR  0R MS S  V`EV V@*0 S=090 0V V0V5:-0 SX S&S- S V$ V*  R rlA 00  R _Q 0VV r, 00  R_Q00  V V*0V S VV r@ 00  R_P V5:00 PA >3PA>3 S>3 2 V  0| -LM0Q, `Q0 AϠ lp 0 4 00XP40`l ^0p U40 @  U V  Vs T e42W  U' u "0 0Q_U  V v 00QF_VD  U u!0 0Q%_U# A?G0CS >2,0X  R 00  @P4  0  @0W  V v 00Q_V pp0  @@DTʎ0 00\@\ d0Wpp~ 0w0r ,@pn 0g -LM, 0 0Q0 `Q0AϠ l040 0PX`lp U@  U V  Vr T d02W  U' uŸ 00Q_U  V v!0 0QE_VC  U u 00Q$_U" A?G0CS4 ><,00  X^4 00  @P40  @E0W  V v 0 0Q_V pp0  @(@DTʏ0 00\@\ d0Wpp 0x0s ,@po 0hG-Q0`A $ P !>3Sy < S7 S S S Q@3"Zp0   S S0ZS S S0>#0S S S S "S>0!># R0p !>3 S >3 !>3 S&S S\0X0>0400 S2 aB0L~ -LTMd h h@d @h@ l0 ``K$ l0 PpW:d <Q U@ * 0dR @Td05<5:T d @@PpP$ 0 0( 0 0, 00 000  4  0SPP h0Sd@H0SX 0 +P0P00 h\ Q D0^ "0D0^dH0S0 y d0L R0Sk R0S`  0fP@ E U 0 FPU 0> NP@ h\ 0lc/0cOhP^*lP@pD0^ 0  h0^p@P:PP$ TPPY$ d@L  0'0DP^dH0SVްܰ$ڰd@0\ rPPKp -L M@0TP 1>3S S 0P>3S ? S S 0@U S SS S 0P'` 0 P Fp, @E  0@ PP, P , 0@S8 S !S 0P` 0 P Fp@E  0@P 0 S S 0>" 0c O 0 > 0c" 0P` 0 P Fp 1>30@C0  @P @p1>3@!>#"R@D 1>3PLSJ1>3P!># RA -L$M@ ,@ 0 p RP`A>3S S  S PU00^ PE0A>3S aSV 4S1>  0 0r% 0 @Q00dS0  0dV0  zqP   1S P1S 0sS ,1V >3,@0ca0 0@P@D ,@  ,00C ,0 ,01 , `{S@ S > 0  0cO0K ,@00 VP000 KS>30@C 0,0 @>P0!@># R 1>3@!>#"R@D 0a @ K> B000 K@K ,00Ps000,00 P>30 z V  VR  0R MS S  V`EV V@*0 S=090 0V V0V5:-0 SX S&S- S V$ V*  R rlA 00  R _Q 0VV r, 00  R_Q00  V V*0V S VV r@ 00  R_P V5:00 PA >3PA>3 S>3 2 V  0| -LMp, 00 Q,(P4 0 8 0 Y}0000AϠ0 P0P 4F < 0Y04 `o<0P 0 V<0 @  V X  X T sp2Z  V' v\ 00Q_V  X x$"0 0QT_XR  V v 00Q3_V1 A?J0CS$0, Y00R0S0 80 40 80P1P<  0P00 P P0Z  X x 0 0Q_X 긠00 P@DTP0y 00\@\ d0Zo 0h0c ,@_ 0X -LMp, 00 Q4(P4 0 8 0 Y00 000AϠ PP< 0`Y V @  V X  X T 00 P@DTP82Z  V' v$"0 0Q_V  X x 00QU_XS  V v!0 0Q4_V2 A?J0CS$  0<S 4< nP ,Y 0 80 40 80PDP< 00 P8P0Z  X x 00Q_X |0wX0X `0Z@n0h0c,@`0YG-QM@p(,P >3 S C S> #S S S P@Ѝ3"Y0   S S0 YS S S0>#00 000S S S +S "S 0>00 1>3 S 0   0S0 `>3 S >3` >3 S 0&S Sy`0\00 >00`0 S00h0S0`@Cca@-M ^@ P`pX\ Ѝ(@ \@Ѝ@@Ѝ@eE11ﳭ* -|4LlMHK0 @K0PTe/ ر@ \ \ R *0S0\  \ 0|S :S 00#@#@: @fPX00L K@X0pL0<P K@(0P0T K@00T0X Kx@,0X0h@\ K40PP\d K@@{p00, d0$h K@80qp408 h0l K@<0gp6[>p K@4_p7[0t K@4Wpt0:x K@0Opx0,K: 0| 0Kp 4K. 0 XRxR @@00 :S0-LP 0:S0@0[X@0 0-DPL @R 0R#3@0 ꈑH -LM K"帰vtOOw*s*$$o* 0-Lē@ 0-L M@֫P 0S0$ (0  00K0@  0  , t@0PP 1S01H K|0@ST 0[@Tꈑp6  BB,*A``&* -/LeM0p @ lK,0 -p0l p `b?!0@?PP@ ei@Pn ?0S:@P?0S: -L M0pP,0   b!  4 KPU ~P`0  R `Pp 0  RS4K (,0 S ,Sꌑ 0-PL@U 1  b!1P\ 0h髤0##n*(h*(a*Q0 : 0:$hhQ*$%%J* -LM< 08 rSwS@T 0 0 N, ,0S 4KP}2 Rvp@c P/ 1 R(< 0rS <0TP4,0aP, @0S , 00,0Q0 \$P 4TP0,1@T 1 R0$@T< 0rS 04P 80sGi40@4T ^/P0 R40,嫝 {(,塝 qꈑ$B$L p-LM`0PS4 @T 0S  @T0SpT R00000S S`K pP0S bup ꈑ$B -0-LMP0 S@   R1 00 cQ  R!,0  0S 0錑 -0-LMP0 S@   R1 00 cQ  R!  0S 0錑 -0-LMP0 S@   R1 00 cQ  R! 0S O0錑 -0L  -BMLMh#0P,0 0L4  0S  00,3 ,0S ,&/MOPL$H$ K啡2P@@00 cBK J JH 傃MK@DPpP 0Sr`0CK0A S A P2D4 H2@ K0C0C0  A  -00C=S񟗗0 S  1S!00 c0&w pC0L4 d]PnL$R X 06U0S3/ꌑȦ}|7Ll,ЦܦL$@-@^  0 S SS00N0J --L '_  0-LM@PN0S 0mP0S fN0S  `N\ 0 @@P -LM@`PdNP pW孞W0S `U @YT :0S J000@0PTP:@T TWRPP  j 07]x -PLUp`@: PP@ U:` `       --L p-LM@P`\0X T`rBT < T^000 \B ph`B`L@x46 -LM0p@ LP 00 00B S0`Ba0B\W`BA0B0S7`B R Q\S P Q'l|l0U0P:0`d00c0CV0`ąrppp0d0C0pp -LM 0@Q`pPT*.X0 R0""00 0PT:400 {u0 SP:00(BP 0000ӑȐ -(0LS@: q0S4r   P0` 00 PUoQ <0PUo0S/ R 00cPo 0(p`P vgp0`P0ꈑ -L* ܛ* -2MLM#0@,0 E0/S  P BKAA 2+ 嶀p Y W3*WY 0P/S00@83 ,0S $,(/ NLP<P"P@aTnK`F`F ឞ0Z0pd  P 0 S/R  Rm/0 0 x2(K RW\&LP L!LP@ Y 0C/0h@+#A!PBKAAKP@L<: S< S0< ?nK`F`F!᪫PP|1@(K /R@ Y!Z 0 S/R 0 S*>K0C0C/  +@ Pp* +p?00^ 0@C/Z0@hu>0q0SZ Ii, D\+>00S8 B>K0C0C+< !ꌑ ,@d p-Q00P00LMSP@`P 0s p高p[˗P@`#00p 0S S* --LM  -LMO0S, 4# pP00S  R 1S018 `< @TT/03 tX?   0 R 0S0q?  0 0S 0 0C`0~NP %T& 0S 0S0 0C` N0S 8pΟ,0 S `,QYNP 8#R 8# @pzT񟗏pppppppppppppppppppppppppppppppppppptpppp@pppppLLLLLLLLLLpppppppppp`ppppxpppppppppp\pppppppppdppp$Hpp\p 0Sas 100Cn@ 0<3 0Sy 0q;  0 0S 0`0CS0 ʠMP ETZ  @ T *000MP d X* `0 j 0 0 43 0P438C0@43 `8C Z  KK @0S 0 0CZ @ S0 RT `JMP T4#0KKQ4 @ 0Z0C0   0S 0 R@X 0088 MP XZ @&43 @4# 0q9  00S 0Z0C0   0SLP 0d`83083 00K0q8  0 0S0Z0C @0 SLP 08JZ!3Kg @+0DMSa88tLLLLLLLdd<\<  @00CS0000YZ N@XXTxTE ;; 3K<# 143@ 4C  43 4 8C@8C 3K0l`@43 4  43@ 4C  43 4  43 4 43 43 3K<#tH 3KXX  LP  <$00<3 <00S<3 ʏ< Q  &3K 00X< tp4JZ!3KL @+0D:SF00@LL@00CS0000BZ  2@xeTET) 3K0a<3KR -K 43 43 @088  43 MK 4 43@B44 c@x3KXx[3KXMKP    9 S9;KP @< tKKp@m@j@hhP@< ^倐lP i 43 @4C `a 43 4 `Y@43 4  43 043  43/@4C A 43/4 43 4 `2"@ 0@zꈑ̐ @< @" <# t80  0@P @[ @-^R  \R n-\ @\00]\0S  R\ A]\ -LM`P 0S=00S  R 1S01 R0 0W@,p  :000PJPpd`@W * 0g 0S /0S,0gF$ꈑ -L|MD`h P   ? @Kp  p@,` @ ,0 -SE@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@ , 0S@@ ,` hP,00Q @ K@0K00SV p/Q|p 9Q10Z0C10Z0pC, /Q9Q0x Q EQeQt 50 ,`P, +Q -Q 00A S,` $0Q 10AS,0A, /Q 9Q , 1, 00C/Q9Q,0H!0nPSUt ` t Zl  p0SI0A%S񟗅| | ,@KX>yPY ,0DC, 6yP,040, @0 D MhBN\HP||,@K0yP5 ,0 (R 0@0 D0 0`L KzPH0L46|KR  at x Z ``S~X@@K V0 HLiKB~WP@ K0 4@0KZt 0f@Tl |P T@ K I@0K@B MT@!"0T0@ D 4勈剈 ᇈ先僈DBTl`qqP`@ @K @ KTP@056C@0 @@K @K @ LrL2pWX2W\256@0 D @0 x 0&xP @P  ! K@KP KT0KvP4 ҈P tP Ptl0@T`cppa@R0p@b8#PCUCn`6``l@ @pTPPUPUepe@eQ Pq 4專PPl 44P W4^P4 a Zڌ P Y TڌNP Q X FPI 4吉P C 0  0sPP+  w/ P@yP- oZP@ d`KQuP/ :@ 刃l3X ljX00\00S / yPa00hk60@ K0 @@K0 @ Kl0@`rSpX 4僇假 }-,}0  ZP@D0S46S$ / kyP/ jxPl@T 2 X0 \ @K\K DK!@0 R"00e/ HyPPpp|WP@Zᎆ O/ 謁P@@K\0K5&B@ @ Kv0 ā@K0 藁@ K@0 0S56@0 { X0S 0@ D0 {\0seZ @0d`K0@D R@046S2 R# p@0@d`K/@?A5?55?5?AP9| ??@0SO@ K.0S"00,T O xP p O [P@ @O0Z@ @ 46S! D@ Z @@K@K0 @ K3@0K@@K0 @KG/O  P@!gP"l DR0 ljX (:k0c Q@ 106@0 D s@046SDQl0S @0kP7Pʊ@0 " B ::ZD0S@ 46SP20kS0S0Sڔ㒇P ȇP@dP @ K @0KDB TRjTl S@ @ K 趀@0KTPl@T @D30#:k`cV VD0 D 4V0 F762D @0 @K/O fPysP5t@T. "TPjt@0T*C@K t et z`PtDKA `p@ K@KH t0s d@@KL v@K / 0P@*. *,0, 0Q 5P 0, )0PS  0PS0S ,  Zp 70Q- 10AS,0|@ 0A@0 ^@ |T| PDZ!₀1ZpPUZ1⃀Z1Ѓp@ , 00A S 0, @0Q 0A ^0XS xS  0, 00S S@40K,K0 Kr0SP Sx 4 R<@KDK0 0#n<@K]u4S} `, u xPP  u@@ A 0-P0@LS t@Tdt 000 010000  H0 000C.0 6::"00 -RL(M8KDKPp`T@ 8@K00,P  <0KTk@ < 0M0 t00 C\0l 00ЍCʠ\7S< 0Ll \!0 0  -LM, ,D0 ` v00  R-V`<  +V< `YY0V Y0V <Q +. 0@K  0O@K 0 K@@K 60KP@@K “<00 KSP T@0PiPepv$B 00Q0`Fv  00Q[ v 00Q7 FW F` VM\< R& 40S 8@T80 W V00S Ng"00`D@ 1B"@$$pSƏ4X004 X 80W8@<0W V00S pD@ 0B"@$$pƏ4 X000Q \,0 J00 K\0XSxS`I -LM, ,`\0 4 P u00  R-UP8  +U8 P4 RR0Uv 4@T0U 4 4@0K/0 @K 1@@K< pu 00Q0PEu P!0 0Q4 u,A 00Q7 EW EP4U%\ X  W W0 < U00S p"00PD@ <B"D@p$$ŏ X008Q\pw0 R \,00F0XSxS0P40 ` -LM0 @0pP `冀 PP @ 00@P0  PP 00_0 ;0P`0@  `VZP p-pLMP@^ 1 Rl a0Se00S  R 1S010 0SpA000P0S  0S 0B0PB000 RpP 0 0R0 P0PS0@0 0@ <08 000B 0 BP0SpeP0000q5,R 0R\  p-LM@K`P(& 0 ZpT --LM  -LM0 0,0t2,2,,0P0||*00@- 0@00 00 vT2#Egܺ -LM1^0@!N?P1p@`eZp:U?ZZ o @Jy?Z@p ֐ n fpP -L 'D\@ @'(`@ ?0(LX\ @c@@ '<@<@ (H<@ [H@ @D@ - K(DH [P@ @L@ . K8DP [X@ \/ KX [@@30K`0T@ 0 KP@ L40K, 1K2PK 84K ,0(S(h ,H` 0-PL@U !", 1#80!"$ 11PX 0h鋑0 -LDM@@ hK\ p0(h0 0'00 * 霠 d0  (  ly 0)pgz p`00* 00H '臠\  )  $0( jX 0 0'00 * 霠 T0  (  x 0)pgz pP00* 00จ '臠LP  )  0( jH0 0'00p * 霠 D0  (  Lx 0)pgz p@`00*00)COH臠 0'<00) 00 ( j8  '  ܗ0* 霠 40 0(00w )pgz p0  *  0'臠,00)00pd  j0*00(00LP 靠 0)00*00(w< p{ p 0'0 0)00hh0(0 0'00টT  j0*00(00༖X 靠 0)00*00vD p{ p 0'0 0)00th0(0 0'00T\ j0*00(000H  靠 0)00*00 vp{ p 0'0 0)00셟4h0(0 0'00ȥ`  j0*00(00कT 靠 0)00*00uH p{ p 0'0 0)00\h0(0 0' 00< j0*0#00 < i 0)0#00ud pz p 0' 0#00Xh0( 0#00 ꤠ0*0#00औ4  i 0)0#00thpz p 0' 0#00dh0( 0#00H ꤠ0*0#00,\  i 0)0#00 tPpz p 0' 0#00샟D h0( 0#00̣` ꤠ0*0#00ଓ i 0)0# 00spz p 0' 0#00t h0( 0#00T ꤠh0  (  0 0 i *s pg{ p00)00舠T0  '  ̢0 ꥠ( ଒\ i 00* 00r pg{ p  )  l 舠d 'H0 ꥠH00( 00$ i   *  r pg{ pP ) 0舠400' 00༡ ꥠX0  (   i <* tq 0pg{ p`00)00P 舠D  '  (  0ꥠ    xjVp $ν|*ƇGF0FؘiD\"kqCy!Ib%@@QZ^&Ƕ]/SD!7Ç ZEogL*B9q"am 8D꾤K`Kp~('09|eVD")*C#9Y[e }]O~o,CN~S5:*ӆ*#*# 0-"  &# K *K0 K$ja0QT` @X `VP`V @0 0` QmV` Vl@P 0^- S`@0Z00 SU V`V 0`V0 5Q`M@X= P0`VP@` V"^- KQ  0S 0` V ` V^- KP 0S0 ` V ` NV 1 R```VT4(K R K0j c` KV$00 :K4`VXʈX KQP3(K RB 0^002`VS@0 P` P00@V`^APJ@3(  P 01nP00`V@DUZ,0 S ,0^ S0 S3K0(AA 0N;P2(K Rp" 002Sn-K( B B`0`V00Z,2( K0`V{KL@L 1` V ࠱1(K`V3K0(NN1 R `V1Sڄ1( K0V p \3K]K(N(PENPE A :K 0 K`$ V0@ Q0nK0(A^ A0 ⷉ0nK^ 00(A 㬉,dO Kwt`V/<7PT P0ꌑt Hq+[[@d p-?P0LMS`?QPPU1!1!^^M\@ 0`R p 0R 0R 0R 6P``0S0 C,S R-S+S0SS0SSP@-@  00L S 100C^00L S^ 0-LMPK@ 0P 02c2c20 :R 0 ;0P 0 2c! 0:S<0 P0 00 0-0P-SL@P +SP  U0 0c00 -LM0@JS: MS 00C S00 0P 0/S00    00  0qP 0.S 0fP 0.S 0 0 00 m E-P@p "22a11\3a11\p0Sl S  W02c2cZ@]E ;RPS J^P WXa  102c2c^S,! 1?0c0AZ1`L ` !Ϡl  B 111F/N!b  !@!A! B 0C`aR0B S B^ W 00T` 010S^ 02c2cS002c2cSQ*gfff$I -RLDM P\ ` N\0<S< \0@0cd0 0S TKP@ P00 `R <R `@ ~` @ bh 0S,S ;S XKP@ 0V0R00SD ;Q,Qv Qr@Q`PP001 R44 `b \\(0011 R\\̃ṣ01 3  RT0 0f   0R`c\Th3d Xa\3`T#L3,#<3  h0 Sh00 0 0 SM@ \,id h0^@ ` i@<K^P@ 0,SPKUP@ @Td0X0T8"0,2`$"$2nK}"2`p@@@0< K {X0@P K uT00@0000@01 2` 1 !3`1X1XT! 102c2c3 S}00KSTwT0>CX0 @>`@ 0@>S`@nh  T0h 0c0h 0d U>\ f0@>S\ @ bd  d\@P0` ^!@d T 긪ĪQ -@LM $0S h{ꤩ -L@08S 00Ph餡tB -@LMIhFꬡ 0- L2P@< P0S3P2 ᙇPP%^@00 ,  h0hl :P 0:S H P 0 ,g00hԪtB -@LMhꬡ -L MR0S@(  \ 0S` 1 \[\0$ 1 l bH2A<a!/0C,b `11231113c\$0$000a$0 $Q01 Q$K P  (0S10&O@#/ 2!Nc10&O@#/ 2!NQ (0^& 0S@  RA 0@ 0S@A^M@0t (Kt 00=01(0\0!0^\ 0  AtBQ" p-T# 0ST Š ŖP@@TPZ@တK?0/0S0 P S@ ňK 0P0SÈ0S S UP@P0CS0 @0S0 Pʶ TKP4^C`0S@ @<<"\0@S1PQJ0 R @TJ4UZ0`S1PQQJ0pS KPE`V4UZ10 00n0  0S TK P` 40R00 ?\0#S a0 K P00:TKpPT;0 T0 _ JnPEDP0\  “2a1H`3a1R1R@0!^H PPKTK< RP lnQ82qtB -LMp@P`\ 0 u -MLM 04( S0 0ł>K0C0Cp0 D8 ,(RJ 00S1 ^8 8 8(0QBKL !80Q80@ SJBKL@8( 1SA0@(K@1 @( QZ@0S<8 <K@1$188 P 0S <@(Q< @XH KN18(1aH\ठ04(D8@X P @dUPP P_,8S 0 0`cR   82qtB 0-4PL@ᮍh  W@᧍0鬡820 0 I5 0 0C5@0  R J1 0Q R@ZtB -LM@K$0c -L M@K$w0@K 0 `RA 0 `RS  0 `RS A -L,M0P,0 P0p А R0<@K0 ᨠEᏁ0` PP   0@T P`=00P@@T 00 ,0S 8,nW00ꌑתfL$Lt -LM0H @0$PH  h( -LMp@`P0T@$K P,0 P00g Z@`d -L\M`\, p Px 0%S U 000S,0 S ,@zT`M K K K K K K K K K K K K K K K K K K K K K K K K K K K K K K K K K K K K K K K K K KhM K K K K K K K K K K K K K K K K K K K K KMMMMdKNON8N K K KhN KdK K KtN|NNNONOO,O K K K K K K`OR|OOO KOR K0RDRPRhRxR KR KRRRRSS(ShSS`FmƟxp 0RPgp0S`&1|X p0 S410p( 0 xp 0p 0p5 Ϡl0BP ppp@ N 0C`p R 0P0b0 B`p ( p0 0p(Pp 0S 4 p0S䟕1` h hKp0hP\h x0\p p Hp t0Ϡt0 | 9|3a#`!1!1"I2Gq#1/2b11Q3b11Qdßt圣` !,0/C!b ?@1c!bb1cA 0c0cs0 0^I^"HpG|3l#a1!1!2I"G 22`11R3`11R[[0a Ba4P P 0VS gS  Zx 00  0p0 S5p0S p$Ÿp  P1p p0cp1 p p0 SplըŤpdK8@KdK p!0 ;XpLP@p0 l lKp0lP\l x0p 0p 0S$@T @dJPϠ0Bl4? 2cc1D1AꌑpĪl4x*($IQnmp6Xty -LMTp,@KP` 0  &;  0S 錑Q *0S0 Q*0S0 -aLA@_OReBd @Ap`@@qGTçPDdp@DW00ä?dpG@Q ?T00S L U'@(0 0Q -P`LV@C~p0S  SP@D -``LMvPp !0@ `0`VQ0@JDX |0P00SC/}`VX@E_Z, 0-0L R8 P咉U  RJ0S  RX@ZPU僉 PP { 0PP@hs0 000000D0000PH00C/}02,Вđ -LMO@0 cRP 0@ cR0SR oP@ $6 0@@h0ВđP8 -|Lx"0Shh`p@P0SpC/0p:}PUX`EOZ$_Q00m,`0Y 0- LhMPPh  P SPN *P! P S0 0000 ,0 0Kd Kh0K%{pd Pd  P0 00 , $KfP$P P P0 0 0 00 , 0Kd Kh0Kzp d0S  0 $KP%  P 000 P P0 0 0 P 000 P P0 0 0 0,0 00 000  Pw *P% P P Pv0 0 0 0 P 000  P P`0! 00 t0 fP V dP PL0= P00 , ( M+F0P$ gP ? }P9pPK@0 0Kh0K , h @@azp; P ?{50P x0P0` K0Kh0K0@, h@ 0P Dzp4 000 $ ;0 7  M-L@M@ 0p`tP| 0 p`dtPPl 0`0`KX00S   0" @ 4 40  1@ 0 (@\`$@TpPqx`8@ X0pX L H T` Pp "!XK P <0 0PS` 00P @ 0000UauX^u @d@ # P! 0d KX咀@ D0D[7 ,0 @(T7 0000ܒ~fxĭ M0-LM00 0 PR0`" -LM,ş `,  (q 0  0  5 $0 K0 0 0 8K 匠K┐K80P800X0K00 P  0P   P 00 0 X 0倆P0S0S 3`0K KP L  32a/@#b! DP pj `@ 8 -(!XL"x H` P s hsU Hp@-h`0S 4@?P00 =0  \@@Pp -LM^s1As! 89 0 s 80l!0pp00 c\1(0000 c( ,4s(a X@0Bs08% #HT @0 Q" oP "r$K5$ 0  S0 900Tp 0?A7c%c!c1cW Xyľ¾4ƾȾ -LMp$K 0R0$ Rj`0 P@0E.>? B7c011N0 d 0!T 0L0   '40 /uȾ¾ľEنƾ0 0P 0-0PL.8~4@0, ,xB@0S0 8<h4H -0PL4.c0`Sp- S  0@W0 0 R@ 0T0\ 0S 0S0S0S 0Pp 0@W0 0 R@ 0TP 0P 8 -AMLM,48 <#h0V,0 4  P`F&B~KpGpG 00PSP@ ZH00$H T00S4P 0S`F00 ,0S $,I" Pꌑ< -AMLM,$p(. , "h  V, 4  P 0 ,0S ,P`F%BKHH 040PSP(@%H $H( 0"(lP0P`F SꌑP -LMH p L ld .0, gH` $p 0 1d" L"0 R0t2 0<Sh2 l |2 p2 0^x xD R" P P |x0,X0S @KoK%KDK 0@P񟗢}p})TP tQ$ ȟ 0pSp" 0S WD"0S 0@SD2 媣P\00D"iPpOK?K@DH2L42  870 S TV*00, bZ00`F@T@Q*@$?#<-"-0 0c`0, bP *0S  P*0SPlR Pp4 0 0  RP 00ӑ -RL M00 , *,p `PU 0 S0? 4` PU0S 00X: iPUJ0.S \S@TpPUZPU0S .U -.0Q .Q .S \00.\^ A Aa0ARS00A S\0 A Aa0ARS00A-Q S_Q 0*S 0.S S0S !0B]S.R000Q\R R.R0S !0C]S0S0 0   < 00 , 0 ( Ġ P 0000ӑ -OMLM@0., /|05 p|/|0'|UT U U U 0\D? K AA,!ip Tq!4qS I>K0C 0C000@S000S0005\ =000@Q n[/0`000lhA ` PfP@2 0 8<0  P  P> (K OKAPP $ R*EnK`F`Fn4@@ =P@(K R  P@-(K0 S SK p P&T-(@K0 S S UU0P S S \ \ \00\``Vh@,fP P`e  P1,(K0 S S+P-Y 0 SS S S ,S PPP 0bSyS fS Py 0bSyS fSrp XPW+(K0 S SQPa0P S S \ \ \00\@@TOh, P P@h0LS PP` d V!* \00 \PYP\ V: P P P 0S S S 0 0t P`*(PK0 S S\ 0 P S S \ \ PP P 0 r0 0  R@@0S@L@K0[SQ L@KL0[SG MKL LN.K B0@ B0C D D fWP0S  RT {m4 REP2$PPP P P 5cm,n t(50++P]P @0:SL@K 3OPz  aP ((K0 S S P Pi111.5 % \ \ \ \ 0 SSW ;S`T 0 S P ;Q QqH7  0P NKJ0 J0  PF E4AE @p1 P`4  Q;Q Qq00  RP   }P4 t1 %005 Ep1@ E 0t!$  $ 5 S@pt\@K P00EτO`  Q;Q Qq00  RP &Y ! /P P PP0`30E R@ %$$   %  P P$(@K0 S S(Pt~Pha0@00 R  r000  R00 W0S 0P00 S S@ S 00L T00R00S4P 0P0 00U[?U P   " {h0S= ^h0h L PSEP`P 0.\@SXVP *T.@D|PPV:00]P0:0 000,0 S X,:LkPP <ENK@D@D;P.PPP ,hMkPP h,Mh0e SLPP` dV!* R R00 R0SY P\ V: P P P P 0S S S S000 4SWTY1q/S0SQ1S0ꌑ 8<h4x@tlvt,p6Ḛذܰ -0LMP0.x0pSD [@ S S@0TP S S  /P`3$K <P$Q |h1  00P0S0 ^00 0 0 00T R R R @0TP R R R0S P  P0:0 P0; x P0; \ P01 @ P00 8CEt<4<("4 <1QS0  0-L@PP@`eT0\e 0-LM@ P K 0K  P @@ip0 -LMKPA-M `p |20  00S3 0\ Pt A\ |0  0  R#0CU\|0  0 D R |0  0   Ra NA N.\ 0V54:Ѝ\ \| 10  00S 0hC10S ꐡ@p^*0S쎑W <4<("4.<0^* R0S8<^P0S R8<4X\x\PP P-L \hB!/00h -LMP@`T,`K,pK EP 010jP VX`@TX ,K i0V0.T00S` X  -$"L$M0P@ <K ,0 j0:Q:0 g00 q50paPU`p 0 p`P tvKP`0K0K [a8Z7 " P0` 00PUoS <0PUoK  0p  0S 0aPo 0  p`P v00SS0,0-@_0 0-\ @0S  S0S\ -L M, ,P0 `@ t00  R-T@ +T@VV0Tg V0T ``YqqaaYp XfphX t0 0Q0@Dt0 0Q2 t0 0Q7 DW D@T%^Y \ 00T00S  d Ǹ"00@\00T00SL, 00S ^,00E 0XSxS@`P p-LM`K$P PP@ 0S 0S @TU p選00P 0Pp -LDM@@KDPKH @  0P < 0 8 4 , =b PPL T D\P` P0 *bPDP0V*0S 0 PU:L 0 0S 1hAL \P  cD\ 0 V` \pT P*0S 0 PU:]\pG W0#0%H%%:H00\~]0 S5 S 00T0  0`@T0  00  `b` 000 0 0 `0 yb0Pp S000  BR #hb D pḀT\ 0 STP 0 P@ 0 0  0X p 42@ Tp@04@ T  D p0S0T T p QX GcX0 b T  0ST pX \H@@\0 S S 00T0  0T  R000L 000⸐L0 T0S 0T S8TQ  0 pX @4 @ Tp@4 @ T0S T pQX0 0S T pX I^\ p-LMPb@[P`0  a0p M-L(MPP@0P HK0D0 ܶ Up` T LKP:L0P p`R 0S  0SH K1 0D0K!X p`PW UTv W Vw0"Sꚶ0"Sd -LM, ,D0 ` v00  R-V`<  +V< `YY0V Y0V <Q +. 0@K  0O@K 0 K@@K b0KP@@K ha<00 KSP T@0PiPepv$B 00Q0`Fv  00Q[ v 00Q7 FW F` VM\< R& 40S 8@T80 W V00S N "00`D@ 1B"@$$pSƏ4X004 X 80W8@<0W V00S pD@ 0B"@$$pƏ4 X000Q \,0 J00 K\0XSxS`I -- L 0 0-LM@0 PP0 -1MLM@ P, P`, p p$Yl4#0d$@K$K0 S20D,0 S ,,yX 0KH@H 0#3PPY `   P PJ ` \< 0Q\< #0S0 0 d#P PJ `0S ZJZ:00 00J NK@D@DRdL `K %R~ T @D R@`<d,@ ,P P 0JK N `nU RM K0 A P@#tz 0w 4 \PPpK> @+ >K 0C1Kc@1AlA H D< L @L lfX۴07S o|1]KPE☁ PE  kK A 0P@07S  0\,KnlA1\8 A 4< 0 < kmQ T00%Q00S  P@DtpYP X< X | 0PPD@``^꒴ 0X P PJ `7ꌑ`#ijг`LĈ@p6س -LM0@s 0000 -LtMp0|@ $0 " 0jP`KS  $0S $K_th KPK叀K@ A}pP屆Pop |ꌑ -PLM@R  ?  000 -LM@儆 0 0  -LM k -L^M⸠p`OKPC/MK@( h < 8 _Vat0V$KOK`?cKpG 0@FfKq q A A 1 (0S (錑 p-LM @$K$qta\l!0p   P)$0\b`S(ttLL  0pP,Pp   0x p  P `PbiP0<  08 ( j|p6(Ĉд -LhP0ض -L  hA6x -LMP0` Sp S xp0h X0 0 @0( n@F -LhxP0\ --LM  p-LMP, ^` 0( S,0K$0  00S  R 1S01$K/0@Spb\ꈑ -@LM P  0-LBP|@ 0S L| 0SPeT 0S \00LS `000^0 -LDM@ d WP dWP` 0So 0S0Q0@ @@`K%ZLpP dP00 H XP L T@ gXKP 0SVWXWP0P0H0S\\A0@D1HP (A 0000 YP {P0@ 0000p0d  H X%4 40hWfW H0Hv 00(@,o 00ر00l xܷ -LTM` `\ h0 0Qd 0p KLP0|0 pK0 0Rx0  x 00$0L< 4 00h  { 0-LP@P0 n P 0S SP 0h}0 0-L@PR P 0S S 00hE d0S 0h] 0-LM@PV0S0. P  \0 0L 0-0 0 0LS@P 010S 0S %0S  0S 0hP000 0 0 0 0 0 0P0 P 0 0 00 0-0LS@P S 00  0S S 000  0 S 000 000 P0-  @ 䈓d@-0@SC @<4(<"4!<0  -0S C   <4(<"4!<0   0-LM@0 SKCP0 0Y<4(<"4!<0  -LM0@SK C < 4 = =0>0< ? C0@0B A A0B0@ C 1 G0DFEEFDG ` 0V0pG-M0 咀 0P0呀 @P`pL吠叀 @P`p0P0 0 L0 0 0 兀H儀0D僀@@傀P`p0 <偀8 0 @P`pH0$0D @00<8000tw|04vx 0u0 ~}|{@zPy`xp,t( 0 @!P"`#p40$00%,0&0((0'p00 ,04h jl0r s0pon@mPl`kpdq$i hgf) *(0+,-@.P/`0p$0< 10 @2030405080\ \`0be0a`@Xd c_P^`]p[ ZYX9:;@607 8p0T@?0 @0A0B0C0D0^T0 0TD E0FG崌⾉0 0 ZЍ -LM@p4 00 , 08 40L0 Ƞ< S,ȠL 0X0C8#Ƞ3 X0 08\<#X5 0<0e8#h < GX0` 0n0C 00,`0 0X00 00C8#Ƞ KPp@00 0E8X#X4  R 0("X0e8#h 8XG0`0l0C0 , ` uK8040 ePp80 4 4P㌠!\/ X0 08#X\< " 0<0e8#h< G`Ie00e0 `0@040\ 00C8#ȠQ00X @ -LMP @p`0B8S`RE 00Q 00lU@JMPT3 V  0S 0Q S0ò000 B0 00C0C0 0 00T00  MUU800C80M0 R -LMP`  a("H T p 0 ʲ0S T0 |P  `pQ0 Ppd`P 0 0b8#H Tʲ0S  0- LP@0S 0\P 0Q 0S 0S 0S00 -LM@ PQpl 0 RX 00 P) @Y 00d0 0S 0S 0P  0(1 P$1 0$1  $1 0(! @0 d Ƞ Q`ἠ,kP   04p  0 S E1 0s0 00 0S0GP 张@`0 0S07P 0S @ -LMP`  Q@ n, $ 0 0S0P  0Pp 0, S 0 yE 0 0  pP!?P Y 0(10S$1 0 ! 0S 0P  0P$1 0$1o@ 0-LMP @p 1 00 -L M`@ A nQP, p'P"h?P 0 P 0, S 0 E 髚0 0 !@0 0S0|P  0Pp -LMP<0 80K0 Kp `P@Q0, 10 <KRp8#80CY 0@00PP08#X ("X 0 P L 00< 0@00Q<Y0A  P00<HPP< 0P -RL M`Pp 0 @T 0S @RT ͅ0! A0@ &P@ V00 HP V, 0 10 731 B,0  1@01S -L MQ 1U p, 0 0Y0Q00S0  R R01  RQ}@`z 1Uw 0  P0G 0S00S00 Z 0 0<3Q B K  1F 0 10S' @0`00 0 \\\0 # 0 Q10  @0 @, Y00 P 01-0Q0 P0HP 00 `HP@ =PP  D =P@ D1S0C1> ͇0! Q0PQC 0 AQ=Q10 -LMPpPmP@ R0 X 0W@ P  0S>AT DI>0HP @-0@0 @0!00 R B 0\R! BQ'  0R!<===x=l=`=T=H= 2 2 2 2 2 2 2 2Q 0S !0S: -LM`p餠 08 S80K00 , 4P (P 00S  R 1S010KQ0@ST(`A}}ꈑ Mp-LM0`0 @`,up Mp-LM0`0 @`up -LtM@DPTHL*0Pd U`p0UXS8 `W@ >@00TX X `V  KkmP ߗ0S  X z]P  ї0S p -.kp@ŗ0S  @ V2fpG` W0WXS 괗0 0ܗ  -LM @p@  -LM @P@ -- L`^M@pTA0TPC/M_K 0 KKM?KPE@`1 4a 0a 7Cd0K?aK@D 0KQ |A Q A 1` 0S  n錑t -LM0@S 0U000 -WMLM0@P=KC/NK, h5 @A  K0KfP@ڰ1%SJZ PZJ10lUP$! 1 0R 1 $! pG  T2  ,KRL>( K  KP0@!1 "  0IZS ɟ0! T@c0T0@C00@ S $P P 2 A " 1@ 20 2 0T@A  R\ A R n?KkKm/K \1@   @1T@!i 0>T0@C;00I S$YA 101  D 1S9 1`  V,P! £! 000\0S㴀K Q :Q ܇@P K7Pb(K U`Q`R`%!@fT!T00t7@D0$! 1 0RJK 1 $! pT4ǟ@$! 1 R0$! 1 ,KpRՑQ F?K 0C0 $ 10Q 1 $ pz6(K R [/K0000 $! 1 0R 1 $! p`ʀY- @eTT%T00$! 1 0R@DJK 1 $! pT@$! 1 0R 1 $! p! ^P$! 1 0R 1 $! pL!! 1@fTTڀş00$! 1 0R@DJK 1 $! p.T8$! 1 0R 1 $! !1Q0bQ R 1 S! 0ZK$1 uJKP 0@ CJKP PZK JKPZK1S1S1@h1T@T @$! 1 0R 1 $! pT00 @cTTԓ00$! 1 0R@DJK 1 $! pqT@$! 1 0R 1 $! p]P! 0010$! 1 0R 1 $! pA1@h T @T @$! 1 0R 1 $! p(T00@cT?Tڠ00$! 1 0R@DJK 1 $! pT@$! 1 0!PZK [(JKPTZKJKPMZKJK PFZKPZK ?긑JKP8ZKfꔑ@@$! 1 0R 1 $! pL\ @$! 1 0R 1 $! p3ʼ@aTT00$! 1 0R@DJK 1 $! pT@$! 1 0R 1 $! p! ! [JKPZK PZK JKPZKJKPZKꌑ  Ql0K0LK F?K A 0 $ 10Q 1 $ pQ!0B0 !1p $1 B0S ! $1 ; @`TT2ؐ00$! 1 0R@DJK 1 $! pT@$! 1 0R 1 $! p ʴ0K0$! 1 R04JK3PoZK.PZK hꤑJK%PaZKJKPZZK!00$! 1R0JK PGZKPZK @D@fTT(d00$! 1 0R@DJK 1 $! pT@$! 1 0R 1 $! pJKPZKPZK JKPZKJKPZK}JKP KPZKe PZKP % >&B`Ph( K0hPCdU1!`P0h! 00S00 0hV0 5A0h0 ?`PV P00 U-0 K0@Pu`1 `  ! 1  1S 1` 1 `   !! !  1S 1 1    PoPo!@ !R 1 Po 1  P !  1S QP 1  P1S "1 " 1 20 2 Po X! K   1S "1` " 0K0LD1` 20 2   1S 1`  1 "` 0 " 1  1S 1   1  P`  ! P`1 !  1S 1 1  P`   !@ !R 1 P` 1  P !  P 2Q`0 2 1 P`  1S 1  1 2P`0 2    1S "1` " e1` 20 2   1S 1`  1 "` 0 " 1  1S 1   1  P`  ! P`1 !  1S 1 1  P`   !@ !R 1 P` 1  P !  P 2Q`0 2 1 P`  1S 1  1 2P`0 2 $  ! !  1S 1` 000Sx;( K1 `   !! !  1S 1 1    P`P`!@ !R 1 P` 1  P !  P 2Q`0 2 1 P`  1S 1  1 20 2 P` aY  =X (K  P ! 1S01 \   1S 10  sK"1oK0KqOK@hP g !R10`1 q= (K 1S-0K0Lq? !1,0hGYgY1 ! $q1Q0aa1  !R0 1 !QPPR1  0P ]! 1S AK  \ PPIF 0NS /?`YP 84?4/`Y K@ 001 "0 0 " 1 z1S 10 sK"1oK0KqOK@2q1 0   p 6! (Kx   @1FKS 1  10   0,K0P0B P  101 !R ! \ # # 1S 10  sK\!K0o?KqOK@P *1 "0 0 " 1 1S 10  1sKS  1oK0KqOK@P b ,5Q 1  0  ! 0IP01  hQ1;} @  .lQ! A 10l  !R 2!  1 20 2 0O !R 21 " " u 10  !@ !R 2 1 ,K.R ] 10   1  !R 2 1 ,K R E 10   1 1  !R 2 1 ! + 10   1  !R 2! 1     0O!R 2 1   !1 0  ! 1S 1P`  1x 2 1(K O1  P`  !  0P 2  1    ! <1X1S  !PQPh0K0Lc9PP < 7Y 2":c600W00` W0SY@`0P0:0  @P* 0#b 0pS`pG`0VS 1|0  h1  00K@ f00K0#2::P `Q00S 0 K0l0@K0Sd p0 \ l0 Cb01  .0KP@`\ V  \ \ p`0 P@0K0t\ .O I`Q00à?S h R]e/O 00K\ P@lhA ` l \ \0 y/O H`K`0SD0 5CD0 /O 0K0 P@`P  ژ100l00l0 "Q RR""l0 @ 00T "A"0 P.@K00Kp d0嘐l `0 l@4 T00RP `Pl3\  ӡ1 \ /O ]0@K0 PP  l 0K00 cQ`%0 E0 ,P@0K00000 K0 )\  ` Z '0K0 0K0 P@|P0y9S 0 00oY 0y9S l @ 00l 00 PZX $@x QTP  0S80C6c"|@T @ P |@ T F |UQT Zj j| T PjX0Sx@T #P - "P@( "@ "P \ #P  x0L@Q0S 00S0 46S d10S T@|@T@ | @Q|0NZ jZ@|T J  | T PTQڈ0#P | Rڔ'#P t0S`0Sx\ Uڐ#P T 00P@#`Q#P@ 0Sp !L0\0W00S 00 VkL00Q00S 00` WW`0PZ)   !P @ T   !P   !P    !P "P ` "P`0y9S 0 00;@Y 0y9S ꘐ100ll -0y0S %9U00!900 0S0SW ڈs"P "PpP:U P 9U VP"p] P  0@ ! /G"P 50PP 0 S0S`0Z!P xL\\ !P `QU" Q"P  lPL l xQh `   P Z|0T 0 |0 T 01!|0`X!P sx RC `00 : !`0 0K0000K00 c\0 _0 W\/ `@Zk*. 0KP@` Ÿ HpK`0 0K/ `P ` Z0/  0@K0KP@m/ 0K00 P0 ]0 P0y0S l pbW H0 00KGb q 0@K \P@0K\ 0`p0 K000K0~0x0 P\ P h ` /x P l 0` h0 Z$T l0 c@cT X@ l10 MPl@@Dl@ ??$@'A8K 08`C Z0  0J002#@j jABT @ K<0CJ6C <0 J l O 00 S0 46S  ;   7 -LP -LP -PLM @ 0S@P@ 0-L@PP 0S0 0S0U 0 0@2  -L$M, 0 0 S, 0L 1p< @D 8@ =,P4 @p <D2 @0 4`PRj? P@K80q Q @W0 640S< JZ 0S<0JZL0S ,@0,D e PD84@p<4 @0 P`0PK P@K80 q Q @W0 64<@ 1 RJZ 0S<JZL0S ,4 -LM`V (  0SpP@ p`@ V`pV@  V 1+#,PP 0p0`S0`` 0 @00, eV`pV@ B<B S=  P UP! ?-0 0e P0 0p0eS0`e0PVPV: ,PP -0 P0f  -000P P*0P` 0PU:)P 0 0c  0P0 V,` `pV@ ,0S? 0Y 1! P Q00P00S$ Q ,PPkY 0p0eS0`e^NP], P ,0 0e 0  ,0007P E  P0g0,0 0 03 p-PLMpP@ 0`S0  000Spg`gphBꈑ p-LM`0p@T 0Pd@00U0  ,PP`@Up0@00pp p-LM@`0PS 0@Sp@g;gꈑ -`LMXp` P@PU J0SX@`PUZXВ 0-0L @R5 P-  0P @0P &0P $00 0 00 QB< S  0  0 0c0 00000飯, p-L M0K K@C 00p!`%PUhC  0 SP P000pP` 0 0 p0Y p-LtM@PP`KbTP0@: S  Q  SL  p( 40R p; 0p0+ 0 p锡 -LM, 0 PPPapPH0SJ@T 0 0S;1 ,p@& ER    000010 0@S000 !00 0  ,0 0,PpH0S, ,P ,  -L Mp01 R 0`0V0 @@TJ0Q 0 S@T PEZ`VW 00CS0`V `]V00W4K 0W 8,P0  W 044 0',  -L M`KPP"0S=p@T 0S @S 0ST  ,P0 `00 +0So+p0 +p@ H0 Eⓡ<0!0 0@S+ꈑ  0-LTPM@KT 0K  0  @@)p -LM@ጜPP/0:0 p-LMP `@0 : 0phJ\ 9 -LM@9pP  0:0q0:0Q -L4M4@0@K0 0 S c錑  0t,@R @0S R! !)Q0 R0 P0000S00 0-0 @L0sR: 0R0!00gPP  ! ) @00000!0S0C0P:2!P*0sP:0 1S 0-0 BRLPBP@1P@*  P:U0 e320 0OP -LM`40 , K00K @xPP8 p00, gP, 0 5W T T @@T\0 0 8 Pn 0 8 ZRb,0QP@aT,0 0S , P004  9 000 Z00`DV00S&0ZS 21 `"8 H 80\0 Z,P, PP,` 00  Q00, ~"00PP  0@1 @d#P Z0 ,0, 00~`PPx0021 2!Y0S  0S0S R| O -L0KM0 KSK0  5`060"|` -LMAT P X \0  0e@40 @0KXp@ pp 0@ , l@ ,0 -S]ĩhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh , 0S' 040 , 0T0S,0T@0pW40<40 \4P P ) 0N\HP,00S6 XP/Q P `hP 9Qʨ Z1000CҨ0 10Z0PC, /Q9Q0儠 Q EQeQp 80 0 ,p, +Q -Q 00A S, (0Q 10ASࠃp !,0A , /Q9Q , p1, 000C/Q0 9Q,0!0`\S^p lp Zy @qhPkI0A%SgĬ̩̩̩̩̩̩̩̩̩̩̩̩̩̩̩̩̩̩̩̩̩̩̩̩̩̩̩̩̩̩Ĭ̩̩̩̩,@KlP; ,0C, dP,00, 40 X\000lP* Q040 0R  Â0040  @040 |"0000P 4 ,@KP8P X0 40 \0, 0(SX  4 X@pp 0pf0S n pp 4 @   S Q  f 0Z S@pK Y00 HLxK Q UpK0 C@ K0p5SZӴp p\ p^]pjp0P7 0i@Tp @K J@ K@1 DBTU8 465680 @0K,ʈ L4@D@pKTH8p%4 6"*5B6T80 H ڜU@ @K @KTP@0K@ KD0KP0 . Dp@0 @g0T@0 @00Dp @0 X@0 `0 Xd 0匀 Xt0 @cpTlp v0PD00 D F t0R0 @0  @0SX 0P C 0P  @  ! &00P E 0  ! &dpD0@ gPP  p\p 0t @@n ``p`U0i@`eW@0b@`@VppWpWg@g`gQ ڸP  |PP P d0@cTڬ(P  Zڰ P  VڰP  XڸP p Zp P `p | C 0Sڼx P 4 P00R00Sx0p0  0`@05x0 4@  U!040 pt` W040  pP@0 0 @DSp TT0DPU  0| ` |0 l@Y00T00Sw Kpl@K^ D QVH KL0KuPL HQF>`@0`T  01 0P0  l0^C0 SʌtP 0zP0 0l@0C0 @0x@ 0C@ @0 x0SL@@K0P0\0^00S* /  KP@/ p`I0 P0 P 0 mpK0 Pl\d  0Xd 40| 040 lPD0@cT e0P0 K @00d@0 @0\@0Xp@0 Si 00S/ (S 0X\00 @02T040 0 0*  S:Xp @00 d320D00 4 y"006S^ \ P l?V瞯<@A?d00K0 NPo40|@0P ID0 Cl D $ A0@PUP 5 P0 0 CYl\ D00S`D0 l 0z@0l 0 @0 A0@P|UWPP a]@a0HP0  0D0 @00d@0 pPp 000tpP0@p 0 0A@0 D ]P0 0P0 0WU`@`p 4 PW /O pPK -O V@KU@Kp/O ` | PMpKJ  K0 (KP! P  6@K/O !Pp|p0lp | Q`^@K/O zP`pW K:.O UE lQ-0l40 ^00Y00S00 UYn 0 P0 0D 1  b@PD0!0D w@P@ @0DP 00`t00  Bl !0D @ 40 cY!0` 4 0t@S p@000g@0 Dp P0 L0!040  RE0S0 AU00!  Y0S4 7tl\00P0S-`EP  {P040 0S7dA 000 P0t\40 \D d0-|l00D J@dp @ K n@0K@= DBTV8465680 @pK,ʈ L@@D@KTH8('4 6"*5B6T80 HTW@ @K %@ KTP G@ K p<`K gA 4KX \0 P@@pP 4PX.@@ Kpp@ p0$<`K 5\pp 4K X \0pP@p|p @KL 4K0D8L8 004 pP" X 0S@ 4 800 1E 0dP ,,80Q8 7, 00CU2 0"0aS 0@d P 8 d8 _@e P pD2!`03 W` P`` 80080 B0+S' -S$ 0@T T 0D@T T 10 <0 0>@< TB T80Ql 080 k0Q .p00S (P `DP  $P   -L` B/ bR@Pp0ڃ0RP W0P0 P @ @ 0 BMPP U@U 0 B@PP U98 -LMP K`,pK@0$K 0 KP N0b4 KŒ\(000 : :C(0 00  \0  @RZR R\000A  R*0 R0:P!00P:0 \ !21R  P00SP0@-0PP!A 0\3! a*000 \2!:R 0e0CC1S000\*0\0: -LM0 R@ *0S R @*0S R:0K0 j@-0S! 0  00 000 0$0(0)0*0+ 0,0!-"0.0#00/D80S40 00 00  $R- \ 0S0 \R0Sa@\0-P@0 0 b @-@ l 3. P: -L M, @00S 0 2qp04 0',`@0 R0  R@0 R R0S  R 42PUq R\0  RD0 S@0 S0S3  RZP00W0#02SW`0 W000 V `0SV`F0040S 40 ` 210 0XSxS0 S@P00W0#02SWP'0 ` c0Z0)R00S, 00)R,00  RPW00' 0200XSxSs0 S@o O -\0 0\ -8@LM,    h ԗ -L ` -L `R b-  \ 1<20 0 \ ?\"00 0QS@-@0c  \1<0   \ ?\0 @0 @\ PT0 0 -RLM@8"x8S,0 `hȠ,Ƞ*H&$!PQ # 3(!( '#P020cY ! C2R `0 !8,0S&hh` 0 Q 2RhF0P13P1 <2 -(0(   ,4P ;;( ;S0 0P0 -LM`PP0@ KpD0 K04 4K00M00Ѝ -LM@Pp`EUW 00-_u@T0-`P\9p T0 R @  S$0 -LM`PpP%J6 K`P`,K0 0K00CM-00!OO$P`0"&pЍ -LM`Pp, H0P`pY ,0 p-LM`P@@@`@p -1LM0S``V$ P@pSS PpR SN $8?S @ U=|:JUT!0000à@T  RP;?$ $  u00Q0SpJe\0 \03  0<$0 00P@ $0P0?45WCpSpp04( p-LM`P@l@P@` ph -LMPP@`pW P `034 `RE0E0BUPU0H @0`043P 0 00` -LMdß@TXp, 00 ` T W 0^0T3("S*2V ,P0;,P02S|5P3 T T00W00ST00W\ /O0`PP#>`P`P`0O/ <`PP`V%^!000P 0\P2 000 ,P 00 0O/O0`*0`@0@ P` 0``!v00Q0 S  P (1U:  |0#03  ,K0f0K "Y` ^X,P0W T ,P0^,P0T^,P0{0^0TD04( -RL@M@p $0 0 $ ` `AG P@U0e $ e0(0 21%$ `e( $0 K(K$K$P0 P O4  b p-PL Mp_@@` P0Q S0 U UJA>`o0OoPJ0P` P 0 `p0`S  0 S43"?S04# 0 0 p-;PLMDUEoJP V 0T0U00S pp~UPD 000p5 D" 0a4000V`p4 -;L,M\< 8 * \PoO 0^8K< K`P80C8 <=PoOoPJ  0P` P`PD @ `Po4KO0^`P,0P`$+`P -;L`p45gSM 3^@$P 0 )V! W2 0 KN0^0 ^0n03  1>0$0 2 A$0 AB B0Q0UzW V2$0 n$Q0 Q03  01$0 0P0S;V V ?"0!P -;LˠP` 45fMà3^@p $0 $U V1$0 N$^0 ^0n03  1>$0 0$0 cAH0Q0\U UP` S:\: 0S00 lp'V U Kn<Q0 Q 03  010$0 1$0 0P0S ";0Ϡ\  Ϡ\  y -;@T;LM/UT`ᠯ", (@ 4P 0 H X9 T^(K, KV0X4P 0K4 KM0,4sL'h$H X!1"4 R0#038"8(!,6.(0\ ! 2\ 0C QCR ,p 5U`; i^0U0X00S; -;PD;LM0/EU"4 0P ,@ (0 h Sb ST P ?45(K, K0PU4P0K4 K0P,0454( S b4 ࠑ}~ ,0 4 p?0S`,Ƞ,Ƞ(XB[ 4!Q0#038!8 5"40P 20bP  CR`P`  0P0!02S `FT ^S ;T -;0LMS@ ;0S P  00 45S P{P c45S;0 S-L# ;0S ?S S 00 P *S S 45S 345S;0 S-L# ;0S ?S S0 0000P *S S 45S 45S -!:**@LAB14LM\?@(0R\0l0&03  T`PT P TQx 000T`0R@L0R000 000 l>"0  4 -p`':@ナ7DL⨊ MXO<0KP  @KX@0H1@0 A@ 0?48@K5 0 ( -LP@K4MH)JJp,jP@ 冪 #T # 3(l0 $(h0.%pH(N.l # R2^P2t 3#S#3t@p#8$0 (, PP@2`3`#\ # 3(t0,( Ƞ##!@ Q020S ! 24`h@^ ! 2ldxY00RKAH D L0 *L`H0DK HKLK0D @T0 0` 0O/ l0T Y 00` 0O` -LP@KlM`K PP<,JXJ@ ,Jᄪ@|40 X%X "| t #[,Hs[2,.\0#03^#38,8 Ƞ&.x 8 "# V2R02 3#h00c bVQ0C2Y0C2S`h0 fh  00|00|0 H0 DK|D 0HKLK>L`dD H0h`Pxt@030# 3# h \|L| h|H ph0l@ 3 #030#0SPLh P DP t ` 0/O PP@Z ` 0O/A?O`PP` -p(  LMP`P' &:::S@ W @0 O00X64460 PP 20460@ -p(  LMP`P3 &:::S@$ ?S@ S@0 O00W VUS S X64460 0460@ -p(  LMP`P3 &:::S@$ ?S@ S @0 O00W VUS S X64460 0460@Q0 0aQ03000100P0R b0@- @P 1<\0 0 ?\4 00-b1R"  @-Sc@#0 401  00S20@-  3#@3@# 0  0bQ@2c0 0@-Pc0 @R#3 e d \@2 n0Q@20p@-X h%X ! $ T#3 Ƞ$ȌH.@!Q2pG-(!X  "(!& ' V#3W#3 Ƞ&Ȍh$a*'x%p,Z@2\P2 3 #P$ PG-ȠM!h,Ƞ !#8() X#3 Ƞ"( X(ȌPA*% ᑌ,Z@#@3H*H F' ᙡ&,QP2 Vp2` P@3@#\#3P, Ƞ%".p RP2 3#^#3@ .,$<0\@2@PTP28 40@0 PЍQPP  :Q00SP  :Q0#02SQP@-0 ! - 0pRpLNP9 00 a@P(8#8"( !8 #( 8^#Ƞ:0 0ba^ *0("( ( #8"( ^"Ƞ:\  0R 0!0 P  ! H= -pL0PS*Uʬ AT01 0S0 00x;p e10U TT0 0c1S1@0 P@ ` pꈑ@H8 P0-L@ TP\0HS @08 !  AQ00hpo0h ꈑH@  0"108#8S2 "$"""!    -L M, 0pǏ00 ɯ 9A 0 $`PP`^Pp ,0 0R0 ,1 p ,OPP ,0  ! ,~,P 88S00000P0  -LM@#P0000@ -LMpPX, Pp0``ZP, < ,  1  R8 40 *00 \:`qV0p 8p*PU 0 @20@\0:0 pV:804 Z0>SJZ0>S ,0, -PLNEQHapW@. "P @T` p0S@V 0S n@P`n`rP@ |0SpT 0S \nTNpP@4n@,0 1PLq< -LM0b 0PUp@ڂ UOP R0  R00@ d 040 Q2 :RP 0E0i0Q0: P!0 <01R\3# -LM@`PPA @ `PPP6 0 P, P@p` 0S Q 0@  ^P@:, P*p`0t ,0@P0 P@:0<S0<HS  P 00P -LM0pQ`5@q 0` P0U 5 P56 0 $  `21056U 0 ``610$0 0K `6256 0 U0032 2 -LM0KPP* ( p1$#j&(0 64 40 ,0S00 ' 0KP4 00 `104 002 4 040S  @0 V 0C>C5 `0C0 C>@0C!0 B@`@4K40 0 @ 0S00S0 0-0L(M P< 08 x@4 000 ,@ 0(0 $P D0 <K0   0 R0`Lnp6 -L) 0  ->0>0L MRP, "t oh"(YX0XBcY h 0 0  Q{*42 0  00"" S4 p (0W*40C  A\0\`SD00pS (0W:0 R6p(0W * @\`V lp(0@W:P1( W X0S<8` ( 0S0S, `\ X0 0X0 ,< , 6D0=P0\0 0Q0b0 00 X00b| X000h0(V,=P8 00e0 4L  -LM─(0PUp` *@\0PS (0@U:`0 =P8 \`0X  cX `00j0L  -LMHp,0,P!, 0 4 >0>0XX00 RB Q*2 0Ȓ  (0""QE* C00A\`V\P 00 SQ 4P (0Q:4P1 0 S00 c0B# 0S4@0 ,P ` X0U0`X0   0S 0S    5  \ 1 4P@0, pl!000X (0R DS 0S"  0S\, X00@R0dX0   P0S 0S    5  Tbp0 P@0 pH 000880\9:T l| -LTM804d,0 & @0 (0 PU U @TR 0SO p<0C>S4##!##@#####H#P#\##d####!#l##t#|###########################!############(00 S(0 0S 0B 0S 0pW:B;P 01C0 0 @00,   L -LMP@U P000 0             0 p`# p X 0:00 S00 H\ 8P  p-LM0@\P`2#8#c%>L 0 R 0C 0 RP  `00C0p4P p p-LM0P, 0,R@`@ N@2#8#c$>0 . RQ 0C0 . RQRp80\T -0L@CpP/0 l00 0`0倁 @1  P2#8#c!>Q0 S # 3P00V#3  - L`ppf PP[ VO0a1@1@011:311p  m P,@P" @0d!ST 21 @!T !0`S00PP O 0S00P0P0*02&61!a!p*n -8P, 0 RL@  0DS@T 0D# 1P`f 0S 0@S  R PpPp | QJ*p1 0  P:ڶ1 f0C2BpW@PpPASf$: @P " 10C(1 R000 0!pBSq !R0 Vp\0 0 fP` 80PyzT -LMP0 `Q@<p00C*"*2 B2<1:1!01R!1R% 1R  R000 !R0 R *r0S00P0P0 50S00PPi9 8 - PLM@bq:$ 0bPW*@>0^P =p`K  P @$Q/0S $0` S*0S`:`0X` 1 R  `$0S X0$0$ c d baPt$ 000` [ 00(0XP` T  P -X L0PS HH 00CQ0[ 0000\ -d@LMP @0 R 00Sh[ 0 0v -LM`W[p0S0P @0T $ @00S0 ,0 0CRP0U 8[T0 R TO.[ 00?P 4ꈑl -LM$r`PPw *"*R@ R B0B@ TC$00c S`1:Q i$0夁SN@ T.:0SN@ |$ 00b00S. 8i0S.$0  cN@$a P 0ST(0 R@ Q*0 0  0"1 \h\(V PP <0 i@ L|P -L`}ZVp$ P0S#0 0R0Sxh}h@00S0 hC0 0CR0VZpheꈑ -PL$M`< x<KP $ :0bV*0Z%ZU@ U E0B@ TP$0T:Pc V$0pp00 U00S 0<Q, VV0S 0SV<< fV Pp VU<V 1 !<0S  R, >.0 >.0 R00 4 ,$0S00@04pph8p 1p Pp p 86`80 0R0<`8 m'*!$Q<4 @004 h<p<00 aP  <04$@a, P Vp0S $ 4<0 b f5L$0InY 00`, \<oL P -LP`VYp0S/Ġ @0T # @00S00 0CRP0U 7Y0S TO.Y 00?P 4ꈑ -L`PY@q0SJ00!@,1T > UV3:V P$:@0Q0 0CRP0U X 0S X 00> 0S 0SX 0 0<IP  ꈑ 0-LMPK 00%0 @+ 0ST 0S @S 0ST 0S 0SX_;   X_ 00 P100*2 H -4LM, 0R,0  0  R 00 㬐K@0K %K @@-0p0C0000@P`0@00 p 0W0`@+@TZ,00 ,0S$0 ,2vj  -L'X<0< R00 R  0S h -H 000000 -LM,@0Sq0Shꈑ - LM0, S)0 R# p00C000 0, P`@0@00  0X0`( 0So5ꈑ 0-pPL0S` 00C0zLHD0S@0ꈑ  -xpL0`S@@DYt PP00CS0 h@Dt0Shzvꈑ  P0-LP0P@``@P:0@-M Ѝ@-MЍ! !P: ZŒŒ#! !P: `B!,aB 0>ZJJJJJJJJJJJJJJJJJJ }J xJ sJ nJ iJ dJ _J ZJ UJ PJKJFJAJ=Q:Q:Q:Q:Q:Q:Q}:Qx:Qs:Qn:Qi:Qd:Q_:QZ:QU:QP:QK:QF: QA: Q<: Q7: Q2: Q-: Q(: Q#: Q: Q: Q:Q:Q :Q:QA ? QA ? QA > QA > QA = QA = QA < QA < QA ; QA ; QA : QA : QA 9 QA 9 QA 8 QA 8 QA 7 QA 7 QA 6 QA 6 QA 5 QA 5 QA 4 QA 4 QA 3 QA 3 QA 2 QA 2 QA 1 QA 1 QA 0 QA 0 \aBC`B0QA 0  -LM@1VhW] -LM@\Pp` h^\QU0SD R 0S=W00  00CSHGHHH(H4H`H@HHHHHHHHHHHHHHHHHTH`H0 0U00 1 0 0 ;00 0 0 R 0;S< W  4 U 00U 0, |7@-EP@-P@p `0SP T  0S 0\^ 0S^0=S P00cC10 -LM0S=S 0S=S` K@-Q:@- R (2 R R -PPPP RrPP B PP R  R00 B R000Ѥ000l\000Ѥ000 R \6 R B0-.40P<$DL%T \,Ġ̌8 R0 .Ġ̌ RA R B0-.80P8$HH%X X,ȠȌ8 R0 .ȠȌ RA R B0-.<0P4$LD%\ T,̠Č8 R0 .̠Č RA R'0 R@- RP1P P1P RrP1P  B P1P B@  R010 1  B R0q0`0q0`0q0`\0q0`0q0`0q0` R 0\6 R B0@-81, Ġ%̌T$\D#L0P  R0@ Ġ01#̌  R R B0@-81, Ƞ%ȌX$XH#H0P  R0@ Ƞ01#Ȍ  R R B0@-81, ̠%Č\$TL#D0P  R0@ ̠01#Č  R-R0 0c BSR48 R p-@P`x BRpR0 BRRR -LM`@ 0pP` 10S  0Sb22|*x*JJt*j* -p@L00l8#hP &08#x `0 0c8#h08#x 0b0C`p`0 -LM@p 0S `;W0R F0`8W#X 0  bPʀ 0S0 0 A0AA0AP(1W0G(1 0000F000A8  B8 000o -L4M@ 0< 开@ =PD p <04Px D0@ 00  0 ZH P L *P0<S`R0000 l , @0g\0KH8 K8' 0080 0 c4 ?P08#8P0 0ZpPP0n0 a B 00ഀD   000#8ᲀL  L 08# aHL0 00`0ᲀPD  0<@ D   000 -LLMT X PpP 0L8#hL \\P ` h [00C8S 0@TL s \d `E0S@@KHKd0@ @ b 00H0 0L c@d@ PP P3 0S 0 00S L Pp   00008#h\0 0S\`0S L'\0S 0 00S\  TLPT \ \  dT 000 0a0C0 h 0b0C 0X L0 PX L` X0@QPh  L X` eX 8K TP X0LPP4PT 8pW\ 0 RL0X P X -LM@p0Qs P`0 R=V0e S0 0RS 00P U*V0 00Q *^ 0ᤷP@  0Y008 8(40Po P0 00S"P@ 0S 0 00S 0 P  Q p-LM40@SP`$ 000`!H 0 @Pp0000000 0 B@ 0p00S40040 -L M`pxQ  0 0C0ppSa <0R@W  P@0Pp  P P>Y 0S00C0pp  ,1R Y 0C\0K 1 00  0 !0  00[\002K)0[* [0 0\ʌ0 0"K+ [,[ \PO0 0T@0@0<  JPPBJ@ D@00@ -L MPx`p@ `  1R TI 0CP0K100  0!0  00[P0Z" <0W@ Q P@0PYp  P rPO0 0@0@0< J PpBJ@ @00@0Tʀ0 0"K) [*[ Pڸ5P  -LM` 0H20APP p0 101  d 020 0  崜8Q0 00P -L M  !4 0pD $0@SQ!P40 BU00 ,P 18aV U 0, 1 CU@  T pb @ TPU00ZD0 $0@0@@c TD ZF !4 0@  A@ D@ 010CY ?=2!I !U08#X&ʊU0 aP`40@ D0 T0D0Z 1@@ AU@ D 1 P,O001 G,{Od@?=2D  $0!E!P@T$ U D0T P U D0TU1@ \0@bT5У 0$10C@/-"@dP`S -0p8#(=1@0@A0C$0^^ 18a!$ BVLP ?=2!E.!hP` -LAMq0P 0 )VAnK `F0@S `F@D3 \0 0eAK0 A SA *0$4 gG0s1 Z K W1s 0S 8 lN?00Qꌑh DT -L MⰀ0ሐ` 0cV8#Ƞ, F0@p P0 00 0c8#Ƞ 0 밀,000 0Pc PEP00@ -LM1@QPap 0 Rp8! ,,P8q8p -L|%s: %s not compiled in instbinUsage: %s ..., where is one of: mount_cd9660dfmountmount_ext2fsarchsyncnewfs_msdossttylndisklabelpaxtarcpiofsck_ext2fscatifconfigsysctlrtsolping6ztsscalelessmoremount_nfsfdiskgrepfgrepegrepumountmount_msdosfscksha256mknodreboothaltmount_ffsdhclientcpgzipgunzipgzcatchmodchgrpchownfsck_ffsnewfsrmmtejectmkdirksh-shbioctlsleepmvexprdmesghostnameX$j(jdG؉0j@@F$8jX?[\]|usage: %s [-N] [-a FAT-size] [-B boot] [-b block-size] [-c cluster-size] [-e dirents] [-F FAT-type] [-f format] [-h heads] [-I volid] [-i info] [-k backup] [-L label] [-m media] [-n FATs] [-O OEM] [-o hidden] [-r reserved] [-S sector-size] [-s total] [-u track-size] special [disktype] ȇ ЇfԇDt܇    P :048<@HPX`hp x #3#3233#@Ȋ@ @Њ@؊ $,4<DLT\ d l@t@|Tyċ̋ԋ܋  $,4@LT\dlt|Ȍ@Ќ@܌@@    $,4<DL@T@\dl t C$|CC$Cč̍ԍ܍  $,4@<@DLT\dldiscarddsuspeofeol2lnextminquitreprintstartstatusstopsuspflushrprntoption requires a numeric argument -- %smaximum option value is %d -- %sundefoption requires an argument -- %sillegal gfmt1 option -- %sillegal gfmt1 optiongfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:ispeed=%d:ospeed=%d %s=%x:%lxoflagospeedlflagiflagispeedcflagcbreakcolscolumnscookeddecekeverythingextproclcasenewoldostartostoprawrowssanespeedttyillegal option -- -%scols %srows %s%d %d TIOCSETDTIOCSTARTTIOCSTOPcs5cs6cs7cs8cstopb-cstopbcread-creadparenb-parenbparodd-paroddparity-parityevenp-evenpoddp-oddppass8-pass8hupcl-hupcl-hupclocal-clocalcrtscts-crtsctsmdmbuf-mdmbufignbrk-ignbrkbrkint-brkintignpar-ignparparmrk-parmrkinpck-inpckistrip-istripinlcr-inlcrigncr-igncricrnl-icrnliuclc-iuclcixon-ixon-flowixoff-ixofftandem-tandemixany-ixanydecctlq-decctlqimaxbel-imaxbel-echoechoe-echoecrterase-crterasecrtbs-crtbsechok-echokechoke-echokecrtkill-crtkillaltwerase-altweraseiexten-iextenechonl-echonlechoctl-echoctlctlecho-ctlechoechoprt-echoprtprterase-prteraseisig-isigicanon-icanonnoflsh-noflshtostop-tostopflusho-flushopendin-pendin-crtnewcrt-newcrtnokerninfo-nokerninfokerninfo-kerninfoxcase-xcaseopost-opostlitout-litoutocrnl-ocrnlolcuc-olcuconlcr-onlcronlret-onlretonocr-onocrtabs-tabsoxtabs-oxtabsonoeot-onoeottablet disc; ispeed %d baud; ospeed %d baud;lflags-extprociflagsoflagscflags%-8scchars%s = %s; %d rows; %d columns;speed %d baud;#%d disc; slip disc; ppp disc; strip disc; nmea disc; -aefgaef:gTIOCGETDTIOCSWINSZtcsetattrgfmt1illegal option -- %sTIOCGWINSZnot a terminalusage: %s [-a | -e | -g] [-f file] [operands] Ffhnslinkit%s: disappeared%s and %s are identical (nothing done).%s/%susage: %s [-fhns] source [target] %s [-fs] source ... [directory] L t  ļ @̼ Լ@ @ @ %2@t   `N̼@_t @dt  $̭̭Lx\{sFOڭ=Qw^٭ʖ-9],kIR9j ID `RL퇿~` i9k& LLO?o^|f(^7K]o7֋ZjC{w^zFo_D/WѫFie&2}*Rh# Q\iƪHu:N3s/Urj?Mt.z+ӴE$Jn7uTB`hќ.eڵM2VIu䘡뽦xF|XY?Pjl{tZ((~q{quE7d'pS@S&=TBi2 ?mq&t߯BLSDG魯akR2#1ch6HH|UiJ AoҦ"t,AJ`}ܝ/Θ4{&[AiA@:+('gf)h'T Q^[C7Ωǭ) 7y#*&^edI4]h܍7[h^݉t:ϐ gT\p$CڝӾ@x<OU._I.hgEqoNQ2_.vB+$&WlJn4PpAt=NمT H)CF$x6Szx@! ( 3𝇯q40a!=6sF?F9z+b<@ZGg₢x"8VkBG])q? ui{5V"L<X0 <24A1b9h:Ơq\lZ8ѽ$23dIi$0XHx(cR!d2>{ڂ&b&dieh P5%1Sd'*q+. X~qޚBh:b&bp GxAO=Ϫ=z gj3{FLN#ўJVQ~r(RRKʶ!NV^zt3&=LW @kO,ćh)1@\iTpEG@PMn8k)Ch!|Ni Cub('UF!t^6O{W i-l°݌ofG fVgh.M.I[k+#8'gSkJ.ʅYfSX#sr ΪG8Up#rK Ca4o$\'AܑJtv][H3DE=:FX Da;XI(VYП|VjxΗp`gZ#r;%:JGZ6#l{kp69|&+R,*{*Gd]C=20i -]BƝNm۬.֟QHEŠ 4Y~"`BZVo!,޻ /#45ZkYYUbN nC}8w`ؓwQ<7701a= z h´a@CTF1)M5Q4h*-50BGv="RQ1V!"0-Cgko=rh 6RqcnG6‘5(!޲5xJG&ef%}@ bAkp9mVz:sANZYu$ԉe}5SDmęwYG\*\ԩEJU4{bp7:D9H:`YiW}Jq2Pa ZcCCs=^OZq Y}+*dNOTXw**GK0(/$Ui\uL=B$Q.eB97ĆlC {b1JLœa\-NR,k⃳hF(] mg!,Fx ZLspHUC4 EŃmr&`]3p3T"pY j$QrP5uRJdutݏj.!7/E_oƃ(c͋~ɇLh>p S3ΰSaklá=F kVxOO)9u@zQˋ:Y3lκ!HJ\H0,hٸTzgVrLLL+Sk95F-܍/nA9eSrsݦ+~~oi>Z'0P!lTPC*V~M-,Ƶ+`D]~ Sxڒ((M6S1)eba ʬy>aY0.Z< c.jP-{l[h%X:r>S2ڎP $Kvzİg %~-D X"pR,@9IuEQzW4(XB*XŁzGiۖwfApWSŲ(#b j̖SY5ֈʷYa70mC[ZƂxAt{gIn1W JqM Q;NlYH,DEx;&\CVߖww(JV Ha9n08[ùnygOFV(g[?D.Y S6/=ZӜN3@[+ωgcq6 hAre㧏>mO ;@9!.̙y.αݠ~ΖijePлsZPwOȀF ? {_a~-6\=H/V +A\K B9 >&dGE\=CKt*ڰUaµrhs?XU=CH-H+1u(ژ^(@. (ۚ'/~>D75|#/ ,CGceMFn>E)gZ XwdUnI=`< 'kYp|9~KI[UŢ7De9D6{h3bkVi*q32=fE=i.)%hQEDW,hK`&r0YhR{Bä FaJc' UqA9[KmY*;엚bAVQ+Cni\Oks6 ;қE`!PuK8?%MW}yi-}=EALz~~v~x( HVx T:A'ǏC6Ll~u| IMb^,ﱋ q>%I9py11av.e{aPж'F!N9 K}O.6Ip1=< bn?p,ɰs̶<5s!XraN}Kצ>uUn(§)oHT+maKOBOvATWfͅgH+$Ztu5|P zOgRg<M'$P Up)`A!GgJǧ,GKA1{.!T0o1,00'Lr-:g߀YVayF{BR`h@Gı)> V?bȑra7k^{]TO~Hc bCLC%h^'QK-$9Y Yo X2T_{!C{oncF+ )0ۈ$צ™ʅ6 EsĽ)Bi5TV,yjRʑ5^^IzwF,Z:77ܙ*5Hf:-4T#yX}};K<[KyжO "G#,\4 A 鐵]蜞Jov;|'va{#<316&B ?8|ؖ{HO^5kD)1A ksak _{Kez-^{:`;MOτ(:߶&%uZTgi@;ϟ o#.,RadosudfunknownSMDMSCPold DECSCSIESDIST506HP-IBHP-FLtype 9floppyccdvndATAPIRAIDunusedVersion6Version7SystemV4.1BSDEighth-Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSHFSADFSNTFSUDFABEf:hNRWb:cdenp:s:tvwbckmgt/dev/%s%cioctl DIOCWLABELunknown disk type: %sioctl DIOCWDINFO%s: No disk label on disk%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of disk%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)ioctl DIOCGPDINFOioctl DIOCGDINFOioctl DIOCRLDINFOBootstrap doesn't leave room for disk label\ :Automatically generated label:\ :dt=se#%u:ns#%u:nt#%u:nc#%u:sc#%u:su#%llu:%srm#%hu:%sil#%hu:d%d#%up%c#%llu:o%c#%llu:t%c=%s:t%c=unknown%d:b%c#%u:f%c#%u:%.*s| %c: %15.*f%c %16llu %7.7s%7d%19.19s# %s %5u %5u %4hu %c: %16llu %16llu # %s: type: %s type: %d disk: %.*s label: %.*s flags:bytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %llu # total bytes: %.*f%crpm: %hu interleave: %hu boundstart: %llu boundend: %llu drivedata: %d %hu partitions: offset# %16.16s %16.16s fstype [fsize bsize cpg] vendor badsect # Notes: # Up to 16 partitions are valid, named from 'a' to 'p'. Partition 'a' is # your root filesystem, 'b' is your swap, and 'c' should cover your whole # disk. Any other partition is free for any use. 'size' and 'offset' are # in 512-byte blocks. fstype should be '4.2BSD', 'swap', or 'none' or some # other values. fsize/bsize/cpg should typically be '2048 16384 16' for a # 4.2BSD filesystem (or '512 4096 16' except on alpha, sun4, ...) re-edit the label? [y]: editNo changes.-cVISUALEDITOR/usr/bin/vi/bin/sh # line %d: syntax errorIDEline %d: warning, unknown disk type: %sbadsectvendorline %d: bad flag: %sdrivedataline %d: bad drivedata %s%d partitionsline %d: bad %s: %ssectors/cylindertracks/cylindercylinderstotal sectorsrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekboundstartboundendline %d: warning, unknown filesystem type: %sline %d: bad partition offset: %sgetasciilabelline %d: bad partition size: %sline %d: too few fieldsline %d: bad partition name: %sline %d: unknown field: %sline %d: bad # of partitionssector size %dtracks/cylinder %dpartition %c: offset past end of unitpartition %c: partition extends past end of unitwarning, unused partition %c: size %lld offset %lldwarning, partition %c: size 0, but offset %lldwarning, number of partitions (%d) > MAXPARTITIONS (%d)warning, super block size %% sector-size != 0super block size %dwarning, boot block size %% sector-size != 0boot block size %dwarning, revolutions/minute %dcylinders/unit %dsectors/track %dcmplabelusage: disklabel [-c | -d | -t] [-Av] [-h | -p unit] disk (read) disklabel -w [-c | -d] [-Anv] disk disktype [packid] (write) disklabel -e [-c | -d] [-Anv] disk (edit) disklabel -E [-c | -d] [-Anv] [-f tempfile] disk (simple editor) disklabel -R [-nv] disk protofile (restore) disklabel -N | -W [-nv] disk (protect) %sdisklabel -%sw [-nv]%s disk disktype [packid] (write) %sdisklabel -%sR [-nv]%s disk protofile [disktype] (restore) `disk' may be of the form: sd0 or /dev/rsd0%c. `disktype' is an entry from %s, see disktab(5) for more info. /etc/disktab`packid' is an identification string for the device. `protofile' is the output from the read cmd form; -R is powerful. For procedures specific to this architecture see: %s fdisk(8)/tmp/var/usr/usr/X11R6/usr/local/usr/src/usr/obj/homeYou need to specify a type for this disk.No 'c' partition found, adding one that spans the disk.Label editor (enter '?' for help at any prompt) unable to get default partition tablePAGER/usr/bin/lessgunzip -qc|%sunable to execute %sOriginal label and mount points restored.EnteringExiting%s expert mode This option is not valid when run without the -f flag. Write the modified label to disk?Write new label?editorunable to write labelNo label changes.In no change mode, not writing label.Free sectors: %16llu - %16llu (%16llu) Total free sectors: %llu. cannot open %sFilenameName of the file to save label into.Last change undone.Unknown option: %c ('?' for help) can't run when there is partition overlap.can't get mem sizeeditor_allocspaceNo space left, you need to shrink a partition Partition must be between 'a' and '%c' (excluding 'c'). Partition '%c' exists. Delete it first. The letter of the new partition, a - p.Command aborted Partition '%c' is not in use. You cannot name a filesystem of type %s. partition to nameThe letter of the partition to name, a - p.partition to modifyThe letter of the partition to modify, a - p.partition to deleteThe letter of the partition to delete, a - p, or '*'.Partition %c is currently %llu sectors in size, and can have a maximum size of %llu sectors. partition to change sizeThe letter of the partition to change size, a - p.%s: [%s] %s: [%llu] Rounding to cylinder: %llu getuint%lldhas_overlap Error, partitions %c and %c overlap: Disable which one? (^D to abort) [%c %c] Changing device parameters for %s: What kind of disk is this? Usually SCSI, ESDI, ST506, or floppy (use ESDI for IDE)."%s" is not a valid disk type. Valid types are: "%s"label name15 char string that describes this label, usually the disk name.The Number of sectors per track.Invalid entry The number of tracks per cylinder.The number of sectors per cylinder (Usually sectors/track * tracks/cylinder).The total number of cylinders on the disk.number of cylindersThe total number of sectors on the disk.Not enough free space to shrink by %llu sectors (only %llu sectors left) The rotational speed of the disk in revolutions per minute.The physical sector interleave, set when formatting. Almost always 1.edit_parmsYou may want to increase the size of the 'c' partition.failed to sort partition tablesdrzwdFLOPPYxdhdCCDVNDsvndPossible values are:"IDE", Disk typeWhat kind of disk is this? Usually SCSI, IDE, ESDI, CCD, ST506, or floppy.Starting sectorThe start of the OpenBSD portion of the disk.Size ('*' for entire disk)The size of the OpenBSD portion of the disk ('*' for the entire disk).Treating sectors %llu-%llu as the OpenBSD portion of the disk. You can use the 'b' command to change this. The 'p' command prints the current partitions. By default, it prints size and offset in sectors (a sector is usually 512 bytes). The 'p' command takes an optional units argument. Possible values are 'b' for bytes, 'c' for cylinders, 'k' for kilobytes, 'm' for megabytes, and 'g' for gigabytes. The 'D' command will set the disk label to the default values as reported by the disk itself. This similates the case where there is no disk label. The 'M' command pipes the entire OpenBSD manual page for disk label through the pager specified by the PAGER environment variable or 'less' if PAGER is not set. It is especially useful during install when the normal system manual is not available. The 'X' command toggles disklabel in to/out of 'expert mode'. By default, some settings are reserved for experts only (such as the block and fragment size on ffs partitions). The 'a' command adds new partitions to the disk. It takes as an optional argument the partition letter to add. If you do not specify a partition letter, you will be prompted for it; the next available letter will be the default answer The 'b' command is used to change the boundaries of the OpenBSD portion of the disk. This is only useful on disks with an fdisk partition. By default, on a disk with an fdisk partition, the boundaries are set to be the first and last sectors of the OpenBSD fdisk partition. You should only change these if your fdisk partition table is incorrect or you have a disk larger than 8gig, since 8gig is the maximum size an fdisk partition can be. You may enter '*' at the 'Size' prompt to indicate the entire size of the disk (minus the starting sector). Use this option with care; if you extend the boundaries such that they overlap with another operating system you will corrupt the other operating system's data. The 'c' command is used to change the size of an existing partition. It takes as an optional argument the partition letter to change. If you do not specify a partition letter, you will be prompted for one. You may add a '+' or '-' prefix to the new size to increase or decrease the existing value instead of entering an absolute value. You may also use a suffix to indicate the units the values is in terms of. Possible suffixes are 'b' for bytes, 'c' for cylinders, 'k' for kilobytes, 'm' for megabytes, 'g' for gigabytes or no suffix for sectors (usually 512 bytes). You may also enter '*' to change the size to be the total number of free sectors remaining. The 'd' command is used to delete an existing partition. It takes as an optional argument the partition letter to change. If you do not specify a partition letter, you will be prompted for one. You may not delete the ``c'' partition as 'c' must always exist and by default is marked as 'unused' (so it does not take up any space). The 'e' command is used to edit the disk drive parameters. These include the number of sectors/track, tracks/cylinder, sectors/cylinder, number of cylinders on the disk , total sectors on the disk, rpm, interleave, disk type, and a descriptive label string. You should not change these unless you know what you are doing The 'g' command is used select which disk geometry to use, the disk or a user geometry. It takes as an optional argument ``d'' or ``u''. If you do not specify the type as an argument, you will be prompted for it. The 'l' command prints the header of the disk label. By default, it prints size and offset in sectors (a sector is usually 512 bytes). The 'p' command takes an optional units argument. Possible values are 'b' for bytes, 'c' for cylinders, 'k' for kilobytes, 'm' for megabytes, and 'g' for gigabytes. The 'm' command is used to modify an existing partition. It takes as an optional argument the partition letter to change. If you do not specify a partition letter, you will be prompted for one. This option allows the user to change the filesystem type, starting offset, partition size, block fragment size, block size, and cylinders per group for the specified partition (not all parameters are configurable for non-BSD partitions). The 'n' command is used to set the mount point for a partition (ie: name it). It takes as an optional argument the partition letter to name. If you do not specify a partition letter, you will be prompted for one. This option is only valid if disklabel was invoked with the -f flag. The 'q' command quits the label editor. If any changes have been made you will be asked whether or not to save the changes to the on-disk label. The 'r' command is used to recalculate and display details about the available free space. The 's' command is used to save a copy of the label to a file in ascii format (suitable for loading via disklabel's [-R] option). It takes as an optional argument the filename to save the label to. If you do not specify a filename, you will be prompted for one. The 'u' command will undo (or redo) the last change. Entering 'u' once will undo your last change. Entering it again will restore the change. The 'w' command will write the current label to disk. This option will commit any changes to the on-disk label. The 'x' command exits the label editor without saving any changes to the on-disk label. Available commands: ? [cmd] - show help n [part] - set mount point A - auto partition all space p [unit] - print partitions a [part] - add partition q - quit & save changes b - set OpenBSD boundaries s [path] - save label to file c [part] - change partition size r - display free space D - reset label to default U - undo all changes d [part] - delete partition u - undo last change e - edit drive parameters w - write label to disk g [d|u] - [d]isk or [u]ser geometry X - toggle expert mode l [unit] - print disk label header x - exit & lose changes M - disklabel(8) man page z - delete all partitions m [part] - modify partition Suffixes can be used to indicate units other than sectors: 'b' (bytes), 'k' (kilobytes), 'm' (megabytes), 'g' (gigabytes) 'c' (cylinders), '%' (% of total disk), '&' (% of free space). Values in non-sector units are truncated to the nearest cylinder boundary.The 'z' command zeroes out the existing partition table, leaving only the 'c' partition. The drive parameters are not changed. mpsave%s%c %s %s rw 1 %d Starting sector for this partition.The offset must be >= %llu and < %llu, the limits of the OpenBSD portion of the disk. The 'b' command can change these limits. The offset must be in a free area. Size of the partition. You may also say +/- amount for a relative change.The size can't be more than %llu sectors, or the partition would extend beyond the last sector (%llu) of the OpenBSD portion of the disk. The 'b' command can change this limit. Sorry, there are only %llu sectors left The size must be > 0 Size of fs block fragments. Usually 2048 or 512.fragment sizeZero fragment size implies zero block sizeSize of filesystem blocks. Usually 16384 or 4096.Error: block size must be at least as big as page size (%d). Error: block size must be a multiple of the fragment size. Error: block size must be at least as big as fragment size. Filesystem type as a decimal number; usually 7 (4.2BSD) or 1 (swap).FS type (decimal)FS typeFilesystem type (usually 4.2BSD or swap)Unrecognized filesystem type '%s', treating as 'unknown' noneWhere to mount this filesystem (ie: / /var /usr)Mount points must start with '/' '%c' already being mounted at '%s' Can't stat deviceYou must enter either 'd' or 'u'. BIOS geometry not defined. Note: user geometry is the same as disk geometry. Enter 'd' to use the geometry based on what the disk itself thinks it is, or 'u' to use the geometry that was found in the label.[d]isk or [u]ser geometry%lluOpenBSD area: ; size: ; free: # %16.16s %16.16s fstype [fsize bsize cpg] Cannot write an archive on top of a directory %sFailed stat on %sFailed chdir to %sFailed open to read on %sFailed open to write on %sFailed open to read/write on %s%s: unknown format, %qu bytes skipped. %qu blocks %s: %s vol %d, %lu files, %qu bytes read, %qu bytes written. done. %s: Waiting for tape drive close to complete...ar_drainUnable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specEnd of archive volume %d reachedFailed read on archive volume %dWARNING: partial archive write. Archive IS FLAWEDWARNING: partial archive write. Archive MAY BE FLAWEDFailed write to archive volume: %dUnable to append, trailer re-write failed. Quitting.Write failed, archive is write protected.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Cannot allow updates to an archive with flaws.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to seek archive backwardsReverse position on previous volume.Unable to obtain current archive byte offsetUnable to backspace tape %d blocks.Tape drive unable to backspace requested amountget_physUnable to backspace tape over %d pad blocksUnable to backspace over tape filemark.Unable to locate tape filemark.Cannot determine archive tape blocksize.Unable to backspace over last tape block.ar_next ATTENTION! %s archive volume change required. %s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot open %s, try again Cannot save archive name.Quitting %s! %s ready for archive tape volume: %d Load the NEXT TAPE on the tape driveReady for archive volume: %d Unable to restore signal maskUnable to set signal maskcould not pipe-dccould not forkcould not exec %sCan't fchdir to starting directoryCannot chdir to %sextractUnable to open %s to readCannot mix current archive format %s with %sappend%s: Reading archive to position at the end...directory name is too long %scopyDestination is not a directory %sDestination pathname too long %sCannot access destination directory %sArchive I/O error. Trying to recover.Archive I/O error, cannot continuePremature end of file on archive readInvalid header, starting valid header search.Unable to append, archive header flawCannot identify format. Searching...Sorry, unable to determine archive format.Write block size of %d too large, maximium is: %dWrite block size of %d larger than POSIX max %d, archive may not be portableWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximium is: %dWrite block size %d is not a %d byte multipleUnable to rewrite archive trailer, cannot append.Cannot append to an archive that may have flaws.Archive read error limit (%d) reachedUnable to append when there are archive read errors.File changed size during read %sFile %s was modified during copy to archiveRead fault on %sActual crc does not match expected crc %sUnable to obtain block size for file %sFile %s changed size during copy to %sFile %s was modified during copy to %sFailed stat of %sFailed write during copy of %s to %sUser specified archive volume byte limit reached.Unable to allocate memory for user id cache tableUnable to allocate memory for group id cache tableUnable to allocate memory for user name cache tableUnable to allocate memory for group name cache tableTRAILER!!!cpio_endwrCpio file name in header is corruptedCpio file name length %d is out of rangeCpio link name is corruptCpio link name read errorCpio link name length is invalid: %qu070707File is too large for cpio format %sCpio header field is too small to store file %scpio_wrUnable to write cpio link name for %sUnable to write cpio header for %s070701070702File is too large for sv4cpio format %sSv4cpio header field is too small for file %svcpio_wrCould not write sv4cpio link name for %sCould not write sv4cpio header for %sFile is too large for bcpio format %sbcpio_wrBcpio header field is too small for file %sCould not write bcpio link name for %sCould not write bcpio header for %sUnable to create %sUnable to close file descriptor on %sA hard link to the directory %s is not allowedUnable to link to %s from %sUnable to copy %s, file would overwrite itselfCould not link to %s from %sUnable to remove %sUnable to link file %s to itselfCould not create: %snode_creatCould not access %s (stat)cannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCould not unlink %sUnable to remove directory %sAccess/modification time set failed on: %sUnable to obtain file stats %sUnable to set file uid/gid of %sCould not set permissions on %sFailed write to file %sOut of memoryFile seek on %sWARNING! Major Internal Error! GNU hack Failing!Failed seek on file %sFile changed size %sset_crcFile %s was modified during readFile rewind failed on: %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:Can't chdir to %sFile system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %snext_fileIgnoring too-long pathname: %sIgnoring unterminated pathname at EOFls_list%b %e %H:%M%b %e %Y%s%2u %-*.*s %-*.*s %4lu,%4lu == -> %9qu %s%s %s ls_tty%s: unknown option %c %s: %c argument missing bcpiosv4cpiosv4crcustarab:cdf:ijklno:p:rs:tuvwx:zB:DE:G:HLOPT:U:XYZ0Write limit is not a %d byte multipleInvalid write limit %sError count value must be positiveInvalid block size %sbzip2Invalid -p string: %cUnknown -x format: %spax: Known -x formats are:Destination directory was not suppliedb:cef:hjmopqruts:vwxzBC:HI:LOPXZ014578/dev/rst0/dev/rst1/dev/rst4/dev/rst5/dev/rst7/dev/rst8Unable to allocate space for option listTAPEProblem with file '%s'Unable to open file '%s' for read-C-Iwrite_opt=nodirabcdfijklmoprstuvzABC:E:F:H:I:LO:SZ6Unknown -H format: %scpio: Known -H formats are:Problem while reading stdin%s: Invalid combination of options: -%cThese format options are not supported %s = %s Invalid option nameInvalid options formatusage: pax [-0cdjnOvz] [-E limit] [-f archive] [-G group] [-s replstr] [-T range] [-U user] [pattern ...] pax -r [-0cDdijknOuvYZz] [-E limit] [-f archive] [-G group] [-o options] [-p string] [-s replstr] [-T range] [-U user] [pattern ...] pax -w [-0adHijLOPtuvXz] [-B bytes] [-b blocksize] [-f archive] [-G group] [-o options] [-s replstr] [-T range] [-U user] [-x format] [file ...] pax -rw [-0DdHikLlnOPtuvXYZ] [-G group] [-p string] [-s replstr] [-T range] [-U user] [file ...] directory usage: tar {crtux}[014578befHhjLmOoPpqsvwXZz] [blocking-factor | archive | replstr] [-C directory] [-I file] [file ...] tar {-crtux} [-014578eHhjLmOoPpqvwXZz] [-b blocking-factor] [-C directory] [-f archive] [-I file] [-s replstr] [file ...] usage: cpio -o [-AaBcjLvZz] [-C bytes] [-F archive] [-H format] [-O archive] < name-list [> archive] cpio -i [-6BbcdfjmrSstuvZz] [-C bytes] [-E file] [-F archive] [-H format] [-I archive] [pattern ...] [< archive] cpio -p [-adLlmuv] destination-directory < name-list Empty replacement stringrep_addInvalid replacement string %sInvalid replacement string option %s%s while compiling regular expression %sUnable to allocate memory for replacement stringEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern list inconsistentPattern select out of memoryRemoving leading / from absolute path names in the archive ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Processing continues, name changed to: %s tty_renameProcessing continues, name unchanged. Skipping file. File name %s/%s, too longrep_name%s >> %s >> %s Replacement name too long %s >> %sReplacement name error %sTMPDIR/tmp/Cannot allocate memory for temp file name.Can't open current working directory.can not gzip while appendingCpu time limit reached, cleaning up.Signal caught, cleaning up.LC_TIMEUnable to set up signal handlerUser selection table out of memoryUnable to find uid for user: %sUnable to allocate memory for user selection tableGroup selection table out of memoryCannot determine gid for group name: %sUnable to allocate memory fo group selection tableEmpty time range stringUpper %s and lower %s time overlapIllegal upper time range %sTime range format is: [[[[[cc]yy]mm]dd]HH]MM[.SS][/[c][m]]Illegal lower time range %sBad option %c with time range %sUnable to allocate memory for time rangeImproperly specified time range: %sCannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %schk_ftimeFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryFailed ftime table readFailed ftime table seekCannot allocate memory for interactive rename tableNo interactive rename table, links may failInteractive rename table out of memoryCannot update rename tableCannot allocate memory for device mapping tableDevice map table out of memoryUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryUnable to allocate memory for directory timesCannot canonicalize %sadd_dirUnable to store mode and times for created directory: %swrite_optnodir%s=%s is only supported when writing.Unknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format optiontar_wrFile name too long for tar %sTar header field is too small for %sFile is too large for tar %sTar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for ustar %sUstar header field is too small for uid %lu, using nobodyUstar header field is too small for gid %lu, using nobodyUstar header field is too small for %sustar_wrnobodyFile is too long for ustar %sLink name too long for ustar %sUstar cannot archive a socket %s/dev/ttyFatal error, cannot open %s%s: setresuidDEI:LRS:c:defi:jl:np:qrs:T:t:V:vw:number of packets to transmit is %s: %sbad interface address: %stos value is %s: %srdomain value is %s: %ssetsockopt SO_RDOMAIN%s: only root may use interval < 1sbad timing interval: %spreload value is %s: %spacket size is %s: %sttl value is %s: %smaxwait value is %s: %s-f and -i options are incompatiblebind-R option and -D or -T, or -t to unicast destinations are incompatiblesetsockopt IP_MULTICAST_IFgetsockoptCannot set the receive buffer sizePING %s: %d data bytes ping: recvfromPING %s (%s): %d data bytes Could only allocate a receive buffer of %i bytes (default %i)setsockoptsetsockopt IP_MULTICAST_TTLsetsockopt IP_MULTICAST_LOOPping: record routerecord route not valid to multicast destinationsNo audible output for flood pingsunknown host: %sping: wrote %s %d chars, ret=%d pingerping: sendtopacket too short (%d bytes) from %s unknown option %x LSRR: 0.0.0.0 (truncated route) %s RR: (same route) NOP%d bytes from %s: icmp_seq=%u ttl=%d wrong data byte #%d should be 0x%x but was 0x%x%x (TRUNC!) (DUP!) time=%d.%03d ms%d bytes from %s: %ld packets transmitted, %ld packets received, %.1f%% packet lossround-trip min/avg/max/std-dev = %d.%03d/%d.%03d/%d.%03d/%d.%03d ms -- somebody's duplicating packets!%ld duplicates, --- %s ping statistics --- Echo ReplyDestination Net UnreachableDest Unreachable, Unknown Code: %d Destination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF setfrag needed and DF set (MTU %d) Source Route FailedNetwork UnknownHost UnknownSource IsolatedDest. Net Administratively ProhibitedDest. Host Administratively ProhibitedDestination Net Unreachable for TOSDestination Host Unreachable for TOSRoute administratively prohibitedHost Precedence ViolationPrecedence CutoffSource QuenchRedirect Network(New addr: %s) Redirect, Unknown Code: %dRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostUnknown ICMP type: %d Echo RequestRouter Discovery Advertisement(%d entries, lifetime %d seconds) Router Discovery SolicitationTime exceeded, Unknown Code: %d Frag reassembly time exceededTime to live exceededParameter problem, required option absent: pointer = 0x%02x Parameter problem: pointer = 0x%02x TimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask Reply (Mask 0x%08x) Vr HL TOS Len ID Flg off TTL Pro cks Src Dst Data %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %s %02xTCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xpatterns must be specified as hex digitsusage: ping [-DdEefLnqRrv] [-c count] [-I ifaddr] [-i wait] [-l preload] [-p pattern] [-s packetsize] [-T tos] [-t ttl] [-V rdomain] [-w maxwait] host lost+foundwrong type to dirscan %d DIRECTORY CORRUPTEDNAME=%s fileerror%s=%s DIRLINK COUNT %s COUNT %d SHOULD BE %d (ADJUSTED)ADJUSTLINK COUNT INCREASINGUNREFmkentryUNREF %s RECONNECTSORRY. CANNOT CREATE lost+found DIRECTORYlost+found IS NOT A DIRECTORYREALLOCATElinkupSORRY. CANNOT CREATE lost+found DIRECTORY SORRY. NO lost+found DIRECTORY DIR I=%u CONNECTED. PARENT WAS I=%u SORRY. NO SPACE IN lost+found DIRECTORYNO lost+found DIRECTORYCREATE (CREATED) (RECONNECTED)makeentryNO SPACE LEFT IN %s (EXPANDED)EXPANDLARGE FILES UNSUPPORTED ON REVISION 0 FILESYSTEMSSETTING LARGE FILE INDICATOR SET LARGE FILE INDICATORTRYING TO SET FILESIZE TO %llu ON MODE %x FILE ckinodeDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDSiblockPARTIALLY TRUNCATED INODE I=%ublk %d < cgdmin %d; blk + cnt %d > cgsbase %d blk %d >= cgdmin %d; blk + cnt %d > cgdmax %d bad inode number %d to ginode bad inode number %d to nextinode Cannot allocate space for inode buffer cannot increase directory list cannot find inode %d CLEAR (CLEARED) I=%u OWNER=%u MODE=%o SIZE=%llu MTIME=%12.12s %4.4s %d %s I=%uBAD STATE %d TO BLKERR b:dfm:npyAlternate super block location: %d ** lost+found creation mode %o bad mode to -m: %o -%c flag requires a %s checkfilesysCAN'T CHECK FILE SYSTEM.** Phase 1 - Check Blocks and Sizes** Phase 1b - Rescan For More DUPS%d files, %d used, %d free ***** REBOOT NOW ***** ***** PLEASE RERUN FSCK ***** ***** FILE SYSTEM WAS MODIFIED *****The following zero link count inodes remain: %u,The following duplicate blocks remain: %d,%d blocks missing %d files missing ** Phase 5 - Check Cyl groups** Phase 4 - Check Reference Counts** Phase 3 - Check Connectivity** Phase 2 - Check PathnamesINTERNAL ERROR: dups with -p** Root file system** Last Mounted on %s starting usage: %s [-dfnpy] [-b block#] [-m mode] filesystem ... UNKNOWN FILE TYPE I=%ubad size %llu:INCORRECT BLOCK COUNT I=%u (%d should be %d) (CORRECTED)LINK COUNT TABLE OVERFLOWCONTINUEbad indirect addr: %d bad direct addr: %d bad size %llu ndb %d:HOLD BAD BLOCKINODE I=%u HAS DTIME=%12.12s %4.4sPARTIALLY ALLOCATED INODE I=%uDUP TABLE OVERFLOW.EXCESSIVE DUP BLKS I=%u (SKIPPING)EXCESSIVE BAD BLKS I=%uBAD STATE %d FOR ROOT INODE DUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYCANNOT ALLOCATE ROOT INODE ROOT INODE UNALLOCATEDALLOCATEpass2MISSING '..'FIXBAD INODE NUMBER FOR '..'DIRECTORY TOO SHORTDIRECTORY %s: LENGTH %lu NOT MULTIPLE OF %dMISSING '.'I OUT OF RANGEREMOVEpass2checkUNALLOCATEDBAD TYPE VALUEIS AN EXTRANEOUS HARD LINK TO DIRECTORY%s %s %s (IGNORED)DUP/BADZERO LENGTH DIRECTORYEXTRA '.' ENTRYEXTRA '..' ENTRYCANNOT FIX, INSUFFICIENT SPACE TO ADD '..' CANNOT FIX, SECOND ENTRY IN DIRECTORY CONTAINS %s BAD TYPE VALUE FOR '..'CANNOT FIX, INSUFFICIENT SPACE TO ADD '.' CANNOT FIX, FIRST ENTRY IN DIRECTORY CONTAINS %s BAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'BAD STATE %d FOR INODE I=%d ZERO LENGTHBAD/DUPsummary info for cg %d is %d, %d, %d,should be %d, %d, %d SUMMARY INFORMATIONS WRONG FOR CG #%dBLK(S) MISSING IN BIT MAPS #%dINODE(S) MISSING IN BIT MAPS #%dsummary info bad in superblock: %d, %d should be %d, %d SUPERBLK SUMMARY INFORMATION BADpass5ino_bitmap:ibmap:blk_bitmap:bbmap:BAD STATE %d FOR INODE I=%ld %u: %2x %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. /r%s is not a character device Can't stat %s Can't stat rootmalloc failedrealloc failedstrdup failed%s is not a character device (NO WRITE)cannot allocate space for superblock setupLOOK FOR ALTERNATE SUPERBLOCKSLOCATION OF AN ALTERNATESUPER-BLOCK TO SUPPLY NEEDEDINFORMATION; SEE fsck_ext2fs(8).SEARCH FOR ALTERNATE SUPER-BLOCKFAILED. YOU MUST USE THE-b OPTION TO FSCK_FFS TO SPECIFY THE%s %s %s %s %s %s USING ALTERNATE SUPERBLOCK AT %d WRONG FPG=%d (BPG=%d) IN SUPERBLOCKBAD SUMMARY INFORMATIONcannot alloc %u bytes for blockmap cannot alloc %u bytes for statemap cannot alloc %u bytes for lncntp cannot alloc %u bytes for inphead cannot alloc %u bytes for typemap IMPOSSIBLE RESERVED BLOCK COUNT=%d IN SUPERBLOCKSET TO DEFAULT** File system is already clean %sile system is clean; not checking ** Fstate = %d NO WRITE ACCESS** %sCan't open %s: %s Can't stat %s: %s MAGIC NUMBER WRONGINCOMPATIBLE FEATURE BITS IN SUPER BLOCKcompat 0x%08x, incompat 0x%08x, compat_ro 0x%08x VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEsuperblock mismatchesoffset %ld, original %ld, alternate %ld BAD LOG_BSIZEBAD SUPER BLOCK: %s %s: NOT LABELED AS A EXT2 FILE SYSTEM (%s) %s: CANNOT FIGURE OUT FILE SYSTEM PARTITION ioctl (GCINFO): %s %s: can't read disk label PARTIALLY WRITING %sZERO'ED BLOCK %d TO DISK bad file type 0%o %s? yes %s? [Fyn?] %s? no INTERNAL ERROR: GOT TO reply()cannot allocate buffer pool deadlocked buffer pool CANNOT %s: BLK %dProgram terminated MARKING FILE SYSTEM CLEAN cache missed %ld of %ld (%d%%) MARK FILE SYSTEM CLEANUPDATE STANDARD SUPERBLOCKSPanic: lost %d buffers READTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %ld (%ld), %ld,SEEKWRITETHE FOLLOWING SECTORS COULD NOT BE WRITTEN:returning to single-user after filesystem check catchquitSALVAGE (SALVAGED)UNKNOWN INODESC FIX MODE %d benstuvusage: %s [-benstuv] [file ...] %6d F,lCxCCCCCYCCCȅCC}CXCCCCCCXCXDDDDP$D4D<@DdHDdPDLXDL,Np`DlDxD}D~ZdDXDDDDDDDDDD(D<E({ EEE $E,E@4E%d: wpapsk wpaprotos %swpa2 wpaakms %s802.1x wpaciphers wpagroupcipher powersave on (%dms sleep) (auto) %ddBm%sHIDENWIDNOBRIDGEieee80211_statusSIOCG80211ALLCHANS %4s %-8s %s freqproperties %4d %4d MHz passive scanieee80211_listchans no permission to scanSIOCG80211ALLNODES none restoreieee80211_listnodesnwid chan %u bssid %s lladdr %s %udB %u%% powersave %uMESSIBSSCF_POLLABLECF_POLLREQPRIVACYSHORT_PREAMBLEPBCCCHNL_AGILITY SPECTRUM_MGMT QOS SHORT_SLOTTIME APSDDSSSOFDMDELAYED_B_ACKIMMEDIATE_B_ACKCACHEBSSAUTHASSOCCOLLECTSIOCGIFMEDIA%s: no link type?init_current_mediaonly one `media' command may be issuedmay not issue `media' after `mode' commandsmay not issue `media' after `mediaopt' commandsonly one `mode' command may be issuedinvalid media mode: %sonly one `mediaopt' command may be issuedmay not issue `mediaopt' after `instance'only one `-mediaopt' command may be issuedmay not issue both `media' and `-mediaopt'only one `instance' command may be issuedmust specify `media' before `instance'media instance %s: %sEthernetetherFDDIIEEE802.11TDMCARPautoselectmanual10baseT10baseT/UTP10UTP10base210base2/BNC10BNC10base510base5/AUI10AUI100baseTX100TX100baseFX100FX100baseT4100T4100baseVG100VG100baseT2100T21000baseSX1000SX10baseSTPSTP10STP10baseFLFL10FL1000baseLX1000LX1000baseCX1000CX1000baseT1000T1000baseTX1000TXHomePNA1HPNA110GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10GbaseCX410GCX410GBASE-CX42500baseSX2500SX10GbaseT10GT10GBASE-T10GSFP+Cu10GCuSingle-modeSMFMulti-modeMMFCDDIFH1FH2DS2DS5DS11DS1DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72t1t1-amie1e1-g.704e1-amie1-ami-g.704t3t3-m13e3e3-g.751e3-g.832e1-g.704-crc411a11b11gfhmasterfull-duplexfdxhalf-duplexhdxflag0flag1flag2loopbackhw-loopbacklooprxpausetxpausedual-attachdasadhochostapibssibss-mastermonitorturbohdlc-crc16pppframerelay-ansiframerelay-ciscoframerelay-ituunknown %s media subtype: %sunknown %s media mode: %sunknown %s media option: %smedia mode %smediaopt instance %d physical address inet%s %s --> %s rdomain %dphys_statusno carrieractiveno ringinsertedno networkbackupUPBROADCASTDEBUGLOOPBACKPOINTOPOINTNOTRAILERSRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST rdomain %i metric %lu mtu %lu lladdr %s description: %s %s: no media types? media: status: supported media: inet %sSIOCGIFNETMASKSIOCGIFDSTADDR --> %s netmask 0x%xSIOCGIFBRDADDR broadcast %sin_status inet6 %sSIOCGIFDSTADDR_IN6 -> %sSIOCGIFNETMASK_IN6 prefixlen %dSIOCGIFAFLAG_IN6 anycast tentative duplicated detached deprecated autoconf scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime infty vltime in6_alias vlan: %d priority: %d parent interface: %s vlan_statusvlan tag %s: %sSIOCGETVLANSIOCSETVLANsetvlantagvlan priority %s: %sSIOCGETVLANPRIOSIOCSETVLANPRIOsetvlanprioinvalid vlan tag and device specificationsetvlandevunsetvlandev%i%i: bad prefixlenin_getaddrprefix %s: %s%s=%o%s=%xin6_getaddrusage: ifconfig [-AaC] [interface] [address_family] [address [dest_address]] [parameters] getifgroupsSIOCGIFGROUP groups:malformed link-level addressSIOCSIFLLADDRCOLUMNS1ACFLRSTacdfghiklmnopqrstux%s: %s: %s: directory causes a cyclefts_readdisplay%*s%*qd printlong%3d, %3d %-*s %*qd %*u total %lu %s %*u %-*s printlink ls: %s: %s %*s usage: %s [-1AaCcdFfghikLlmnopqRrSsTtux] [file ...] kern.osreleasehw.machinehw.modelhw.disknameshw.ncpufound%s=usage: sysctl [-n] name mainifconfigmake_packetrtsol_check_timerrtsol_timer_updatesockopensendpacketrtsol_inputinterface_upinterface_statuslladdropt_fill)get_llflagprobe_initdefrouter_probesendprobeadDfFm1O:failed to open a socketfailed to initialize interfacesselect: %sfailed to setup for probing routersfailed to initialize %skernel is configured as a router, not a hostkernel is configured not to accept RAsadDFO:memory allocation failedinterface %s was already configuredfailed to get link layer information for %slink-layer address option has null length on %s. Treat as not included.memory allocation failed for %sNew timer is %ld:%08ldthere is no timer%s status is changed from %d to %dNo answer after sending %d RSstimer expiration on %s, state = %dset timer for %s to %d:%dstop timer for %sillegal interface state(%d) on %susage: rtsold [-1DdFfm] [-O script-name] interface ... rtsold [-1DdFfm] -a usage: rtsol [-DdF] [-O script-name] interface ... rtsol [-DdF] -a <%s> %swarnmsgprobing %sreallocmultiple interfaces foundff02::2inet_pton failed for %ssetsockopt(ICMP6_FILTER): %sIPV6_RECVHOPLIMIT: %sIPV6_RECVPKTINFO: %ssocket: %smalloc for send msghdr failedmalloc for receive msghdr failedsend RS on %s, whose state is %dsendmsg on %s: %ssendpacketfailed to get receiving interfacertsol_inputinvalid icmp type(%d) from %s on %sinvalid RA with hop limit(%d) from %s on %sinvalid RA with non link-local source from %s on %sreceived RA from %s on %s, state is %dreceived RA from %s on an unexpected IF(%s)invalid icmp code(%d) from %s on %spacket size(%zd) is too shortfailed to get receiving hop limitrecvmsg: %schecking if %s is ready...interface_up%s is duplicated%s is tentative%s is readyget_llflag() failed, anyway I'll tryioctl(SIOCSIFFLAGS): %sioctl(SIOCGIFFLAGS): %sinterface_statusioctl(SIOCGIFMEDIA) on %s: %sioctl(SIOCGIFFLAGS) on %s: %sunsupported link type(%d)get_llflagioctl(SIOCGIFAFLAG_IN6): %sgetifaddrs: %ssocket(SOCK_DGRAM): %sshutdown: %slo0defrouter_probedefault router list contains a non-link-local address(%s)ioctl(SIOCGDRLST_IN6): %sprobe a router %s on %ssendprobeTTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftinvalid namelen:%d/%luno nameunknown qtyperefused???unknown, type 0x%xrefused, type 0x%x%d bytes from %s, icmp_seq=%u hlim=%d(DUP!) time=%g ms dst=%sfailed to get receiving packet informationa:b:c:dEefHg:h:I:i:l:mnNp:qRS:s:tvwW-R is not supported in this configurationinvalid source address: %sinvalid socket buffer sizeillegal number of packets -- %sMust be superuser to flood pingillegal hoplimit -- %sillegal hoplimit %stoo small interval, raised to 0.01illegal timing interval %sillegal preload value -- %sMust be superuser to preloaddatalen value too large, maximum is %dillegal datalen value -- %sgetaddrinfo failedsetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionsUnable to allocate packetsetsockopt(IPV6_USE_MIN_MTU)setsockopt(ICMP6_FILTER)%s: invalid interface namesetsockopt(SO_SNDBUF)PING6(%lu=40+8+%lu bytes) %s --> new path MTU (%d) is notified recvmsgpollsetsockopt(IPV6_RECVHOPLIMIT)setsockopt(IPV6_RECVPKTINFO)setsockopt(SO_RCVBUF)you need -b to increase socket buffer sizeUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP setsockopt(IPV6_RTHDR)UDP connectgetsocknamecan't initialize rthdrbad addr family of an intermediate addrcan't add an intermediate nodecan't allocate enough memorysetsockopt(IPV6_RECVRTHDR)setsockopt(IPV6_RECVPATHMTU)IPV6_MULTICAST_HOPSgateway resolves to multiple addressestoo many intermediate hopsgetaddrinfo for the gateway %s: %sping6: wrote %s %d chars, ret=%d sendmsg\%03odnsdecodeinvalid peernamepr_packunknown code 0x%x, type 0x%xNodeInfo NOOP HbH Options: Dst Options: Routing: nxt %u, len %u (%lu bytes) Received Opt %u len %lu Jumbo Payload Opt: Length %u Router Alert Opt: Type %u nxt %u, len %u (%d bytes), type %u, %d segments, %d left pr_rthdr [%d] [%d]%s segments unknown, -%uNodeInfo Supported Qtypes, compressed bitmap, raw bitmap %s(TTL=%u)pr_nodeaddr(TTL=infty) no address truncatedpath MTU for %s is notified. (ignored) --- %s ping6 statistics --- round-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms %.1lf%% packet loss+%ld duplicates, IPv6 addressDNS labelIPv4 addressSuccessRefusedNo Route to Destinationpr_icmphDestination Unreachable, Bad Code: %d Destination Administratively UnreachableDestination Unreachable Beyond ScopePacket too big mtu = %d Time exceeded, Bad Code: %d Parameter problem: Bad code(%d) pointer = 0x%02x Erroneous Header Unrecognized Option Unknown Nextheader Listener QueryListener ReportListener DoneRouter SolicitationRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementRedirectDestination: %s New Target: %sBad ICMP type: %dNode Information QueryNOOP, invalid, oldfqdn, subject=%s(%s), no subject, subject=%s(invalid)Supported qtypesDNS namenodeaddrIPv4 nodeaddrNode Information Reply, %sVr TC Flow Plen Nxt Hlim %1x %02x %05x %04x %02x %02x %s->pr_iphHBH RTHDR FRAG ESPAH ICMP6: type = %d, code = %d Unknown Header(%d) DSTOPT IP6ff02::2:0000:0000nigroupusage: ping6 [-dEefHmNnqtvWw] [-a addrtype] [-b bufsiz] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [hops ...] host ioctl SMODEmmapWSMOUSEIO_SCALIBCOORDS/dev/ttyC0open /dev/ttyC0/dev/wsmousemouse.scale=%d,%d,%d,%d,%d,%d,%d WSMOUSEIO_GCALIBCOORDSopen /dev/wsmouseusage: %s ?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for dataLESSSECURELESS-E-G-L-mMORE--WARNING: terminal is not fully functionalCannot allocate memoryticdcmsomdmbvbbc|^srget_termraw_modeLESS_TERMCAP_ltget_envLINESlicokrklkukdkPkNkh@7kDTERMhcxndadbsgpcNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketseek errorread errorch_ungetchar overrunseek error to 0ESC^%c*s<%X>Non-match First-file EOF-ignore Keep-pos Regex-off (P)+ [Press space to continue, 'q' to quit.]less %sungetcc overflowPattern not found help(N-th) No %snext fileNo %sprevious fileNo such filemark: goto mark: Command not availableBrackets: [Press 'h' for instructions.]Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableeditchar"%s" may be a binary file. See it anyway? Missing filename ("less --help" for help)LESSMETAESCAPE\LESSMETACHARS; *? '"()<>|&^`#\%c%s%c%s%s%sHOMEbin_file%s %s %sLESSOPENLESSCLOSE...skipping... Cannot find help fileCannot seek to end of fileCannot seek to beginning of fileCannot seek to line number %nDetermining length of fileDon't know length of fileCannot seek to that file positionLESSANSIENDCHARSplinenum~ Calculating line numbers (press RETURN)Invalid mark letterMark not setMark not in current fileLine number is required after -lless Copyright (C) 2002 Mark Nudelman less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Homepage: http://www.greenwoodsoftware.com/less Tab stops and then every %d spacesopt_x-" must be followed by 1 or 2 charsquotes %sUse "h" for helpThere is no %s option ("less --help" for help)There is no %s optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric option-%sValue is required after %sNumber is required after %sfakeSearch includes displayed screenSearch skips displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by clearing each lineRepaint by painting from top of screenAssume intelligent terminalAssume dumb terminalDon't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesAllow help commandDon't allow help commandCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: Position target at screen line %dDon't display a status columnDisplay a status columnDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numbersprompt: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directlyDisplay control characters directly, processing ANSI sequencesDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linesDisplay underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: Horizontal shift %d positionsUse keypad modeDon't use keypad modeBe less helpful in promptsBe helpful in promptspostoalinenumtoainttoaiprint_intiprint_linenumap_posap_linenumap_intNo previous regular expressionInvalid patternPlease re-enter search patternNothing to searchLine numbers turned offmm(kn nn nD(n0n8nr@ngtĊ t@̊Ԋtt؊ @uu0u: or @ spechostname too longusage: %s [-23bcdilsTU] [-a maxreadahead] [-g maxgroups] [-I readdirsize] [-o options] [-R retrycnt] [-r readsize] [-t timeout] [-w writesize] [-x retrans] rhost:path node unused DOS FAT-12 XENIX / XENIX /usr DOS FAT-16 Extended DOSDOS > 32MB NTFS AIX fs AIX/Coherent OS/2 Bootmgr Win95 FAT-32 Win95 FAT32LDOS FAT-16 Extended LBAOPUS OS/2 hidden Compaq Diag.OS/2 hidden OS/2 hidden OS/2 hidden AST swap Willowtech ThinkPad Rec Willowsoft $NEC DOS 'Win Recovery8Theos 9Plan 9 @VENIX 286 ALin/Minux DRBLinuxSwap DRCLinux DR MQNX 4.2 Pri NQNX 4.2 Sec OQNX 4.2 Ter PDM QDM RCP/M or SysVSDM TOntrack UEZ-Drive VGolden Bow \Priam aSpeedStor cISC, HURD, *dNetWare 2.xxeNetWare 3.xxfNetWare 386 gNovell hNovell iNovell pDiskSecure uPCIX Minix (old) Minix (new) Linux swap Linux files*OS/2 hidden Linux ext. NT FAT VS NTFS VS Linux LVM Amoeba FS Amoeba BBT Mylex BSDI NotebookSaveFreeBSD OpenBSD NEXTSTEP MacOS X NetBSD MacOS X bootMacOS X HFS+BSDI filesy*BSDI swap Solaris CTOS DRDOSs FAT12DRDOSs < 32MDRDOSs >=32MHPFS DisbledCPM/C.DOS/C*Dell Maint SpeedStor SpeedStor SpeedStor BeOS/i386 EFI GPT EFI Sys SpeedStor DOS 3.3+ SecSpeedStor Xenix BBT ZYo8~+$ ''d gPphܿ~b;܇1\)"Ͼo~4=[J/F*2KjUxkG λ.nއ~F^==q{Ee^DE"QZT<[298x x~_O) ^6x$1󂙷y̋f^:™f^>”I~aX_̼̬1=^'3oΣ 76x1U5䯼/GuubD4LC)2VQ̕_Y.z"[)YVyJ#l@%.DXܦAo濁`gGR Bw ,BE VAHkíQht|*#څ"Jw1^2W%EG/J+ID E 2}9^S!5A5*`˛g2-+AwIT囎xQytb,R6I0?jZ*( b#YȂQ n)Sk&l'pOO2(íGQF,}ɂ2I €RLc2 ;5oq Zck,7A5BbtUGE7k+*7,˹F,& yd*^dJrjQk<7"g{7lU%ݫQs%ce n@QTh``_"Jhjƃ-H/d鄐Q1ZIT(ZPDxfe2)1\7VEYV7ZDN2eNEhvO9h}A(B) Rv|doF(x^n6ԅ, "#e 8(JA7+xHp^Fqa؆Re%mTWY ?g 40= \m+iZy/2.Iͼ.d ZC@5-SUٲ)ɍo* &Y-6;ފ1tVkbδ  BҀWK 90Srpl]ͼwߋw7?`z}PiK{p[ F!-%LB" WB C06,nɦYT YE %)P49W'wHHPF$i[ @*|x55a xVHrmN#īMzq_|cxx8z\'8ںpe {m?G ~1vdY"D]AMFlP6bT9lS4Ѹd}þ3'0w_ߥ J*kD4ןɂ̤fT'5?Œd!Ӿ SH;Lt2(dYa`)ǤOOC ؿ0 xzMo>= TLq\9풜ydEf[P~ZK0bAw81񦪥ٝSmyJ5*R*gZT!vCd2!xA2nJi ,Ե(?Ã\VM7;όEsSo-40H6q!Ҭ;G^W8: 9lѰB90K us$.hp}cBmh{sztxqfvwdxPgAoǭw\e-|+ZTiN (3t*;3;ͅ*z̎!֝JǦq>bY=.ܼo&'d4/I)1NH)4qҰ?2319?o8>P'^Z~,טay˗؟;d?0~&IOO}yI|>>%Y/e6fq"8#2mE#SW/8n lH,"lQj"73}gw W(Q}߷4"YK-uw[KVeo-,cZlf_ YϬVݕWսw{]ywr#пΜyzт(KQXQ䃶.̳d]֙#1")X>::';m.7ojGJLm(=1ri`抭)QM= b-u LSW>%uqpSpUtVsvӹEkEMk鍣1@zw:wؐ<әUp7LBG9cK- 9q V*^>&Ӂ@ݶ<.Vݶ:A6ܶӰkZtxjJ;Fug5E4**,Y!dU "*+ΑAu Dd%%řmEuYKZ7'N^{Hk@*H A)Yѯ"Ӷ,6xaTWQ103tRzDHyOW4G/hluۭzCj$Ã=KY(H:|5D]ijvӬsuG7su{tmf'wbm{tf{HU+ɴh]f!R&`h+mQ"J4R]A^&ܢ0E|-WoPwobhAAR)|O%| ?;p`)9{O&!Vm܋FGx7Fsc|93&͏FL&xmOcիnOHIei4X^,sgU\?3x+> r r USER_modifyAborting changes to current MBR.Invalid command '%s'. Try 'help'. Offset: %d USER_print_diskBytesSectorsKilobytesMegabytesGigabytesask_cmd%s [%X - %X]: [%X] %s [%d - %d]: [%d] (? for help) ask_num'%d' is out of range. '%s' is not a valid number. %s [n] %s: [%u] Rounding to nearest cylinder: %u %s is not a character device or a regular fileDISK_getlabelmetricsDIOCGDINFODisk: %s geometry: %d/%d/%d [%.0f %d-byte %s] geometry: Signature: 0x%X MBR_pcopyChoose from the following Partition id values:%02X %s %02X %s %02X %s %02X %s Warning CHS values out of bounds only saving LBA values Starting Ending LBA Info:%c%1d: %.2X %6u %3u %3u - %6u %3u %3u [%12u:%12.0f%s] %s #: id C H S - C H S [ start: size ]-------------------------------------------------------------------------------Start of partition #%d after end!In memory copy is initialized to:Use 'write' to update disk.XreinitChange disk geometry?BIOS CylindersBIOS HeadsBIOS SectorsInvalid argument: %s Invalid partition number %d. Swap with what partition?%d same partition as %d, doing nothing. Invalid argument: %s Invalid partition number.Partition id ('0' to disable) Partition %d is disabled. Do you wish to edit in CHS mode?Size of the partition.BIOS Starting cylinderBIOS Starting headBIOS Starting sectorBIOS Ending cylinderBIOS Ending headBIOS Ending sectorLoop to offset 0! Not selected.Selected extended partition %d New MBR at offset %d. Partition %d is not an extended partition. Writing MBR at offset %d. Xwriteerror writing MBR %s %s Machine code updated.Partition %d flag value set to 0x%x. Partition %d marked active. Invalid argument: %s [value] (standard input)(fd %d)invalid file type^\((%s[[:<:]]%s%.*s%s[[:>:]]%susage: %s [-abcEFGHhIiLlnoPqRSsUVvwx] [-A num] [-B num] [-C[num]] [-e pattern] [-f file] [--binary-files=value] [--context[=num]] [--line-buffered] [pattern] [file ...] 0123456789A:B:CEFGHILPSRUVabce:f:hilnoqrsuvwxybinary-filesline-bufferedafter-contextbefore-contextextended-regexpfixed-stringsbasic-regexpbinarytextbyte-offsetregexpno-filenameignore-casefiles-without-matchfiles-with-matchesline-numberquietsilentrecursiveno-messagesrevert-matchword-regexpline-regexpunix-byte-offsetscontext out of rangegrep version %u.%u without-matchUnknown binary-files optionBinary file %s matches [[:<:]][[:>:]]afh:t:v%s: not a directory or special deviceumountfsBad MNT RPC%s: unmount from %s %s: not currently mountedusage: %s %s umount [-fv] special | nodeumount -a [-fv] [-h host] [-t type]mm(kn nn nD(n0n8n@nsl9xu:g:m:o:not an MSDOS filesystemstat %sunknown group id: %sunknown user id: %sinvalid file mode: %susage: mount_msdos [-9lsx] [-g gid] [-m mask] [-o options] [-u uid] special node start %s %swait %scheckfs%s/fsck_%sexec %sCan't get resource limit for data sizeCan't get resource limit to max data sizedvpfnyb:l:T:t:-b %s%s: unknown special file or file system.fsck_%snoInvalid option stringusage: %s [-dfnpvy] [-b block#] [-l maxparallel] [-T fstype:fsoptions] [-t fstype] [special | node ...] UNEXPECTED INCONSISTENCY:THE FOLLOWING FILE SYSTEM%s HAD AN %s %s: %s (%s)%sCan't open checklist file: %s/etc/fstabBAD DISK NAME %s pass %d, name %s Unknown pid %ld%s: %s (%s): EXITED WITH SIGNAL %d done %s: %s (%s) = %x disk %s: %s in fstab more than once!usage: sha256 outfile mkfifom:invalid file mode.non-numeric major number.non-numeric minor number.major or minor number too largenode must be type 'b' or 'c'.usage: %s [-m mode] fifo_name ... usage: %s [-m mode] name [b | c] major minor %s [-m mode] name p WG(WW4WUUU W W W4,UGHRBD M@dmCXLS1@2 3cJPT0123456789abcdefentry in usenot in tablerouting table overflow: gateway %s (%s)netmask missing-in requires -mpls-mplslabel requires -inet or -inet6-out requires -mpls-out requires -push, -pop, -swap-pop requires -mpls-push requires -mpls-swap requires -mplsblackholechangecloningdstencapexpiregatewaygenmaskhopcountifaifpjumbollinfolocklockrestmpathmplslabelnetnojumbonostaticpopproto1proto2pushrecvpiperejectrttrttvarsasendpipeshowssthreshstaticxresolvekeepalive downbotched keyword: %susage: %s [-dnqtv] [-T tableid] command [[modifiers] args] commands: add, change, delete, exec, flush, get, monitor, show dnqtT:v/dev/nullroute-sysctl-estimate%-20.20s donewrite to routing socketgot only %d for rlen Examining routing table from sysctl(address family %s) actual retrieval of routing tablemust be root to alter routing tableno such interface %spriority is %s: %sking bula sez: set_metric with invalid keyset_metric: %s is %sinet6_makenetandmask128%s: resolved to multiple values%s: bad address%s: not a network%d: bad address familympls labels require -in or -out switchinternal errorbad label: %s is %sprefixlen is not supported with af %dprefixlen %s is %sactual retrieval of interface tablegot message of size %d on %sread from routing socketwriting to routing socketso_srcso_labelso_ifaso_ifpso_genmaskso_maskso_gateso_dstRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics or flagsRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_RESOLVE: Route created by cloningRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_IFINFO: iface status changeRTM_IFANNOUNCE: iface arrival/departure[#%d]routing message version %d not understoodprint_rtmsg%s: len %d, if# %d, link: %s, flags:name: %s, priority %d, table %u, pid: %ld, seq %d, errno %d flags: use: %8llu mtu: %8u%c expire: %8d%cmetric %d, flags:if# %d, name %s, what: departurearrivalconnectedospfis-isbgp route to: %s destination: %s mask: %s interface: %.*s if address: %s priority: %u (%s) flags: label: %s use mtu expire%8llu %8u%c %8d%c sockaddrs: gateway: %s RTM_GET: %s (errno %d)message length mismatch, in packet %d, returned %d locks: inits: sockaddrs: sodump%s: inet %s; %s: inet6 %s; %s: link %s; label too longinvalid table id: %ssetrdomainsysctl of routing tableRouting tables Encap:sysctl of spdspd-sysctl-estimateGatewayFlagsRefsUseMtuPrioIface%-*.*s %-*.*s %-6.6s %5.5s %8.8s %5.5s %4.4s %s InterfaceIn labelOut labelOp%-16s %-10s %-6s %-18s %-6.6s %5.5s %8.8s %5.5s %4.4s %s PortProtoSA(Address/Proto/Type/Direction)Source%-18s %-5s %-18s %-5s %-5s %-22s p_rtentry%-6.6s %5u %8llu %5u %5s %2d %.16sInternet Protocol Family %d: AppleTalkInternet6EncapMPLS%-*s %-5u %-*.*s %-5u %-6u/esp/use/in/out///acquire/require/bypass/deny/dontacq/ah/ipip/ipcomp%-*.*s p_sockaddr_mplsp_flagsroutename(%d) %s%u.%u.%u/%d%u.%u.%u.%u/%d%u.%u/%d%u/%d%s/%dnetname6illegal prefixlenaf %d: %slink#%dLOCALPOPPUSHSWAP%-16s %-10slabel_print KMGTPUser-Agent: OpenBSD ftpGET %s HTTP/1.0 Proxy-Authorization: Basic %s%s %s GET %s HTTP/1.0 %s%s HTTP/1.0GET /%s %s Host: Can't allocate memory.[%s]:%s %s%s Writing HTTP requestToo many redirections requestedError retrieving file: %sContent-Length: Location: Redirected to %s Can't open %sCan't allocate memory for transfer bufferReading from socketRead short file. Auto-login using ftp URLs isn't supported when using $ftp_proxyReceiving HTTP replyWriting %sImproper response from %surl_getExtra `@' characters in usernames and passwords should be encoded as %%40 <>"#{}|\^~[]`%%%02xreceivedCan't allocate memory to parse URLhttp://ftp://file:url_get: Invalid URL '%s'No `/' after host (use -o): %sNo filename after host (use -o): %sNo filename after directory (use -o): %sCan't allocate memory for proxy URL.Malformed proxy URL: %serror in base64 encodingCan't open file %sReading from file(unknown)Trying %s... r+Requesting %s (via %s) http fetch aborted. file fetch aborted. ftp_proxyhttp_proxyCan't allocate memory for auto-fetch.Invalid URL: %sCan't connect or login to host `%s'*?[]{}NLSTRetrieving %s/%s mgetauto_fetchCan't allocate memory for URL decoding:/ftpgatehttp%s: bad port number `%s'connect to address %ssetsockopt TOS (ignored)fdopen failed.Connected to %s. hookupNo control connection for command.QUIT%c%c%c421 Service not available, remote server has closed connection. getreply receive aborted waiting for remote to finish abort. RETRlocal: %s remote: %s local: %sREST %lld%s: short writeWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. netin: %slocal: %s: %sCan't change modification time on %s to %suse of scoped address can be troublesomeEPSVwrong server: return code must be 229 PASVLPSVPassive mode refused. wrong server: return code must be 227 %u,%u,%u,%u,%u,%uwrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode AF mismatch. Shouldn't happen! %c%c%c%d%cparse error! setsockopt (reuse address)setsockopt IP_PORTRANGE (ignored)setsockopt IPV6_PORTRANGE (ignored)listenEPRT |%d|%s|%s|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dinitconnacceptdataconnSTOUSTORproxy server does not support third party transfers. No primary connection. PORT %slocal: %s remote: %s resetrunique: can't find unique file name. Forced abort. The connection will be closed. Lost control connection for abort.%cABOR abort_remoteNeither $FTPSERVER nor $GATE_SERVER is defined; disabling gate-ftpdumbemacssukeep alive amount is %s: %sretry amount is %s: %s46AaCc:dEegik:mno:pP:r:tvVFTPSERVERPORTFTPMODEpassivegateunknown FTPMODE: %s. Using defaultsgate-ftpFTPSERVERusage: %s [-o output] ftp://[user:password@]host[:port]/file[/] ... %s [-o output] http://host[:port]/file ... %s [-o output] file:file ... %s [-o output] host:/file[/] ... | Using %s mode to transfer files. %s: unknown mode. TYPE %s %sTYPE %sasciiimageebcdictenexusage: %s [internal error: unknown type %d.a+wgetitcan't get cwdSkipping non-relative filename `%s' CWD %sCWD command not recognized, trying XCWD. XCWD %snmap: unbalanced brackets. %-*.*s%s %3d%% %3d%% *************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************|%.*s%*s| %5lld %c%c %2d:%02d:%02d --:-- ETA - stalled -%02d:%02d ETAprogressmeterAlready connected to %s, use close first. gateserver not defined (shouldn't happen)PASSERVE %sConnected via pass-through server %s non-printstreamSYSTRemote system type is %s. 215 UNIX Type: L8215 TOPS20Remember to set tenex mode when transferring binary files from this machine. anonymous%s@Name (%s): Name (%s:%s): USER %sPassword:PASS %sAccount:ACCT %sLogin %s failed.ftp_loginunable to create temporary file: %sftpXXXXXXXXXXLISTcan't find list of remote files, oops.can't find list of remote files, oops. remglob2%s: not foundSIZE %sMDTM %s191Y2K warning! Fixed incorrect time-val received from server. %*s %04d%02d%02d%02d%02d%02dCan't convert %s to a time. Unable to determine real path of `%s'fileindir%lld byte%s %s in %.2f seconds (%.2f %sB/s) ETA: %02d:%02d:%02d ptransfer/etc/rcWARNING: some process(es) wouldn't die(can't restart init): SIGTERM processes/dev/consolesetsidrevokeSIGTSTP inithalted (with powerdown) by %shalted by %srebooted by %sdlnpq~usage: %s [-dn%sq] mm(kn nn nD(n0n8nr@g@nrrreloadfilesystem must be mounted read-only; you may need to run fsckusage: mount_ffs [-o options] special node YD"% b &piaddr%d bad IP checksums seen in %d packets%d udp packets in %d too long - dropped%d bad udp checksums in %d packetssubnet-masktime-offsetIAtime-serversien116-name-serversdomain-name-serverslog-serverscookie-serverslpr-serversimpress-serversresource-location-servershost-nameboot-sizemerit-dumpdomain-nameswap-serverroot-pathextensions-pathip-forwardingnon-local-source-routingpolicy-filterIIAmax-dgram-reassemblydefault-ip-ttlpath-mtu-aging-timeoutpath-mtu-plateau-tableSAinterface-mtuall-subnets-localbroadcast-addressperform-mask-discoverymask-supplierrouter-discoveryrouter-solicitation-addressstatic-routestrailer-encapsulationarp-cache-timeoutieee802-3-encapsulationdefault-tcp-ttltcp-keepalive-intervaltcp-keepalive-garbagenis-domainnis-serversntp-serversvendor-encapsulated-optionsnetbios-name-serversnetbios-dd-servernetbios-node-typenetbios-scopefont-serversx-display-managerdhcp-requested-addressdhcp-lease-timedhcp-option-overloaddhcp-message-typedhcp-server-identifierdhcp-parameter-request-listBAdhcp-messagedhcp-max-message-sizedhcp-renewal-timedhcp-rebinding-timedhcp-class-identifierdhcp-client-identifieroption-62option-63nisplus-domainnisplus-serverstftp-server-namebootfile-namemobile-ip-home-agentsmtp-serverpop-servernntp-serverwww-serverfinger-serverirc-serverstreettalk-serverstreettalk-directory-assistance-serveruser-classoption-78option-79option-80option-81option-82option-83option-84nds-serversnds-tree-namends-contextoption-88option-89option-90option-91option-92option-93option-94option-95option-96option-97option-98option-99option-100option-101option-102option-103option-104option-105option-106option-107option-108option-109option-110option-111option-112option-113option-114option-115option-116option-117option-118option-119option-120option-121option-122option-123option-124option-125option-126option-127option-128option-129option-130option-131option-132option-133option-134option-135option-136option-137option-138option-139option-140option-141option-142option-143option-144option-145option-146option-147option-148option-149option-150option-151option-152option-153option-154option-155option-156option-157option-158option-159option-160option-161option-162option-163option-164option-165option-166option-167option-168option-169option-170option-171option-172option-173option-174option-175option-176option-177option-178option-179option-180option-181option-182option-183option-184option-185option-186option-187option-188option-189option-190option-191option-192option-193option-194option-195option-196option-197option-198option-199option-200option-201option-202option-203option-204option-205option-206option-207option-208option-209option-210option-211option-212option-213option-214option-215option-216option-217option-218option-219option-220option-221option-222option-223option-224option-225option-226option-227option-228option-229option-230option-231option-232option-233option-234option-235option-236option-237option-238option-239option-240option-241option-242option-243option-244option-245option-246option-247option-248option-249option-250option-251option-252option-253option-254option-endpadvalue %s%o exceeds max (%d) for precision.value %s%x exceeds max (%d) for precision.value %s%u exceeds max (%d) for precision.Unexpected integer size: %dfilename must be a stringno memory for string %s.expecting a network hardware typeExpecting numeric lease timeno space for numeric aggregatenumeric aggregate too short.Bogus number: %s: digit %d not in base %dBogus number: %s.numeric day of week expected.numeric d9fb269a4200cbabad132a41a31e7b8ceb73897e6b353fbb203c864947ddf88b A ...B . ..C binDmdec-\sbin-\share\C .B .. ftpgrepnfgrepnegrepngzipngunzipgzcatnlessnmoren\sedD .B..E ...F . .. bsd base47.tgz comp47.tgz etc47.tgz+ misc47.tgz man47.tgz+x game47.tgz0d367464290345a69ba534f95549dabcbec85e9b1d001d59a54a55f72658f67a year expected.expected slash separating year from month.numeric month expected.expected slash separating month from day.numeric day of month expected.numeric hour expected.expected colon separating hour from minute.numeric minute expected.expected colon separating minute from second.numeric second expected.buf_open: %mbuf_add: %mbuf_close (connection closed)buf_close (short write): %mbuf_close: %mbuf_read (short read): %mbuf_read: %mcorrupted message receivedreceived unknown message, code %ddispatch_imsgcannot seek temp filecannot read temp fileline too longcannot write temp fileinvalid address/tmp/ed.XXXXXXXXXXw+cannot open temp filecannot close temp fileinvalid pattern delimiterunexpected end-of-fileno previous command& cannot open input filecannot close input filenewline inserted newline appended cannot read input filecannot open output filecannot close output filecannot write filecannot read stdin\  \abfnrtv\script, line %d: %s usage: %s [-] [-sx] [-p string] [file] crypt unavailable ? p:sx ? interrupt? invalid filenamewarning: file modifiednumber out of rangeinvalid redirectioncannot nest global commandsinvalid destinationno previous substitutiondestination expectedunexpected command suffixno current filenamecrypt unavailableinvalid command suffixunexpected addressno matchfilename too longshell access restrictedinvalid mark charactered.hup/ed.hupno previous patternunbalanced brackets ([])trailing backslash (\)infinite substitution loopnothing to undoHLPRfiprthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s%s: name too long (not copied)%s is a directory (not copied).cannot overwrite directory %s with non-directory %s%s and %s are identical (not copied).overwrite %s? readlink: %sunlink: %scopy_linksymlink: %smkfifo: %smknod: %schown: %schmod: %schflags: %sutimes: %slchown: %susage: %s [-fip] [-R [-H | -L | -P]] source target %s [-fip] [-R [-H | -L | -P]] source ... directory p#x#|#ELXNG `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @      #+3;CScs !1Aa  0@`@@''`#|''''''`#%s not a regular file%s%s already has %s suffix -- unchanged%s: unknown suffix: ignored%s%s: name too long%s: input: %sdeflate.gz123456789ab:cdfghLlNnOo:qrS:tVvcfhlNno:qrtVvfghqrzcatzipunknown program nameGZIPGZIP is too longoption -a is ignored on this systemillegal bit count -- %s-o argument is too long-o option may only be used with a single input filemay not mix -o, -c, or -t options%s is a directory: ignored: unchangedcompression not supported%s: won't read compressed data from terminal%s: unrecognized file formatcrc errordodecompressfchown: %sfchmod: %sfchflags: %sfutimes: %sZgzztgztaz.-_method crc date time compressed uncompressed ratio uncompressed_name%-7.7s %08x %s %10lld %10lld %4.1f%% %s %10lld %10lld %4.1f%% (totals) OK %4.1f%% -- replaced with %s %lld bytes in, %lld bytes out usage: %s [-123456789cdfghLlNnOqrtVv] [-b bits] [-o filename] [-S suffix] %*s [file ...] usage: %s [-cfhlNnqrtVv] [-o filename] [file ...] usage: %s [-fghqr] [file ...] 1.2.3put_headerfile errorstream errordata errorinsufficient memorybuffer errorincompatible versionneed dictionarystream endHLPRXfghorstuwxinvalid flags: %sinvalid flag: %sthe -R and -h options may not be specified together.user is %s: %sgroup is %s: %susage: %s [-R [-H | -L | -P]] %s file ... %s [-fh] [-R [-H | -L | -P]] :group file ... owner[:group]usage: %s [-fh] [-R [-H | -L | -P]] %s file ...   @?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@dirscanexpanddirbad size: blk %lld, offset %lld, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock.fs_fpg %d cannot allocate memory for inode cache cannot increase directory list%lld %s I=%uCG %d: BAD MAGIC NUMBER dfpnNyYb:c:m:conversion levelusage: %s [-fnpy] [-b block#] [-c level] [-m mode] filesystem ... %lld files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %lld,%lld blocks missing %lld files missing phase 1, inode %d/%dcheckinodeINCORRECT BLOCK COUNT I=%u (%ld should be %d)bad indirect addr: %ld bad direct addr: %ld convert symlink %d(%s) of size %llu cannot read symlink phase 1b, inode %d/%dphase 2, directory %d/%dphase 2, parent directory %d/%d%s %s: LENGTH %ld NOT MULTIPLE of %d%s %s: LENGTH %ld NOT MULTIPLE OF %d (REMOVED)phase 3, directory %d/%ldphase 4, inode %d/%dphase 5, cg %d/%dCREATCANNOT %s CLUSTER MAPS FREE BLK COUNT(S) WRONG IN SUPERBLKBLK(S) MISSING IN BIT MAPSALLOCATED FRAG %ld MARKE 08`K<  K(`[~ [~K`@@<@TU KwbKwwA KK$KbS KbS  FdAK?E0K?E0K?E0 AKK8KK? ;AKl$KK 2@AK_K_K  *AKMVKMVK AKaQ }KW4}KW4 B/^JvKu1Ku9Ku9  !K12K12K12/o!K5U2K5U2K5U2gxb!KqV3KqV3K $!K5K5Ks"&P!K5K5K5ζ8 !KW6KW6KW6 !K8K8K8z!KI8KI8KI8'!KK9KK9KK9&!Ky:Ky:KtS'"c!K|;K|;K|;I۵`!K-K-K-$SaK)^K)^K1/7!KbtKbtK1/qaKu(Ku(K1/I7B!KvYKvYK1/)aK3K3K1/v!KO4#KO4#K1/仫aKTKTK1/{!KhKhK1/>XaK5j K5j K1/"V!KqkO KqkO K1/;XT0aK' K' K1/"!K( K( K1/g "aKZKZK1/!KZKZK1/aK|K|K1/B!K|K|K1/;aK|K|K1/O'!K|K|K1/s]aK|K|K1/ 3NS!K|K|K1/ h0haKKK1/ L$!KKK1/ ǮAaKKK1/ z!KKK1/ ?aKKK1/ 6ǖ!KKK5(D0 ,3HaKKK5(D0 ֗d!KKK5(D0 IaKKK5(D0><6!KKK5(D0;aKKK5(D0){!KKK5(D0je~aKKK5(D0 A!KKK5(D0_aKKK5(D0zF!KKK5(D0+9aKKK5(D0n!KKK5(D07aKKK5(D000!KKK5(D0zaK`EK`EK5(D0X!K`EK`EK5(D0+SaK`EK`EK5(D0cr<!K`EK`EK5(D0$:JaK`EK`EK5(D0ӆ+!K`EK`EK5(D0" aK`EK`EK5(D0<!K`EK`EK5(D07qaK`EK`EK5(D0Ŕ !K`EK`EK5(D0HtaKuKuK5(D0|1!KuKuK5(D0&"aKuKuK5(D025a!KuKuK5(D0:aKuKuK5(D0s!KuKuK5(D0aKyvKyvK5(D0!KyvKyvK5(D0]Y$aKyvKyvK5(D05k!KyvKyvK5(D0 aKyvKyvK5(D08b!KyvKyvK5(D0P-FaKyvKyvK5(D0$!KyvKyvK5(D0-(!aKyvKyvK5(D0!K|K|K5(D0raK|K|K5(D0QdB!K|K|K5(D0L֓aK|K|K5(D0=f!K|K|K5(D031yaK|K|K5(D0vo!K|K|K5(D0@}aK|K|K5(D0%<:!K|K|K5(D0&aK|K|K5(D0D}Q!K٧K٧K5(D0|UaK٧K٧K5(D0G!K٧K٧K5(D0?f$aK٧K٧K5(D0~L!K٧K٧K5(D0KԇaK٧K٧K5(D01;!K٧K٧K5(D0x%aK@K@K5(D0 ,!K@K@K5(D0 XeaK@K@K5(D0 jl!K@K@K5(D0 faK@K@K5(D0 b[!K@K@K5(D0 TaK@K@K5(D0 )!K@K@K5(D0 taKKK5(D0 }!KKK5(D0 $aKKK5(D0}2!KKK5(D0(?1aKKK5(D0V~!KKK5(D0!KKK* DtBu!KKK+ ,mBuaKKK5(D0n!KKK5(D0~haK)qK)qK5(D0g!K)qK)qK5(D0s\!K)qK)qK)q?Y`#!K)qK)qK)q?X]xaK)qK)qK5(D0o!K)qK)qK5(D0ʛaK)qK)qK5(D0z!K)qK)qK5(D0!aK)qK)qK5(D0SPU!KbS KbS K5(D0VaKbS KbS K5(D0A!KbS KbS K5(D0A!KbS KbS KbS <b !KbS KbS KbS = (!KbS KbS KbS "E !KfKfKf"JEH!K;K;K;4oA Kl K.)K.) K#AKzUTKTK 1ATK#pK pK eռApKM.rKȻrKȻ }hArKv5r rKW,rKW, G*ArK,}K3}K3 muA}KěZ4K$K$ n^*/G %dcg 0: bad magic numberfirst cylinder group ran out of spaceinternal error: can't find block in cyl 0fsinit: inode value %d out of rangerdfs: read error on block %lldwtfs: write error on block %lldisblock bad fs_frag %dclrblock bad fs_frag %dsetblock bad fs_frag %dilog2: %d is not a power of 2 dfiPRr%s: is a directoryrm_overwrite%s (inode %u): not overwritten due to multiple links%s: malloccheckoverride %s%s%s/%s for %s? remove %s? "." and ".." may not be removedusage: %s [-dfiPRr] file ... bsfbsrdensityeomfsffsrofflinerewindrewofflretensionweofioctl MTIOCGETf:no remote support%s: unknown command%s: illegal countWriteProtectMounted76543210%d: unknown tape drive type %s tape drive, residual=%d erblocksize: %d (%d) density: %d (%d) usage: %s [-t] device usage: %s [-f device] command [count] m:pusage: %s [-p] [-m mode] directory ... 0123456789/\$invalid command code %cextra characters at the end of %c commandcommand %c expects \ followed by textextra characters after \ at the end of %c commandunexpected }branchempty labelread commandw commandfilename expectedunterminated substitute patternsubstitute pattern can not be delimited by newline or backslashextra text at the end of a transform commandcommand %c expects up to %d address(es), found %dcommand expectedunexpected EOF (pending }'s)\ can not be used as a string delimiternewline can not be used as a string delimiterRE error: %sunterminated substitute in regular expression123456789\%c not defined in the REunescaped newline inside substitute patternnumber in substitute flags out of rangemore than one number or 'g' in substitute flagsbad flag in substitute command: '%c'compile_flagsno wfile specifiedunterminated transform source stringunterminated transform target stringtransform strings are not the same lengthtransform pattern can not be delimited by newline or backslashexpected context addressunterminated regular expressionwhitespace after %sundefined label '%s'duplicate label '%s'unused label '%s'Eae:f:nruusage: sed [-aEnru] command [file ...] sed [-aEnru] [-e command] [-f command_file] [file ...] stdout: %s ..."sed: %lu: %s: \%d not defined in the REflush_appends\ \abfrtv%03ofirst RE may not be empty]]_x _L _  ` `@ ` ` (`\ 0` h 4` 8` D` P` \` d` h` x# jt,b) 0b`$ 4b? 8b3 @b? Lb3 Xb0 `b= hb2 pb`$ xb2 bL5 bx$ b8 b1 b* b+ b? b`$ bO bH% bP6 hD> -a-b-c-d -e-f-G-g-h -H -k-L -n-O-o-p -r-s-S -t-u-w-x-z===!=<>-eq-ne-gt-ge-lt -le!-ef"-nt#-ot$ucd@lctcfcccdcscldmdnp p| e ,el @e, Per \et ter ePu eL e@ e} e| pL D@ eT <%} ep e0p fh f, f ,f g  0y7#-1 1= ?2*?* /&.&_606162636465666768695U5u4L4l3C3c[O%A"BCDTk++--==!== *= /= %= += -= <<= >>= &= ^= |= <<>><=>=<>&& || */%+-&^|? , ~!():P(o4o@oIFS= ${PS2=> } ${PS3=#? } ${PS4=+ }lsTk}ujvavvcvvvevvviwklwXUmwCdrn(wf0w8wqb@wuHwTw\wpXjrLshwhtwvt|wwwwwxlet8jhzpzxzzz z z Q z zzؿ{xhPz{z}dzzzzzzf ||&&!()YYYYY]]<>P[ d}}}h m }   Ps}}}}}}@(#)PD KSH v5.2.14 99/07/13.2 AAA  Q AA A QBunable to allocate memoryafree: %p not present in area %pLPrestricted shell - can't cdPWDOLDPWDdon't know current directoryCDPATH%s: bad directorytoo many argumentsno OLDPWDno home directory (HOME not set)can't get current directory - %sRnprsu,-p: %s-u: %s: %s-npvVpv is a reserved word special is a%s shell builtin is a function undefined (autoload from %s) tracedn exported%s is *GOK*exported is an %salias for alias %s= is a tracked %salias for not foundL#R#UZ#fi#lprtuxfunction %s %T %s() %T %s: not identifierexportreadonly%s[%d]typeset -U -u -l -Z -R%d -L%d -t -r -x -i only -t, -u and -x options may be used with -funalias-tadprtUxalias: -r flag can only be used with -t and without arguments alias %s alias not found adtno argumentslpnzjob control not enabled%%%*d %*s %s%*d %*d %sls:bad signal `%s'usage: kill [-s signame | -signum | -signame] { job | pid | pgrp } ... kill -l [exit_status ...] %s: arguments must be jobs or process IDsmissing name argument%s: is not an identifierarguments changed since last callOPTARGc_getopts: no argvmissing options argumentlm+alias+cd+command*=export+fc+getopts+jobs+killletpwd*=readonly=typeset+unaliaswhence+bg+fg%s%*ldm%ld.%02lds%snothing to shift%s: bad numberc_umask=+-rwxugoXsbad maskaugo%#3.3o ugorwxprsu,%s is read onlytrap -- bad signal %s%s: can only %s %d level(s)%s: cannot %sfv%s%*ld.%02ld%sreal user sys system user real :ptime: -%s requires an argumenttime: -%s unknown optioninvalid file modeusage: mknod [-m mode] name [b | c] major minorusage: mknod [-m mode] name p*=.*=:[*=break=builtin*=continue*=eval*=exec*=exit+false*=return*=set*=shift=times*=trap+=wait+readtest+trueulimit+umask*=unset-tmissing ]internal error: unknown opunexpected operator/operandmissing expression operatormissing second argumentexpression expectedmissing argumentmissing closing paren-atime(cpu-seconds)file(blocks)coredump(blocks)data(kbytes)stack(kbytes)lockedmem(kbytes)memory(kbytes)nofiles(descriptors)usage: ulimit [-acdfHlmnpSst] [value]ulimit: %c%-20s unlimitedbad limit: %sexceeds allowable limitinvalid limit: %sunlimited x_modefileglob: substitute errorFPATH;|&()`*+?@!IFS\$(){}[]?*&;#|<>"'`beginning-of-historycomplete-commandcomplete-filecompletedelete-char-backwarddelete-word-backwarddelete-char-forwarddelete-word-forwardkill-lineredrawend-of-historyeot-or-deletegoto-historymacro-stringauto-insertkill-to-eolkill-regionlist-commandlist-filequoteprefix-1prefix-2yank-popbackward-charbeginning-of-linebackward-wordend-of-lineforward-charforward-wordnewlinedown-historynewline-and-nextno-opup-historyprev-hist-wordsearch-character-forwardsearch-character-backwardsearch-historyset-mark-commandstuffstuff-resettranspose-charsexchange-point-and-markcomplete-listexpand-filecapitalize-worddowncase-wordupcase-wordset-argcommentx_search_hist I-search: nothing to yank yank something first%s = '%s' %s: no such functioncannot bind, not a ttyPOSIXparameter null or not setexpand(NULL)%S%s: bad substitutionsubstitute%s: parameter not set%s: cannot open $() input%Rfunny $() command: %s*+?@! coprocess already existsPS4%s: can't find function definition file%s: can't find function definition file - %s%s: function not defined by %sCFUNC %d%s: can't open function definition file %s - %s%s: cannot execute - %s%s: restrictedcommand -p: restrictedbuiltin: %s: not a builtinEXECSHELL%s: %s: %sshcomexec: %scould not finish (dup) redirection %s: %sdupcannot %s %s: %s%s%s herein: yylexerror writing %s: %scan't %s temporary file %s: %shere document missing-rPS3%*d) %sdbteste_isadbteste_error: %s (offset %d)%s: unexpected `%s'end of expression%s: bad number `%s'%s: expression recurses on parameter `%s'%s: %s requires lvalue%s: %s applied to read only variablemissing )missing :zero divisorhistory functions not availablee:glnrs0,1,2,3,4,5,6,7,8,9,-%c%scan't use -e, -l, -n, -r with -s (-e -)can't use -l, -n with -e%.*s ${FCEDIT:-/bin/ed} $_error reading temp file %s - %scannot open temp file %serror writing temporary file - %scannot create temp file %s - %s-16substitution failed%s: not in history%s: invalid rangeno history (yet)HISTFILE%s.%dhist_shrinkinternal error: %s[%d]: shl_stdout not validtoo many files open in shellcan't create pipe - try againillegal file descriptor namefd not open for readingfd not open for writingbad file descriptorno coprocess%s/shXXXXXXXXstoppedrunning and You have %s%s%s jobs no such jobambiguousargument must be %job or process idwarning: won't have full job controlj_init: tcsetpgrp() failed: %sj_init: setpgid() failed: %sj_init: tcgetpgrp() failed: %sj_init: getpgrp() failed: %s[%d]jw:last procchildexchild: execute() returnedexchild: XPIPEI and no last_job - pid %dfork failedcannot fork - try againwaitlast: no last jobjw:waitlastwaitlast: not startedjw:waitfor| jw:resumecannot continue job %s: %sfg: 2nd tcsetpgrp(%d, %d) failed: %s1st tcsetpgrp(%d, %d) failed: %s[%d] job not job-controlledjobsnotifyzombiej_async: bad nzombie (%d)j_async: job not startedj_waitj: tcsetpgrp(%d, %d) failed: %scheckjobcheck_job: job started (flags 0x%x) Running (core dumped)%-20s %s%s%sj_print%s%5d %-20s %s%s %s%s%s%s %5d [%d] %c DoneDone (%d)remove_job: job not found (%s)no closing quote here document `%s' unclosed \$PS1PS2dopprompt\%c%r%l:%M:%S%a %b %d~/%smissing ] MAILyou have mail in $_typesetKSH_VERSION-xPPIDOPTIND=1evaltypeset -i RANDOM MAILCHECK="${MAILCHECK-600}" SECONDS="${SECONDS-0}" TMOUT="${TMOUT-0}"hash=alias -ttype=whence -vstop=kill -STOPsuspend=kill -STOP $$autoload=typeset -fufunctions=typeset -fhistory=fc -linteger=typeset -inohup=nohup local=typesetr=fc -e -login=exec login-tUccdatemailmakeprviwhoENVSH_VERSION$ /etc/suid_profile/etc/profile$HOME/.profileCannot determine current working directory-c requires an argumentUSERinclude: %dUse `exit' to leave ksh shell: %d%s%s-`%c' requires argument%s%s-%c: unknown optionalnumalphablankcntrldigitgraphlowerpunctupperxdigit |&;<>()*@#!$-? =-+?#% "#$&'()*;<>?[\`|0123456789ABCDEFallexportbraceexpandbgnicecsh-historyemacs-usemetaerrexitgmacsignoreeofinteractivekeywordmarkdirsnoclobbernoglobnohupnolognounsetphysicalposixprivilegedtrackallverbosevirawvi-show8vi-tabcompletevi-esccompletextrace%-*s %sCurrent option settings -o %sgetoptionsparse_args: `%c'%s: bad optionA:o;sgmatch'\'%-*s%*sdo_phys_pathshf_fdopen: missing read/writeshf_reopen: bad shf/buf/bsizeshf_reopen: missing read/writeshf_sopen: flags 0x%xshf_flush: no fdshf_emptybuf: no fdshf_fillbuf: no fdshf_read: bsize %dshf_read: flags %xshf_getse: flags %xshf_getchar: flags %xshf_ungetc: flags %xshf_putchar: no fdshf_putchar: flags %xshf_write: nbytes %dshf_write: flags %xshf_snprintf: buf %lx, bsize %dshf_vfprintf0123456789abcdef(null %s)too many <<'s for%s: bad identifier too many redirections %s: invalid function name thenelseelifficaseesacwhileuntildo{}[[&&||;;((|&unexpectedunmatchedsyntax error: `%s' %s ?%dsyntax error: unexpected EOF ERRError handlerEXITSIGtimed out waiting for inputsetexecsig: unset signal %d(%s)%S #no-args# #no-vars# ( %T) %T| %T%;%T%s %T ]] %Sdo%N%T%;done in %;for %s select %s case %S in%N(%S%c%;%T%N;;%Nesac %s %T%;doif %Telif %Telse%;%T%;fi then%N%T{%;%T%;} %T& function %s %T%s() %Ttime %T%T|& < >| <> <<- << >> <&>&wdscan: unknown char 0x%x (carrying on)j_ttyinit: can't set close-on-exec flag: %sj_ttyinit: dup of tty fd failed: %sNo controlling tty (open /dev/tty: %s)Can't find tty file descriptorOPTINDPOSIXLY_CORRECTHISTSIZEMAILCHECKMAILPATHRANDOMSECONDSTMOUTLINENO%s: subscript %ld out of range0123456789abcdefghijklmnopqrstuvwxyz0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZstr_valsetstr: %s=%s: assigning to self%s: is read only%0*s%.*s%*s%.*sy$%s %dfc -e ${VISUAL:-${EDITOR:-vi}} --grabhist: bad history arrayM-%7s %-10s %14s %-7s %-6s '%s' %14llu%14skey disk %3uUnusedHot spareScrubbingBIOCDISK%7s %-10s %14s %-7s CRYPTO%s%s %u secondsDevice%-7s %-10s %14s %-8s VolumeStatusSizeBIOCINQa:b:C:c:dH:hik:l:Pp:qr:R:vu:Number of rounds is %s: %s/dev/bioneed -c parameterneed -l parametercan't use sd deviceCan't locate %s device via %sneed deviceusage: %s [-hiqv] [-a alarm-function] [-b channel:target[.lun]] [-H channel:target[.lun]] [-R device | channel:target[.lun] [-u channel:target[.lun]] device %s [-dhiPqv] [-C flag[,flag,...]] [-c raidlevel] [-k keydisk] [-l special[,special,...]] [-p passfile] [-R device | channel:target[.lun] [-r rounds] device target not specifiedstr2locatorBIOCVOLbio_inq %d%% doneBuildingOfflineDegradedOnlineInvalid%s %u%7s %-10s %14s %-7s RAID%u%s%s RebuildFailed%u:%u.%unoenclunknown serial%7s %-10s %14s %-7s %-6s <%s> alarm is currently %s invalid alarm function: %sBIOCALARMbio_getvolbynameTarget %s: %sinvalid device %sBIOCSETSTATEbio_setblinkDisk %s does not existDisk %s is not in an enclosureBIOCBLINKno devices specifiednot enough memory for dev_t listunsupported raid levelnot enough disksbio_createraidIncorrect passphraseBIOCCREATERAIDioctlPassphrase: not exactly one partitioncould not stat %sinvalid KDF infoinvalid KDF hintunknown KDF type %dnumber of KDF rounds too low: %dKDF hint has invalid sizeNew passphrase: invalid device listbio_parse_devlistduplicate device in listtoo many devices on device listbio_createflagsinvalid flags listinvalid flag %sbio_deleteraiddelete volume %s failedOld passphrase: %s: failed to get KDF hintbio_changepass%s: incorrect passphrase%s: failed to change passphrase%s: <%s, %s, %s>, serial %s bio_diskinqDIOCINQInvalid keyInvalid saltcan't specify passphrase file during initial creation of crypto volumeinvalid passphrase filecan't stat passphrase filepassphrase file must be owned by rootpassphrase file has the wrong permissionsinvalid passphrase lengthRe-type passphrase: Passphrases did not matchderive_key_pkcspbkdf2 failedunable to read passphrasecan't read passphrase fileToo few rounds: %dhmac_sha1pkcs5_pbkdf2usage: %s seconds %s: destination pathname too longdo_moverename %s to %scan't remove %scannot resolve %scannot rename a mount point%s: remove%s: set times%s: set flags%s: set mode%s: set owner/group%s: set owner/group; not setting setuid/setgid%s: waitpid/bin/cp%s: terminated with %d (non-zero) status%s: did not terminate normally/bin/rm-rf-PRpusage: %s [-fi] source target %s [-fi] source ... directory |&=<>+-*/%:()syntax erroreval5division by zeronon-numeric argument_msgbufpM:N:sysctl: KERN_MSGBUFSIZEcouldn't allocate space for buffer datasysctl: KERN_MSGBUFusage: %s [-M core] [-N system] sethostnamegethostnameusage: %s [-s] [name-of-host] IN-ADDR.ARPAgetnetanswerbf0.0.0.%u.in-addr.arpa0.0.%u.%u.in-addr.arpa0.%u.%u.%u.in-addr.arpa%u.%u.%u.%u.in-addr.arpagetnetbyaddrgetnetbynamegethostby*.getanswer: asked for "%s", got "%s"-_/getanswer%x.%x.ip6.arpagethostbyaddr/etc/hosts/BD7q۵[V9Y?^[1$} Ut]rހܛtiGƝ̡ $o,-tJܩ\ڈvRQ>m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxqg jgrn<:ORQhك[\pXlttttttgethostby*.getanswer: asked for "%s", got "%s"explore_numeric# _gethtentres_querydomainN/etc/group_pwhashbyname/etc/spwd.db/etc/pwd.db%02x:%02x:%02x:%02x:%02x:%02x/etc/ethersether_ntohostether_hostton/var/run/utmplogout%s: not a device nodereadlabelfs%s: bad filesystem type in label%s: couldn't read disklabel%s%s%s%c/etc/fbtab(null)%s: bad entry: %s%o%s: %s: %mlogin_protect/*%s: chown(%s): %m%s: chmod(%s): %m%s: opendir(%s): %m%lld.%1lld%c%lld%c0B/var/log/wtmplogwtmp\\#TERMPATHtgetent.termcap /usr/share/misc/termcap/usr/share/misc/termcapTERMCAPOOPS?Ynlongjmp botch. inet6_rth_reverseno errorunknown/invalid errorargument buffer overflowresolved protocol is unknowninvalid value for hintsmemory allocation failureaddress family for name not supportedservice not supported for ai_socktypeai_socktype not supportedai_family not supportedno address associated with namenon-recoverable failure in name resolutiontemporary failure in name resolutionname or service is not knowninvalid value for ai_flagsxxswfstabscansscanfABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/=%u.%u.%u.%u0123456789abcdefSHA256EndSHA256FileChunkSHA256Datap|hwȕ(̕ԕܕ (0Signal 0HUPINTILLTRAPABRTEMTFPEKILLBUSSEGVSYSPIPEALRMURGTSTPCONTCHLDTTINTTOUIOXCPUXFSZVTALRMPROFWINCHUSR1USR2THRLABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ !"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ ABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789ABCDEFabcdefABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789NULSOHSTXETXEOTENQBELalertBSbackspaceHTtabLFVTvertical-tabFFform-feedCRcarriage-returnSOSIDLEDC1DC2DC3DC4NAKSYNETBCANEMSUBIS4IS3GSIS2RSIS1USexclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfivesixseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettildeDEL[:<:]][:>:]]  (4DP\dpnosappndnosappendnoarchnoarchivednoschgnoschangenosimmutablenouappndnouappendnouchgnouchangenouimmutablenodumpnoopaque ,%ld%s-blocks%s: unknown blocksize%s: minimum blocksize is 512maximum blocksize is %dGBLOCKSIZE*** unknown regexp error code ***REG_NOMATCHregexec() failed to matchREG_BADPATinvalid regular expressionREG_ECOLLATEinvalid collating elementREG_ECTYPEinvalid character classREG_EESCAPEREG_ESUBREGinvalid backreference numberREG_EBRACKbrackets ([ ]) not balancedREG_EPARENparentheses not balancedREG_EBRACEbraces not balancedREG_BADBRinvalid repetition count(s)REG_ERANGEinvalid character rangeREG_ESPACEREG_BADRPTrepetition-operator operand invalidREG_EMPTYempty (sub)expressionREG_ASSERT"can't happen" -- you found a bugREG_INVARGinvalid argument to regex routineregerrorREG_0x%xsecurertsctssoftcarwindow/etc/ttys/var/run/dev.dbttyname_r/etc/protocols/etc/networksreadpassphraseglob3g_opendirg_lstatg_statauthunix_createauthunix_create: out of memory authunix_create_defaultauth_none.c - Fatal marshalling problemp,8D`htԢ$<Ld|ԣp,8D`htԢ$<Ld|ԣHangupInterruptQuitIllegal instructionTrace/BPT trapAbort trapEMT trapFloating point exceptionKilledBus errorSegmentation faultBad system callBroken pipeAlarm clockTerminatedUrgent I/O conditionSuspended (signal)SuspendedContinuedChild exitedStopped (tty input)Stopped (tty output)I/O possibleCputime limit exceededFilesize limit exceededVirtual timer expiredProfiling timer expiredWindow size changesInformation requestUser defined signal 1User defined signal 2Thread ASToption requires an argument -- %coption requires an argument -- %sambiguous option -- %.*soption doesn't take an argument -- %.*sunknown option -- %cunknown option -- %sinet_net_pton_ipv40123456789abcdef0123456789/usr/src/lib/libc/net/inet_net_pton.cn >= 0 && n <= 9n >= 0 && n <= 15assertion "%s" failed: file "%s", line %d assertion "%s" failed: file "%s", line %d, function "%s" getnameinfoip6_parsenumeric%u.%u.%u.%uinet_ntop4inet_ntop6b0b1ncdtscilsbpxbxfxoxtxdxgetenttc%s.db:\|:cgetnextSHA1TransformSHA1Padexeclexecleexeclpexecvpexecvp: : path too long xdr_array: out of memory   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~realpathvfscanfؗҜ<3#I9=D2[%Cod(hinityan%h %e %T MD5Padstack overflow in function %sGMTmnabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789 :+-._Local time zone must be set--see zic manual page/usr/share/zoneinfotzload/etc/localtimeposixrules,M4.1.0,M10.5.0TZSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec%.3s %.3s%3d %2.2d:%2.2d:%2.2d %-4s %.3s %.3s%3d %2.2d:%2.2d:%2.2d %s asctime3048<@DHLPTX\`ht|@Ȭ̬ЬԬجܬ(4@PTXJanFebMarAprMayJunJulAugSepOctNovDecJanuaryFebruaryMarchAprilJuneJulyAugustSeptemberOctoberNovemberDecemberSunMonTueWedThuFriSatSundayMondayTuesdayWednesdayThursdayFridaySaturday%H:%M:%S%m/%d/%y%a %b %e %T %YAMPM%a %b %e %H:%M:%S %Z %Y_fmt%Y-%m-%d%H:%M%2d%03d%I:%M:%S %p%e-%b-%Y%04d_conv-0clntudp_create: out of memory clntudp_callres_query%.*s.%.*sres_querydomainHOSTALIASES__hostalias __res_nameinquery__res_queriesmatch__res_send  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~/&/etc/resolv.conf;#lookupsearchnameserversortlistinet4_res_initRES_OPTIONSenvLOCALDOMAINndots:insecure1insecure2edns001234567890123456789abcdef0123456789ABCDEFinet_pton6  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~/etc/services,/4"p"too small ((((( AAAAAABBBBBB _rsyslog%s: unknown facility/priority: %x__vsyslog_r<%d>Error %d[%ld]connectlog_r/dev/logvsnprintf$@Tl|ص8Th  <Xp; errno = %s; s1 = %u, s2 = %u; why = (unknown authentication error - %d); low version = %u, high version = %uRPC: SuccessRPC: Can't encode argumentsRPC: Can't decode resultRPC: Unable to sendRPC: Unable to receiveRPC: Timed outRPC: Incompatible versions of RPCRPC: Authentication errorRPC: Program unavailableRPC: Program/version mismatchRPC: Procedure unavailableRPC: Server can't decode argumentsRPC: Remote system errorRPC: Unknown hostRPC: Port mapper failureRPC: Program not registeredRPC: Failed (unspecified error)RPC: Unknown protocolRPC: (unknown error code)%s: %s %s: %s - %s Authentication OKInvalid client credentialServer rejected credentialInvalid client verifierServer rejected verifierClient credential too weakInvalid server verifierFailed (unspecified error)clnttcp_create: out of memory bindresvport_saxdrrec_create: out of memory perrorlibcUnknown error: Unknown signal: _catopen/usr/share/nls/%L/%N.cat:/usr/share/nls/%N/%LLANGNLSPATH0Hdtк @w(<H`lxл8HXp̼ @`̽8hȾ,Hd|Ŀؿ$4H\p $@Tp,XlUndefined error: 0Operation not permittedNo such file or directoryNo such processInterrupted system callInput/output errorDevice not configuredArgument list too longExec format errorBad file descriptorNo child processesResource deadlock avoidedPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkOperation not supported by deviceNot a directoryIs a directoryInvalid argumentToo many open files in systemToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksNumerical argument out of domainResult too largeResource temporarily unavailableOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketProtocol not availableProtocol not supportedSocket type not supportedOperation not supportedProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceOperation timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downNo route to hostDirectory not emptyToo many processesToo many usersDisk quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticatorIPsec processing failureAttribute not foundIllegal byte sequenceNo medium foundWrong medium typeValue too large to be stored in data typeOperation canceledIdentifier removedNo message of desired typeNot supportedp,8D`htԢ$<Ld|ԣxdr_bytes: out of memory xdr_string: out of memory %$sniglet^&snprintf0123456789abcdef0123456789ABCDEF__sbprintf__vfprintfbug in vfprintf: bad baseINFinfNANnan__find_argumentsInfinityNaNisatty !#&(*-/14`#`#`#`#`#`#`#,`#`#ABCDEF7yACnF?O8M20HwZ~???>ccpp `8 ǃx8 089 pp<cc8` a`p ǃ0 009 0`<cg8` q`` FLJ0 009 8|cf0`8  p089 `f?0?  ?8 `f0   8 `f 1   8 `f 1`İ   08 8 `8 q`8  088 0` `qxp ap8p  008 pp ~??>?~?> 0 4f xǎv|w0xxD\1``bˌ  .&Ș|`` 00( r @ t `"b`11F0 ~sLJ;??~~c   @@? `mF8|x`a1C  mv<88J|LJϜm~|8Z cc `Ș F@F R#cHX $|B b#c0`Ș ,FF gό9>|a`G8p 9>Xa@@@x@gg"" e j    ky ( JKYdu f    bv z!w" (F2R r u'g <<p%[)]*())* * ){{}}{}(())()[[]][]#$G>> P30123456789=:f/?/*?*n+n,N-N.m'E :e  :n:pt5T6:x&:d4-/:ttso_|%v !+ Hh VqQ:q:QZZ    l h b  w  i x X      0  $  k  j  is a directory is not a regular file (use -f to see it)ddaleGble@G&BleG0XcleGЀdleAGeleG,H\fleG|FleG܁gleG LhleGHAGԂileG&(jleGP`Jle!GlH#LleG܃mleGnle"G 8LpleH$Ple$lqleGx̄rle"G(sle!GhSle!Gule"GVle&wle"G Dxxle('XleAGȆyleG(zleGLd"le)~le!G?le*#leGԇ.leAG B (press RETURN)... (interrupt to abort),vvv382 Ȏмظ11"t €u6Uu|agPtPS[X!Using drive X, partition YMBR on floppy or old BIOS Read error No O/S No active partition OxU~DLQ`h (@nLQpPhܩD< <p(xx}(#@īԳ~t$A4BPCkDDETFdGtU<V|abdGce{fhiLĴlشnqqrs vw(x4ussC(n     ^(b48{EE<oDDLTU`Ƚh C!t"C#x$%Կ&'Z(D)*+,-./0Ⱦ1̾2ؾ34567`#4`<h priorityrttvarrttssthreshsendpiperecvpipeexpirehopcountmtuUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CLONING XRESOLVE LLINFO STATIC BLACKHOLEPROTO3PROTO2PROTO1CLONEDSOURCEMPATHJUMBOMPLSUPBROADCASTDEBUGLOOPBACKPTPNOTRAILERSRUNNINGNOARP PPROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTDSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD LABEL<NOOP t tKHz`#( 0(EHC P E(  0(EHDHC ;Zx0Nܯh,Hy`####%%%%%x" ... ...ĭ̭ԭܭ $0<DL\dlt|8q`#`#`#`#`#`#`#qhu؏`#`#Tn`#`#`#q`#`#Ī)))*L mm(kn nn nD(n0n8nr@@n@@@%s: can't read disk label; disk type must be specified......FFFЇF D FFFFGGG̭lGG{}abcdDgGhHilnNpPqrs tw xy !:#= PlsTktslssj}D{lstslstsssYs tt,tDt\ttttttttYththht`ph,ttTit$ipLtu0?@@P[d\p\]^^_Ě_К`{{|}}0~8lx̝ @$DPlx   ܞ  <H`l`#Hv v v,  vH (vp 0v 8v h @v D8 Hv` Pv ?`#ĭ̭ԭܭ $0<DL\dlt|8q`#`#`#`#`#`#`#qhu؏`#`#Tn`#`#`#q`#`#0123456789abcdef   545 ȑ4 4 x4ȑ`fHf`fgfpDTl 04<D,,x(`,x(<(T\< 0000000000000000}`LX0f<.shstrtab.init.text.fini.rodata.data.eh_frame.jcr.gotpad0.got.ctors.dtors.gotpad1.bss.stack.arm.atpcs.note.openbsd.ident PPdd0f0DgDe%`L`LG+TT5XX:\C\\(H OV_mdkv44 . ..chownndhclientP: disklabel:dmesgnfdisknfsckn fsck_ext2fsfsck_ffsP:ifconfigP:initnmknodnmountn mount_cd9660, mount_ext2fs, mount_ffs: mount_msdos mount_nfs:newfsn newfs_msdospingnping6nreboothaltnroutenrtsolnumountsysctlbioctlƧdhclient-scriptc 65 $U 660 ;; ugen*) n=$(($U*16)) for j in 0{0,1,2,3,4,5,6,7,8,9} 1{0,1,2,3,4,5} do M ugen$U.$j c 70 $(($n+10#$j)) 660 done ;; ttyU[0-9a-zA-Z]) U=${i#ttyU*} o=$(alph2d $U) M ttyU$U c 68 $o 660 dialer uucp M cuaU$U c 68 $(($o+128)) 660 dialer uucp ;; uall) R ttyU0 ttyU1 ttyU2 ttyU3 ugen0 ugen1 ulpt0 ulpt1 uhid0 uhid1 R uhid2 uhid3 uscanner0 urio0 usb0 usb1 usb2 usb3 usb4 usb5 ;; wsmux|wsmouse|wskbd) M wsmouse c 63 0 600 M wskbd c 63 1 600 ;; wsmouse[0-9]*) M wsmouse$U c 62 $U 600 ;; wskbd[0-9]*) M wskbd$U c 61 $U 600 ;; tty[C-J]*) U=${i##tty[C-J]} case $i in ttyC*) n=C m=0;; ttyD*) n=D m=256;; ttyE*) n=E m=512;; ttyF*) n=F m=768;; ttyG*) n=G m=1024;; ttyH*) n=H m=1280;; ttyI*) n=I m=1536;; ttyJ*) n=J m=1792;; esac case $U in [0-9a-f]) M tty$n$U c 60 $((16#$U+$m)) 600;; cfg) M tty${n}cfg c 60 $((255+$m)) 600;; *) echo bad unit $U for $i; exit 1;; esac ;; wscons) R wsmouse0 wsmouse1 wsmouse2 wsmouse3 wskbd0 wskbd1 wskbd2 R wskbd3 wsmux ttyCcfg ttyC0 ttyC1 ttyC2 ttyC3 ttyC4 ttyC5 R ttyC6 ttyC7 ttyC8 ttyC9 ttyCa ttyCb ;; pty*) if [ $U -gt 15 ]; then echo bad unit for pty in: $i continue fi set -A letters p q r s t u v w x y z P Q R S T set -A suffixes 0 1 2 3 4 5 6 7 8 9 a b c d e f g h i j k l m n o p q \ r s t u v w x y z A B C D E F G H I J K L M N O P Q R S T U V W X \ Y Z name=${letters[$U]} n=0 while [ $n -lt 62 ] do nam=$name${suffixes[$n]} off=$(($U*62)) M tty$nam c 4 $(($off+$n)) M pty$nam c 5 $(($off+$n)) n=$(($n+1)) done ;; ptm) M ptm c 98 0 666 ;; tty[0-7][0-9a-f]) U=${i#tty*} o=$(h2d $U) M tty$U c 12 $o 660 dialer uucp M cua$U c 12 $(($o+128)) 660 dialer uucp ;; st*) n=$(($U*16)) for pre in " " n e en do M ${pre}st$U b 25 $n 660 operator M ${pre}rst$U c 25 $n 660 operator n=$(($n+1)) done ;; vnd*) dodisk vnd $U 19 19 $U 0 dodisk svnd $U 19 19 $U 2048 ;; rd*) dodisk2 rd $U 18 18 $U 0 ;; ch*) M ch$U c 27 $U 660 operator ;; cd*) dodisk2 cd $U 26 26 $U 0 ;; local) test -s $T.local && sh $T.local ;; all) R ccd0 ccd1 ccd2 ccd3 vnd0 vnd1 vnd2 vnd3 sd0 sd1 sd2 sd3 sd4 R sd5 sd6 sd7 sd8 sd9 cd0 cd1 rd0 tun0 tun1 tun2 tun3 bpf0 R bpf1 bpf2 bpf3 bpf4 bpf5 bpf6 bpf7 bpf8 bpf9 pty0 bio vscsi0 R nnpfs0 ss0 ss1 ch0 hotplug ptm local wscons uall rmidi0 R rmidi1 rmidi2 rmidi3 rmidi4 rmidi5 rmidi6 rmidi7 tuner0 R radio0 music0 video0 audio0 audio1 audio2 uk0 random lkm R tty00 tty01 tty02 tty03 apm crypto pf systrace wd0 wd1 wd2 R wd3 raid0 raid1 raid2 raid3 std st0 st1 fd ;; wd*|sd*|raid*|ccd*) case $i in wd*) dodisk wd $U 16 16 $U 0;; sd*) dodisk sd $U 24 24 $U 0;; raid*) dodisk raid $U 71 71 $U 0;; ccd*) dodisk ccd $U 21 21 $U 0;; esac ;; *) echo $i: unknown device ;; esac done } R "$@" { echo -n ${RMlist[*]} echo -n ${mklist[*]} echo -n ${MKlist[*]} echo -n ${whlist[*]} echo ${oplist[*]} } | if [ "$eo" = "echo" ]; then cat else sh fi #!/bin/sh - PATH=/sbin:/usr/sbin:/bin:/usr/bin T=$0 [ "$eo" ] || eo= hex() { case $1 in [0-9]) echo -n $1;; 10) echo -n a;; 11) echo -n b;; 12) echo -n c;; 13) echo -n d;; 14) echo -n e;; 15) echo -n f;; esac } alph2d() { local t="$1" local p="0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ" local sub=${p%${t}*} echo ${#sub} } h2d() { local s="$1" local f=${s%*[0-9a-f]} n=${s#[0-9a-f]*} echo $(($(_h2d $f)*16+ $(_h2d $n) )) } _h2d() { case $1 in [0-9]) echo -n $1;; a) echo -n 10;; b) echo -n 11;; c) echo -n 12;; d) echo -n 13;; e) echo -n 14;; f) echo -n 15;; esac } unt() { arg="$1" tmp="${arg#[a-zA-Z]*}" tmp="${tmp%*[a-zA-Z]}" while [ "$tmp" != "$arg" ] do arg=$tmp tmp="${arg#[a-zA-Z]*}" tmp="${tmp%*[a-zA-Z]}" done echo $arg } dodisk() { [ "$DEBUG" ] && set -x n=$(($((${5}*${7:-16}))+${6})) count=0 [ 0$7 -ne 8 ] && l="i j k l m n o p" for d in a b c d e f g h $l do M $1$2$d b $3 $(($n+$count)) 640 operator M r$1$2$d c $4 $(($n+$count)) 640 operator let count=count+1 done } dodisk2() { n=$(($(($5*${7:-16}))+$6)) M $1$2a b $3 $n 640 operator M r$1$2a c $4 $n 640 operator n=$(($n+2)) M $1$2c b $3 $n 640 operator M r$1$2c c $4 $n 640 operator } RMlist[0]="rm -f" mkl() { mklist[${#mklist[*]}]=";mknod -m $1 $2 $3 $4 $5" } M() { RMlist[${#RMlist[*]}]=$1 mkl ${5-666} $1 $2 $3 $4 G=${6:-wheel} [ "$7" ] && { MKlist[${#MKlist[*]}]=";chown $7:$G $1" } || { case $G in wheel) [ ${#whlist[*]} = 0 ] && whlist[0]=";chgrp wheel" whlist[${#whlist[*]}]="$1" ;; operator) [ ${#oplist[*]} = 0 ] && oplist[0]=";chgrp operator" oplist[${#oplist[*]}]="$1" ;; *) MKlist[${#MKlist[*]}]=";chgrp $G $1"; esac } return 0 } R() { [ "$DEBUG" ] && set -x for i in "$@" do U=`unt $i` [ "$U" ] || U=0 case $i in ramdisk) R std bpf0 wd0 wd1 sd0 tty00 rd0 wsmouse R st0 ttyC0 wskbd0 apm bio ;; std) M console c 0 0 600 M tty c 1 0 M mem c 2 0 640 kmem M kmem c 2 1 640 kmem M null c 2 2 M zero c 2 12 M stdin c 7 0 M stdout c 7 1 M stderr c 7 2 M ksyms c 8 0 640 kmem M klog c 6 0 600 ;; vscsi*) M vscsi$U c 100 $U 600 ;; nnpfs*) M nnpfs$U c 51 $U 600 ;; video*) M video$U c 38 $U MKlist[${#MKlist[*]}]=";[ -e video ] || ln -s video$U video" ;; tuner*) M tuner$U c 75 $(($(($U*2))+16)) 644 ;; systrace) M systrace c 50 0 644 ;; ss*) M ss$U c 29 $(($U*16)) 640 operator M nss$U c 29 $(($(($U*16))+1)) 640 operator M enss$U c 29 $(($(($U*16))+3)) 640 operator RMlist[${#RMlist[*]}]="scan$U" MKlist[${#MKlist[*]}]=";umask 77;ln -s ss$U scan$U" ;; uk*) M uk$U c 28 $U 640 operator ;; tun*) M tun$U c 33 $U 600 ;; *random) n=0 for pre in " " s u a do M ${pre}random c 40 $n 644 n=$(($n+1)) done ;; rmidi*) M rmidi$U c 57 $U 666 ;; radio*) M radio$U c 97 $U MKlist[${#MKlist[*]}]=";[ -e radio ] || ln -s radio$U radio" ;; pf*) M pf c 46 0 600 ;; music*) M music$U c 58 $U M sequencer$U c 58 $(($U+128)) MKlist[${#MKlist[*]}]=";[ -e music ] || ln -s music$U music" MKlist[${#MKlist[*]}]=";[ -e sequencer ] || ln -s sequencer$U sequencer" ;; lkm) M lkm c 35 0 640 _lkm ;; fd) RMlist[${#RMlist[*]}]=";mkdir -p fd;rm -f" n=0 while [ $n -lt 64 ];do M fd/$n c 7 $n;n=$(($n+1));done MKlist[${#MKlist[*]}]=";chmod 555 fd" ;; crypto) M crypto c 47 0 ;; bpf*) M bpf$U c 22 $U 600 ;; bktr*) M bktr$U c 75 $U 644 ;; bio) M bio c 52 0 600 ;; hotplug) M hotplug c 37 $U 400 ;; audio*) M sound$U c 36 $U M mixer$U c 36 $(($U+16)) M audio$U c 36 $(($U+128)) M audioctl$U c 36 $(($U+192)) MKlist[${#MKlist[*]}]=";[ -e audio ] || ln -s audio$U audio" MKlist[${#MKlist[*]}]=";[ -e mixer ] || ln -s mixer$U mixer" MKlist[${#MKlist[*]}]=";[ -e sound ] || ln -s sound$U sound" MKlist[${#MKlist[*]}]=";[ -e audioctl ] || ln -s audioctl$U audioctl" ;; apm*) M apm c 34 0 644 M apmctl c 34 8 644 ;; uscanner*) M uscanner$U c 69 $U 660 ;; usb*) [ "$i" = "usb" ] && u= || u=$U M usb$u c 64 $U 660 ;; urio*) M urio$U c 67 $U 660 ;; ulpt*) M ulpt$U c 66 $U 660 ;; uhid*) M uhid$U @ . ..GMAKEDEVHconsoleI ttyJ memKkmem}nLnull}nMzero}nNstdinnOstdoutPstderrQksymsnRklog}nSbpf0}nTwd0a}nUrwd0anVwd0b}nWrwd0bnXwd0c}nYrwd0cnZwd0d}n[rwd0dn\wd0e}n]rwd0en^wd0f}n_rwd0fn`wd0g}narwd0gnbwd0h}ncrwd0hndwd0i}nerwd0infwd0j}ngrwd0jnhwd0k}nirwd0knjwd0l}nkrwd0lnlwd0m}nmrwd0mnnwd0n}norwd0nnpwd0o}nqrwd0onrwd0p}nsrwd0pntwd1a}nurwd1anvwd1b}nwrwd1bnxwd1c}nyrwd1cnzwd1d}n{rwd1dn|wd1e}n}rwd1en~wd1f}nrwd1fnƀwd1g}nƁrwd1gnƂwd1h}nƃrwd1hnƄwd1i}nƅrwd1inƆwd1j}nƇrwd1jnƈwd1k}nƉrwd1knƊwd1l}nƋrwd1lnƌwd1m}nƍrwd1mnƎwd1n}nƏrwd1nnƐwd1o}nƑrwd1onƒwd1p}nƓrwd1pnƔsd0a}nƕrsd0anƖsd0b}nƗrsd0bnƘsd0c}nƙrsd0cnƚsd0d}nƛrsd0dnƜsd0e}nƝrsd0enƞsd0f}nƟrsd0fnƠsd0g}nơrsd0gnƢsd0h}nƣrsd0hnƤsd0i}nƥrsd0inƦsd0j}nƧrsd0jnƨsd0k}nƩrsd0knƪsd0l}nƫrsd0lnƬsd0m}nƭrsd0mnƮsd0n}nƯrsd0nnưsd0o}nƱrsd0onƲsd0p}nƳrsd0pnƴtty00nƵcua00nƶrd0a}nƷrrd0anƸrd0c}nƹrrd0cnƺwsmousewskbdnƼ st0rst0}nƾnst0}nƿnrst0nest0}nerst0nenst0nenrst0ttyC0nwskbd0 apmapmctlbio6030cfb761703a62aede42325781cd16924a5af074d466b6a4843fcc09d3577f 51f209c8279abe79018070ec84917352900cacd0c77c816b829fb1f79a86bf46 f520537ff83101e474622ef13c135a2800d595bd8b8424afeaa6e907fe7963ff #!/bin/sh delete_old_address() { if [ -n "$old_ip_address" ]; then ifconfig $interface inet $old_ip_address delete $medium route delete "$old_ip_address" 127.0.0.1 >/dev/null 2>&1 fi } add_new_address() { ifconfig $interface \ inet $new_ip_address \ netmask $new_subnet_mask \ broadcast $new_broadcast_address \ $medium route add $new_ip_address 127.0.0.1 >/dev/null 2>&1 } delete_old_alias() { if [ -n "$alias_ip_address" ]; then ifconfig $interface \ inet $alias_ip_address delete > /dev/null 2>&1 route delete $alias_ip_address 127.0.0.1 > /dev/null 2>&1 fi } add_new_alias() { if [ -n "$alias_ip_address" ]; then ifconfig $interface inet $alias_ip_address alias netmask \ $alias_subnet_mask route add $alias_ip_address 127.0.0.1 fi } delete_old_routes() { route -n flush -inet -iface $interface >/dev/null 2>&1 if [ -n "$old_static_routes" ]; then set $old_static_routes while [ $# -gt 1 ]; do route delete "$1" "$2" shift; shift done fi arp -dan } add_new_routes() { route -n flush -inet -iface $interface >/dev/null 2>&1 for router in $new_routers; do if [ "$new_ip_address" = "$router" ]; then route add default -iface $router >/dev/null 2>&1 else route add default $router >/dev/null 2>&1 fi break done if [ -n "$new_static_routes" ]; then set $new_static_routes while [ $# -gt 1 ]; do route add $1 $2 shift; shift done fi } add_new_resolv_conf() { rm -f /etc/resolv.conf.std if [ -n "$new_domain_name" ]; then echo "search $new_domain_name" >>/etc/resolv.conf.std fi if [ -n "$new_domain_name_servers" ]; then for nameserver in $new_domain_name_servers; do echo "nameserver $nameserver" >>/etc/resolv.conf.std done fi if [ -f /etc/resolv.conf.std ]; then if [ -f /etc/resolv.conf.tail ]; then cat /etc/resolv.conf.tail >>/etc/resolv.conf.std fi if [ -f /etc/resolv.conf ]; then cat /etc/resolv.conf > /etc/resolv.conf.save fi cat /etc/resolv.conf.std > /etc/resolv.conf rm -f /etc/resolv.conf.std chown -RL root:wheel /etc/resolv.conf chmod -RL 644 /etc/resolv.conf return 0 fi return 1 } case $reason in MEDIUM) ifconfig $interface $medium sleep 1 ;; PREINIT) delete_old_alias ifconfig $interface up ;; ARPCHECK|ARPSEND) ;; BOUND|RENEW|REBIND|REBOOT) if [ -n "$old_ip_address" ]; then if [ "$old_ip_address" != "$alias_ip_address" ]; then delete_old_alias fi if [ "$old_ip_address" != "$new_ip_address" ]; then delete_old_address delete_old_routes fi fi if [ "$reason" = BOUND ] || [ "$reason" = REBOOT ] || [ -z "$old_ip_address" ] || [ "$old_ip_address" != "$new_ip_address" ]; then add_new_address add_new_routes fi if [ "$new_ip_address" != "$alias_ip_address" ]; then add_new_alias fi add_new_resolv_conf ;; EXPIRE|FAIL) delete_old_alias if [ -n "$old_ip_address" ]; then delete_old_address delete_old_routes fi add_new_alias if [ -f /etc/resolv.conf.save ]; then cat /etc/resolv.conf.save > /etc/resolv.conf fi ;; TIMEOUT) delete_old_alias add_new_address sleep 1 if [ -n "$new_routers" ]; then set "$new_routers" if ping -q -c 1 -w 1 "$1"; then if [ "$new_ip_address" != "$alias_ip_address" ]; then add_new_alias fi add_new_routes if add_new_resolv_conf; then exit 0 fi fi fi ifconfig $interface inet $new_ip_address delete $medium delete_old_routes exit 1 ;; esac exit 0 e8b465054005a28b5de7f0bb1ac329c802957b679cd13773824397306278da94 c6de29e306cb7a5452a655cfb61e6c9ba672c1b3c436636dc5399b7f741ab14f right/Pacific/Kiritimati right/Pacific/Kosrae right/Pacific/Kwajalein right/Pacific/Majuro right/Pacific/Marquesas right/Pacific/Midway right/Pacific/Nauru right/Pacific/Niue right/Pacific/Norfolk right/Pacific/Noumea right/Pacific/Pago_Pago right/Pacific/Palau right/Pacific/Pitcairn right/Pacific/Ponape right/Pacific/Port_Moresby right/Pacific/Rarotonga right/Pacific/Saipan right/Pacific/Samoa right/Pacific/Tahiti right/Pacific/Tarawa right/Pacific/Tongatapu right/Pacific/Truk right/Pacific/Wake right/Pacific/Wallis right/Pacific/Yap right/Poland right/Portugal right/ROC right/ROK right/Singapore right/Turkey right/UCT right/US/ right/US/Alaska right/US/Aleutian right/US/Arizona right/US/Central right/US/East-Indiana right/US/Eastern right/US/Hawaii right/US/Indiana-Starke right/US/Michigan right/US/Mountain right/US/Pacific right/US/Pacific-New right/US/Samoa right/UTC right/Universal right/W-SU right/WET right/Zulu Africa/ Africa/Abidjan Africa/Accra Africa/Addis_Ababa Africa/Algiers Africa/Asmara Africa/Asmera Africa/Bamako Africa/Bangui Africa/Banjul Africa/Bissau Africa/Blantyre Africa/Brazzaville Africa/Bujumbura Africa/Cairo Africa/Casablanca Africa/Ceuta Africa/Conakry Africa/Dakar Africa/Dar_es_Salaam Africa/Djibouti Africa/Douala Africa/El_Aaiun Africa/Freetown Africa/Gaborone Africa/Harare Africa/Johannesburg Africa/Kampala Africa/Khartoum Africa/Kigali Africa/Kinshasa Africa/Lagos Africa/Libreville Africa/Lome Africa/Luanda Africa/Lubumbashi Africa/Lusaka Africa/Malabo Africa/Maputo Africa/Maseru Africa/Mbabane Africa/Mogadishu Africa/Monrovia Africa/Nairobi Africa/Ndjamena Africa/Niamey Africa/Nouakchott Africa/Ouagadougou Africa/Porto-Novo Africa/Sao_Tome Africa/Timbuktu Africa/Tripoli Africa/Tunis Africa/Windhoek America/ America/Adak America/Anchorage America/Anguilla America/Antigua America/Araguaina America/Argentina/ America/Argentina/Buenos_Aires America/Argentina/Catamarca America/Argentina/ComodRivadavia America/Argentina/Cordoba America/Argentina/Jujuy America/Argentina/La_Rioja America/Argentina/Mendoza America/Argentina/Rio_Gallegos America/Argentina/Salta America/Argentina/San_Juan America/Argentina/San_Luis America/Argentina/Tucuman America/Argentina/Ushuaia America/Aruba America/Asuncion America/Atikokan America/Atka America/Bahia America/Barbados America/Belem America/Belize America/Blanc-Sablon America/Boa_Vista America/Bogota America/Boise America/Buenos_Aires America/Cambridge_Bay America/Campo_Grande America/Cancun America/Caracas America/Catamarca America/Cayenne America/Cayman America/Chicago America/Chihuahua America/Coral_Harbour America/Cordoba America/Costa_Rica America/Cuiaba America/Curacao America/Danmarkshavn America/Dawson America/Dawson_Creek America/Denver America/Detroit America/Dominica America/Edmonton America/Eirunepe America/El_Salvador America/Ensenada America/Fort_Wayne America/Fortaleza America/Glace_Bay America/Godthab America/Goose_Bay America/Grand_Turk America/Grenada America/Guadeloupe America/Guatemala America/Guayaquil America/Guyana America/Halifax America/Havana America/Hermosillo America/Indiana/ America/Indiana/Indianapolis America/Indiana/Knox America/Indiana/Marengo America/Indiana/Petersburg America/Indiana/Tell_City America/Indiana/Vevay America/Indiana/Vincennes America/Indiana/Winamac America/Indianapolis America/Inuvik America/Iqaluit America/Jamaica America/Jujuy America/Juneau America/Kentucky/ America/Kentucky/Louisville America/Kentucky/Monticello America/Knox_IN America/La_Paz America/Lima America/Los_Angeles America/Louisville America/Maceio America/Managua America/Manaus America/Marigot America/Martinique America/Matamoros America/Mazatlan America/Mendoza America/Menominee America/Merida America/Mexico_City America/Miquelon America/Moncton America/Monterrey America/Montevideo America/Montreal America/Montserrat America/Nassau America/New_York America/Nipigon America/Nome America/Noronha America/North_Dakota/ America/North_Dakota/Center America/North_Dakota/New_Salem America/Ojinaga America/Panama America/Pangnirtung America/Paramaribo America/Phoenix America/Port-au-Prince America/Port_of_Spain America/Porto_Acre America/Porto_Velho America/Puerto_Rico America/Rainy_River America/Rankin_Inlet America/Recife America/Regina America/Resolute America/Rio_Branco America/Rosario America/Santa_Isabel America/Santarem America/Santiago America/Santo_Domingo America/Sao_Paulo America/Scoresbysund America/Shiprock America/St_Barthelemy America/St_Johns America/St_Kitts America/St_Lucia America/St_Thomas America/St_Vincent America/Swift_Current America/Tegucigalpa America/Thule America/Thunder_Bay America/Tijuana America/Toronto America/Tortola America/Vancouver America/Virgin America/Whitehorse America/Winnipeg America/Yakutat America/Yellowknife Antarctica/ Antarctica/Casey Antarctica/Davis Antarctica/DumontDUrville Antarctica/Mawson Antarctica/McMurdo Antarctica/Palmer Antarctica/Rothera Antarctica/South_Pole Antarctica/Syowa Antarctica/Vostok Arctic/ Arctic/Longyearbyen Asia/ Asia/Aden Asia/Almaty Asia/Amman Asia/Anadyr Asia/Aqtau Asia/Aqtobe Asia/Ashgabat Asia/Ashkhabad Asia/Baghdad Asia/Bahrain Asia/Baku Asia/Bangkok Asia/Beirut Asia/Bishkek Asia/Brunei Asia/Calcutta Asia/Choibalsan Asia/Chongqing Asia/Chungking Asia/Colombo Asia/Dacca Asia/Damascus Asia/Dhaka Asia/Dili Asia/Dubai Asia/Dushanbe Asia/Gaza Asia/Harbin Asia/Ho_Chi_Minh Asia/Hong_Kong Asia/Hovd Asia/Irkutsk Asia/Istanbul Asia/Jakarta Asia/Jayapura Asia/Jerusalem Asia/Kabul Asia/Kamchatka Asia/Karachi Asia/Kashgar Asia/Kathmandu Asia/Katmandu Asia/Kolkata Asia/Krasnoyarsk Asia/Kuala_Lumpur Asia/Kuching Asia/Kuwait Asia/Macao Asia/Macau Asia/Magadan Asia/Makassar Asia/Manila Asia/Muscat Asia/Nicosia Asia/Novokuznetsk Asia/Novosibirsk Asia/Omsk Asia/Oral Asia/Phnom_Penh Asia/Pontianak Asia/Pyongyang Asia/Qatar Asia/Qyzylorda Asia/Rangoon Asia/Riyadh Asia/Riyadh87 Asia/Riyadh88 Asia/Riyadh89 Asia/Saigon Asia/Sakhalin Asia/Samarkand Asia/Seoul Asia/Shanghai Asia/Singapore Asia/Taipei Asia/Tashkent Asia/Tbilisi Asia/Tehran Asia/Tel_Aviv Asia/Thimbu Asia/Thimphu Asia/Tokyo Asia/Ujung_Pandang Asia/Ulaanbaatar Asia/Ulan_Bator Asia/Urumqi Asia/Vientiane Asia/Vladivostok Asia/Yakutsk Asia/Yekaterinburg Asia/Yerevan Atlantic/ Atlantic/Azores Atlantic/Bermuda Atlantic/Canary Atlantic/Cape_Verde Atlantic/Faeroe Atlantic/Faroe Atlantic/Jan_Mayen Atlantic/Madeira Atlantic/Reykjavik Atlantic/South_Georgia Atlantic/St_Helena Atlantic/Stanley Australia/ Australia/ACT Australia/Adelaide Australia/Brisbane Australia/Broken_Hill Australia/Canberra Australia/Currie Australia/Darwin Australia/Eucla Australia/Hobart Australia/LHI Australia/Lindeman Australia/Lord_Howe Australia/Melbourne Australia/NSW Australia/North Australia/Perth Australia/Queensland Australia/South Australia/Sydney Australia/Tasmania Australia/Victoria Australia/West Australia/Yancowinna Brazil/ Brazil/Acre Brazil/DeNoronha Brazil/East Brazil/West CET CST6CDT Canada/ Canada/Atlantic Canada/Central Canada/East-Saskatchewan Canada/Eastern Canada/Mountain Canada/Newfoundland Canada/Pacific Canada/Saskatchewan Canada/Yukon Chile/ Chile/Continental Chile/EasterIsland Cuba EET EST EST5EDT Egypt Eire Etc/ Etc/GMT Etc/GMT+0 Etc/GMT+1 Etc/GMT+10 Etc/GMT+11 Etc/GMT+12 Etc/GMT+2 Etc/GMT+3 Etc/GMT+4 Etc/GMT+5 Etc/GMT+6 Etc/GMT+7 Etc/GMT+8 Etc/GMT+9 Etc/GMT-0 Etc/GMT-1 Etc/GMT-10 Etc/GMT-11 Etc/GMT-12 Etc/GMT-13 Etc/GMT-14 Etc/GMT-2 Etc/GMT-3 Etc/GMT-4 Etc/GMT-5 Etc/GMT-6 Etc/GMT-7 Etc/GMT-8 Etc/GMT-9 Etc/GMT0 Etc/Greenwich Etc/UCT Etc/UTC Etc/Universal Etc/Zulu Europe/ Europe/Amsterdam Europe/Andorra Europe/Athens Europe/Belfast Europe/Belgrade Europe/Berlin Europe/Bratislava Europe/Brussels Europe/Bucharest Europe/Budapest Europe/Chisinau Europe/Copenhagen Europe/Dublin Europe/Gibraltar Europe/Guernsey Europe/Helsinki Europe/Isle_of_Man Europe/Istanbul Europe/Jersey Europe/Kaliningrad Europe/Kiev Europe/Lisbon Europe/Ljubljana Europe/London Europe/Luxembourg Europe/Madrid Europe/Malta Europe/Mariehamn Europe/Minsk Europe/Monaco Europe/Moscow Europe/Nicosia Europe/Oslo Europe/Paris Europe/Podgorica Europe/Prague Europe/Riga Europe/Rome Europe/Samara Europe/San_Marino Europe/Sarajevo Europe/Simferopol Europe/Skopje Europe/Sofia Europe/Stockholm Europe/Tallinn Europe/Tirane Europe/Tiraspol Europe/Uzhgorod Europe/Vaduz Europe/Vatican Europe/Vienna Europe/Vilnius Europe/Volgograd Europe/Warsaw Europe/Zagreb Europe/Zaporozhye Europe/Zurich Factory GB GB-Eire GMT GMT+0 GMT-0 GMT0 Greenwich HST Hongkong Iceland Indian/ Indian/Antananarivo Indian/Chagos Indian/Christmas Indian/Cocos Indian/Comoro Indian/Kerguelen Indian/Mahe Indian/Maldives Indian/Mauritius Indian/Mayotte Indian/Reunion Iran Israel Jamaica Japan Kwajalein Libya MET MST MST7MDT Mexico/ Mexico/BajaNorte Mexico/BajaSur Mexico/General Mideast/ Mideast/Riyadh87 Mideast/Riyadh88 Mideast/Riyadh89 NZ NZ-CHAT Navajo PRC PST8PDT Pacific/ Pacific/Apia Pacific/Auckland Pacific/Chatham Pacific/Easter Pacific/Efate Pacific/Enderbury Pacific/Fakaofo Pacific/Fiji Pacific/Funafuti Pacific/Galapagos Pacific/Gambier Pacific/Guadalcanal Pacific/Guam Pacific/Honolulu Pacific/Johnston Pacific/Kiritimati Pacific/Kosrae Pacific/Kwajalein Pacific/Majuro Pacific/Marquesas Pacific/Midway Pacific/Nauru Pacific/Niue Pacific/Norfolk Pacific/Noumea Pacific/Pago_Pago Pacific/Palau Pacific/Pitcairn Pacific/Ponape Pacific/Port_Moresby Pacific/Rarotonga Pacific/Saipan Pacific/Samoa Pacific/Tahiti Pacific/Tarawa Pacific/Tongatapu Pacific/Truk Pacific/Wake Pacific/Wallis Pacific/Yap Poland Portugal ROC ROK Singapore Turkey UCT US/ US/Alaska US/Aleutian US/Arizona US/Central US/East-Indiana US/Eastern US/Hawaii US/Indiana-Starke US/Michigan US/Mountain US/Pacific US/Pacific-New US/Samoa UTC Universal W-SU WET Zulu posix/ posix/Africa/ posix/Africa/Abidjan posix/Africa/Accra posix/Africa/Addis_Ababa posix/Africa/Algiers posix/Africa/Asmara posix/Africa/Asmera posix/Africa/Bamako posix/Africa/Bangui posix/Africa/Banjul posix/Africa/Bissau posix/Africa/Blantyre posix/Africa/Brazzaville posix/Africa/Bujumbura posix/Africa/Cairo posix/Africa/Casablanca posix/Africa/Ceuta posix/Africa/Conakry posix/Africa/Dakar posix/Africa/Dar_es_Salaam posix/Africa/Djibouti posix/Africa/Douala posix/Africa/El_Aaiun posix/Africa/Freetown posix/Africa/Gaborone posix/Africa/Harare posix/Africa/Johannesburg posix/Africa/Kampala posix/Africa/Khartoum posix/Africa/Kigali posix/Africa/Kinshasa posix/Africa/Lagos posix/Africa/Libreville posix/Africa/Lome posix/Africa/Luanda posix/Africa/Lubumbashi posix/Africa/Lusaka posix/Africa/Malabo posix/Africa/Maputo posix/Africa/Maseru posix/Africa/Mbabane posix/Africa/Mogadishu posix/Africa/Monrovia posix/Africa/Nairobi posix/Africa/Ndjamena posix/Africa/Niamey posix/Africa/Nouakchott posix/Africa/Ouagadougou posix/Africa/Porto-Novo posix/Africa/Sao_Tome posix/Africa/Timbuktu posix/Africa/Tripoli posix/Africa/Tunis posix/Africa/Windhoek posix/America/ posix/America/Adak posix/America/Anchorage posix/America/Anguilla posix/America/Antigua posix/America/Araguaina posix/America/Argentina/ posix/America/Argentina/Buenos_Aires posix/America/Argentina/Catamarca posix/America/Argentina/ComodRivadavia posix/America/Argentina/Cordoba posix/America/Argentina/Jujuy posix/America/Argentina/La_Rioja posix/America/Argentina/Mendoza posix/America/Argentina/Rio_Gallegos posix/America/Argentina/Salta posix/America/Argentina/San_Juan posix/America/Argentina/San_Luis posix/America/Argentina/Tucuman posix/America/Argentina/Ushuaia posix/America/Aruba posix/America/Asuncion posix/America/Atikokan posix/America/Atka posix/America/Bahia posix/America/Barbados posix/America/Belem posix/America/Belize posix/America/Blanc-Sablon posix/America/Boa_Vista posix/America/Bogota posix/America/Boise posix/America/Buenos_Aires posix/America/Cambridge_Bay posix/America/Campo_Grande posix/America/Cancun posix/America/Caracas posix/America/Catamarca posix/America/Cayenne posix/America/Cayman posix/America/Chicago posix/America/Chihuahua posix/America/Coral_Harbour posix/America/Cordoba posix/America/Costa_Rica posix/America/Cuiaba posix/America/Curacao posix/America/Danmarkshavn posix/America/Dawson posix/America/Dawson_Creek posix/America/Denver posix/America/Detroit posix/America/Dominica posix/America/Edmonton posix/America/Eirunepe posix/America/El_Salvador posix/America/Ensenada posix/America/Fort_Wayne posix/America/Fortaleza posix/America/Glace_Bay posix/America/Godthab posix/America/Goose_Bay posix/America/Grand_Turk posix/America/Grenada posix/America/Guadeloupe posix/America/Guatemala posix/America/Guayaquil posix/America/Guyana posix/America/Halifax posix/America/Havana posix/America/Hermosillo posix/America/Indiana/ posix/America/Indiana/Indianapolis posix/America/Indiana/Knox posix/America/Indiana/Marengo posix/America/Indiana/Petersburg posix/America/Indiana/Tell_City posix/America/Indiana/Vevay posix/America/Indiana/Vincennes posix/America/Indiana/Winamac posix/America/Indianapolis posix/America/Inuvik posix/America/Iqaluit posix/America/Jamaica posix/America/Jujuy posix/America/Juneau posix/America/Kentucky/ posix/America/Kentucky/Louisville posix/America/Kentucky/Monticello posix/America/Knox_IN posix/America/La_Paz posix/America/Lima posix/America/Los_Angeles posix/America/Louisville posix/America/Maceio posix/America/Managua posix/America/Manaus posix/America/Marigot posix/America/Martinique posix/America/Matamoros posix/America/Mazatlan posix/America/Mendoza posix/America/Menominee posix/America/Merida posix/America/Mexico_City posix/America/Miquelon posix/America/Moncton posix/America/Monterrey posix/America/Montevideo posix/America/Montreal posix/America/Montserrat posix/America/Nassau posix/America/New_York posix/America/Nipigon posix/America/Nome posix/America/Noronha posix/America/North_Dakota/ posix/America/North_Dakota/Center posix/America/North_Dakota/New_Salem posix/America/Ojinaga posix/America/Panama posix/America/Pangnirtung posix/America/Paramaribo posix/America/Phoenix posix/America/Port-au-Prince posix/America/Port_of_Spain posix/America/Porto_Acre posix/America/Porto_Velho posix/America/Puerto_Rico posix/America/Rainy_River posix/America/Rankin_Inlet posix/America/Recife posix/America/Regina posix/America/Resolute posix/America/Rio_Branco posix/America/Rosario posix/America/Santa_Isabel posix/America/Santarem posix/America/Santiago posix/America/Santo_Domingo posix/America/Sao_Paulo posix/America/Scoresbysund posix/America/Shiprock posix/America/St_Barthelemy posix/America/St_Johns posix/America/St_Kitts posix/America/St_Lucia posix/America/St_Thomas posix/America/St_Vincent posix/America/Swift_Current posix/America/Tegucigalpa posix/America/Thule posix/America/Thunder_Bay posix/America/Tijuana posix/America/Toronto posix/America/Tortola posix/America/Vancouver posix/America/Virgin posix/America/Whitehorse posix/America/Winnipeg posix/America/Yakutat posix/America/Yellowknife posix/Antarctica/ posix/Antarctica/Casey posix/Antarctica/Davis posix/Antarctica/DumontDUrville posix/Antarctica/Mawson posix/Antarctica/McMurdo posix/Antarctica/Palmer posix/Antarctica/Rothera posix/Antarctica/South_Pole posix/Antarctica/Syowa posix/Antarctica/Vostok posix/Arctic/ posix/Arctic/Longyearbyen posix/Asia/ posix/Asia/Aden posix/Asia/Almaty posix/Asia/Amman posix/Asia/Anadyr posix/Asia/Aqtau posix/Asia/Aqtobe posix/Asia/Ashgabat posix/Asia/Ashkhabad posix/Asia/Baghdad posix/Asia/Bahrain posix/Asia/Baku posix/Asia/Bangkok posix/Asia/Beirut posix/Asia/Bishkek posix/Asia/Brunei posix/Asia/Calcutta posix/Asia/Choibalsan posix/Asia/Chongqing posix/Asia/Chungking posix/Asia/Colombo posix/Asia/Dacca posix/Asia/Damascus posix/Asia/Dhaka posix/Asia/Dili posix/Asia/Dubai posix/Asia/Dushanbe posix/Asia/Gaza posix/Asia/Harbin posix/Asia/Ho_Chi_Minh posix/Asia/Hong_Kong posix/Asia/Hovd posix/Asia/Irkutsk posix/Asia/Istanbul posix/Asia/Jakarta posix/Asia/Jayapura posix/Asia/Jerusalem posix/Asia/Kabul posix/Asia/Kamchatka posix/Asia/Karachi posix/Asia/Kashgar posix/Asia/Kathmandu posix/Asia/Katmandu posix/Asia/Kolkata posix/Asia/Krasnoyarsk posix/Asia/Kuala_Lumpur posix/Asia/Kuching posix/Asia/Kuwait posix/Asia/Macao posix/Asia/Macau posix/Asia/Magadan posix/Asia/Makassar posix/Asia/Manila posix/Asia/Muscat posix/Asia/Nicosia posix/Asia/Novokuznetsk posix/Asia/Novosibirsk posix/Asia/Omsk posix/Asia/Oral posix/Asia/Phnom_Penh posix/Asia/Pontianak posix/Asia/Pyongyang posix/Asia/Qatar posix/Asia/Qyzylorda posix/Asia/Rangoon posix/Asia/Riyadh posix/Asia/Riyadh87 posix/Asia/Riyadh88 posix/Asia/Riyadh89 posix/Asia/Saigon posix/Asia/Sakhalin posix/Asia/Samarkand posix/Asia/Seoul posix/Asia/Shanghai posix/Asia/Singapore posix/Asia/Taipei posix/Asia/Tashkent posix/Asia/Tbilisi posix/Asia/Tehran posix/Asia/Tel_Aviv posix/Asia/Thimbu posix/Asia/Thimphu posix/Asia/Tokyo posix/Asia/Ujung_Pandang posix/Asia/Ulaanbaatar posix/Asia/Ulan_Bator posix/Asia/Urumqi posix/Asia/Vientiane posix/Asia/Vladivostok posix/Asia/Yakutsk posix/Asia/Yekaterinburg posix/Asia/Yerevan posix/Atlantic/ posix/Atlantic/Azores posix/Atlantic/Bermuda posix/Atlantic/Canary posix/Atlantic/Cape_Verde posix/Atlantic/Faeroe posix/Atlantic/Faroe posix/Atlantic/Jan_Mayen posix/Atlantic/Madeira posix/Atlantic/Reykjavik posix/Atlantic/South_Georgia posix/Atlantic/St_Helena posix/Atlantic/Stanley posix/Australia/ posix/Australia/ACT posix/Australia/Adelaide posix/Australia/Brisbane posix/Australia/Broken_Hill posix/Australia/Canberra posix/Australia/Currie posix/Australia/Darwin posix/Australia/Eucla posix/Australia/Hobart posix/Australia/LHI posix/Australia/Lindeman posix/Australia/Lord_Howe posix/Australia/Melbourne posix/Australia/NSW posix/Australia/North posix/Australia/Perth posix/Australia/Queensland posix/Australia/South posix/Australia/Sydney posix/Australia/Tasmania posix/Australia/Victoria posix/Australia/West posix/Australia/Yancowinna posix/Brazil/ posix/Brazil/Acre posix/Brazil/DeNoronha posix/Brazil/East posix/Brazil/West posix/CET posix/CST6CDT posix/Canada/ posix/Canada/Atlantic posix/Canada/Central posix/Canada/East-Saskatchewan posix/Canada/Eastern posix/Canada/Mountain posix/Canada/Newfoundland posix/Canada/Pacific posix/Canada/Saskatchewan posix/Canada/Yukon posix/Chile/ posix/Chile/Continental posix/Chile/EasterIsland posix/Cuba posix/EET posix/EST posix/EST5EDT posix/Egypt posix/Eire posix/Etc/ posix/Etc/GMT posix/Etc/GMT+0 posix/Etc/GMT+1 posix/Etc/GMT+10 posix/Etc/GMT+11 posix/Etc/GMT+12 posix/Etc/GMT+2 posix/Etc/GMT+3 posix/Etc/GMT+4 posix/Etc/GMT+5 posix/Etc/GMT+6 posix/Etc/GMT+7 posix/Etc/GMT+8 posix/Etc/GMT+9 posix/Etc/GMT-0 posix/Etc/GMT-1 posix/Etc/GMT-10 posix/Etc/GMT-11 posix/Etc/GMT-12 posix/Etc/GMT-13 posix/Etc/GMT-14 posix/Etc/GMT-2 posix/Etc/GMT-3 posix/Etc/GMT-4 posix/Etc/GMT-5 posix/Etc/GMT-6 posix/Etc/GMT-7 posix/Etc/GMT-8 posix/Etc/GMT-9 posix/Etc/GMT0 posix/Etc/Greenwich posix/Etc/UCT posix/Etc/UTC posix/Etc/Universal posix/Etc/Zulu posix/Europe/ posix/Europe/Amsterdam posix/Europe/Andorra posix/Europe/Athens posix/Europe/Belfast posix/Europe/Belgrade posix/Europe/Berlin posix/Europe/Bratislava posix/Europe/Brussels posix/Europe/Bucharest posix/Europe/Budapest posix/Europe/Chisinau posix/Europe/Copenhagen posix/Europe/Dublin posix/Europe/Gibraltar posix/Europe/Guernsey posix/Europe/Helsinki posix/Europe/Isle_of_Man posix/Europe/Istanbul posix/Europe/Jersey posix/Europe/Kaliningrad posix/Europe/Kiev posix/Europe/Lisbon posix/Europe/Ljubljana posix/Europe/London posix/Europe/Luxembourg posix/Europe/Madrid posix/Europe/Malta posix/Europe/Mariehamn posix/Europe/Minsk posix/Europe/Monaco posix/Europe/Moscow posix/Europe/Nicosia posix/Europe/Oslo posix/Europe/Paris posix/Europe/Podgorica posix/Europe/Prague posix/Europe/Riga posix/Europe/Rome posix/Europe/Samara posix/Europe/San_Marino posix/Europe/Sarajevo posix/Europe/Simferopol posix/Europe/Skopje posix/Europe/Sofia posix/Europe/Stockholm posix/Europe/Tallinn posix/Europe/Tirane posix/Europe/Tiraspol posix/Europe/Uzhgorod posix/Europe/Vaduz posix/Europe/Vatican posix/Europe/Vienna posix/Europe/Vilnius posix/Europe/Volgograd posix/Europe/Warsaw posix/Europe/Zagreb posix/Europe/Zaporozhye posix/Europe/Zurich posix/Factory posix/GB posix/GB-Eire posix/GMT posix/GMT+0 posix/GMT-0 posix/GMT0 posix/Greenwich posix/HST posix/Hongkong posix/Iceland posix/Indian/ posix/Indian/Antananarivo posix/Indian/Chagos posix/Indian/Christmas posix/Indian/Cocos posix/Indian/Comoro posix/Indian/Kerguelen posix/Indian/Mahe posix/Indian/Maldives posix/Indian/Mauritius posix/Indian/Mayotte posix/Indian/Reunion posix/Iran posix/Israel posix/Jamaica posix/Japan posix/Kwajalein posix/Libya posix/MET posix/MST posix/MST7MDT posix/Mexico/ posix/Mexico/BajaNorte posix/Mexico/BajaSur posix/Mexico/General posix/Mideast/ posix/Mideast/Riyadh87 posix/Mideast/Riyadh88 posix/Mideast/Riyadh89 posix/NZ posix/NZ-CHAT posix/Navajo posix/PRC posix/PST8PDT posix/Pacific/ posix/Pacific/Apia posix/Pacific/Auckland posix/Pacific/Chatham posix/Pacific/Easter posix/Pacific/Efate posix/Pacific/Enderbury posix/Pacific/Fakaofo posix/Pacific/Fiji posix/Pacific/Funafuti posix/Pacific/Galapagos posix/Pacific/Gambier posix/Pacific/Guadalcanal posix/Pacific/Guam posix/Pacific/Honolulu posix/Pacific/Johnston posix/Pacific/Kiritimati posix/Pacific/Kosrae posix/Pacific/Kwajalein posix/Pacific/Majuro posix/Pacific/Marquesas posix/Pacific/Midway posix/Pacific/Nauru posix/Pacific/Niue posix/Pacific/Norfolk posix/Pacific/Noumea posix/Pacific/Pago_Pago posix/Pacific/Palau posix/Pacific/Pitcairn posix/Pacific/Ponape posix/Pacific/Port_Moresby posix/Pacific/Rarotonga posix/Pacific/Saipan posix/Pacific/Samoa posix/Pacific/Tahiti posix/Pacific/Tarawa posix/Pacific/Tongatapu posix/Pacific/Truk posix/Pacific/Wake posix/Pacific/Wallis posix/Pacific/Yap posix/Poland posix/Portugal posix/ROC posix/ROK posix/Singapore posix/Turkey posix/UCT posix/US/ posix/US/Alaska posix/US/Aleutian posix/US/Arizona posix/US/Central posix/US/East-Indiana posix/US/Eastern posix/US/Hawaii posix/US/Indiana-Starke posix/US/Michigan posix/US/Mountain posix/US/Pacific posix/US/Pacific-New posix/US/Samoa posix/UTC posix/Universal posix/W-SU posix/WET posix/Zulu posixrules right/ right/Africa/ right/Africa/Abidjan right/Africa/Accra right/Africa/Addis_Ababa right/Africa/Algiers right/Africa/Asmara right/Africa/Asmera right/Africa/Bamako right/Africa/Bangui right/Africa/Banjul right/Africa/Bissau right/Africa/Blantyre right/Africa/Brazzaville right/Africa/Bujumbura right/Africa/Cairo right/Africa/Casablanca right/Africa/Ceuta right/Africa/Conakry right/Africa/Dakar right/Africa/Dar_es_Salaam right/Africa/Djibouti right/Africa/Douala right/Africa/El_Aaiun right/Africa/Freetown right/Africa/Gaborone right/Africa/Harare right/Africa/Johannesburg right/Africa/Kampala right/Africa/Khartoum right/Africa/Kigali right/Africa/Kinshasa right/Africa/Lagos right/Africa/Libreville right/Africa/Lome right/Africa/Luanda right/Africa/Lubumbashi right/Africa/Lusaka right/Africa/Malabo right/Africa/Maputo right/Africa/Maseru right/Africa/Mbabane right/Africa/Mogadishu right/Africa/Monrovia right/Africa/Nairobi right/Africa/Ndjamena right/Africa/Niamey right/Africa/Nouakchott right/Africa/Ouagadougou right/Africa/Porto-Novo right/Africa/Sao_Tome right/Africa/Timbuktu right/Africa/Tripoli right/Africa/Tunis right/Africa/Windhoek right/America/ right/America/Adak right/America/Anchorage right/America/Anguilla right/America/Antigua right/America/Araguaina right/America/Argentina/ right/America/Argentina/Buenos_Aires right/America/Argentina/Catamarca right/America/Argentina/ComodRivadavia right/America/Argentina/Cordoba right/America/Argentina/Jujuy right/America/Argentina/La_Rioja right/America/Argentina/Mendoza right/America/Argentina/Rio_Gallegos right/America/Argentina/Salta right/America/Argentina/San_Juan right/America/Argentina/San_Luis right/America/Argentina/Tucuman right/America/Argentina/Ushuaia right/America/Aruba right/America/Asuncion right/America/Atikokan right/America/Atka right/America/Bahia right/America/Barbados right/America/Belem right/America/Belize right/America/Blanc-Sablon right/America/Boa_Vista right/America/Bogota right/America/Boise right/America/Buenos_Aires right/America/Cambridge_Bay right/America/Campo_Grande right/America/Cancun right/America/Caracas right/America/Catamarca right/America/Cayenne right/America/Cayman right/America/Chicago right/America/Chihuahua right/America/Coral_Harbour right/America/Cordoba right/America/Costa_Rica right/America/Cuiaba right/America/Curacao right/America/Danmarkshavn right/America/Dawson right/America/Dawson_Creek right/America/Denver right/America/Detroit right/America/Dominica right/America/Edmonton right/America/Eirunepe right/America/El_Salvador right/America/Ensenada right/America/Fort_Wayne right/America/Fortaleza right/America/Glace_Bay right/America/Godthab right/America/Goose_Bay right/America/Grand_Turk right/America/Grenada right/America/Guadeloupe right/America/Guatemala right/America/Guayaquil right/America/Guyana right/America/Halifax right/America/Havana right/America/Hermosillo right/America/Indiana/ right/America/Indiana/Indianapolis right/America/Indiana/Knox right/America/Indiana/Marengo right/America/Indiana/Petersburg right/America/Indiana/Tell_City right/America/Indiana/Vevay right/America/Indiana/Vincennes right/America/Indiana/Winamac right/America/Indianapolis right/America/Inuvik right/America/Iqaluit right/America/Jamaica right/America/Jujuy right/America/Juneau right/America/Kentucky/ right/America/Kentucky/Louisville right/America/Kentucky/Monticello right/America/Knox_IN right/America/La_Paz right/America/Lima right/America/Los_Angeles right/America/Louisville right/America/Maceio right/America/Managua right/America/Manaus right/America/Marigot right/America/Martinique right/America/Matamoros right/America/Mazatlan right/America/Mendoza right/America/Menominee right/America/Merida right/America/Mexico_City right/America/Miquelon right/America/Moncton right/America/Monterrey right/America/Montevideo right/America/Montreal right/America/Montserrat right/America/Nassau right/America/New_York right/America/Nipigon right/America/Nome right/America/Noronha right/America/North_Dakota/ right/America/North_Dakota/Center right/America/North_Dakota/New_Salem right/America/Ojinaga right/America/Panama right/America/Pangnirtung right/America/Paramaribo right/America/Phoenix right/America/Port-au-Prince right/America/Port_of_Spain right/America/Porto_Acre right/America/Porto_Velho right/America/Puerto_Rico right/America/Rainy_River right/America/Rankin_Inlet right/America/Recife right/America/Regina right/America/Resolute right/America/Rio_Branco right/America/Rosario right/America/Santa_Isabel right/America/Santarem right/America/Santiago right/America/Santo_Domingo right/America/Sao_Paulo right/America/Scoresbysund right/America/Shiprock right/America/St_Barthelemy right/America/St_Johns right/America/St_Kitts right/America/St_Lucia right/America/St_Thomas right/America/St_Vincent right/America/Swift_Current right/America/Tegucigalpa right/America/Thule right/America/Thunder_Bay right/America/Tijuana right/America/Toronto right/America/Tortola right/America/Vancouver right/America/Virgin right/America/Whitehorse right/America/Winnipeg right/America/Yakutat right/America/Yellowknife right/Antarctica/ right/Antarctica/Casey right/Antarctica/Davis right/Antarctica/DumontDUrville right/Antarctica/Mawson right/Antarctica/McMurdo right/Antarctica/Palmer right/Antarctica/Rothera right/Antarctica/South_Pole right/Antarctica/Syowa right/Antarctica/Vostok right/Arctic/ right/Arctic/Longyearbyen right/Asia/ right/Asia/Aden right/Asia/Almaty right/Asia/Amman right/Asia/Anadyr right/Asia/Aqtau right/Asia/Aqtobe right/Asia/Ashgabat right/Asia/Ashkhabad right/Asia/Baghdad right/Asia/Bahrain right/Asia/Baku right/Asia/Bangkok right/Asia/Beirut right/Asia/Bishkek right/Asia/Brunei right/Asia/Calcutta right/Asia/Choibalsan right/Asia/Chongqing right/Asia/Chungking right/Asia/Colombo right/Asia/Dacca right/Asia/Damascus right/Asia/Dhaka right/Asia/Dili right/Asia/Dubai right/Asia/Dushanbe right/Asia/Gaza right/Asia/Harbin right/Asia/Ho_Chi_Minh right/Asia/Hong_Kong right/Asia/Hovd right/Asia/Irkutsk right/Asia/Istanbul right/Asia/Jakarta right/Asia/Jayapura right/Asia/Jerusalem right/Asia/Kabul right/Asia/Kamchatka right/Asia/Karachi right/Asia/Kashgar right/Asia/Kathmandu right/Asia/Katmandu right/Asia/Kolkata right/Asia/Krasnoyarsk right/Asia/Kuala_Lumpur right/Asia/Kuching right/Asia/Kuwait right/Asia/Macao right/Asia/Macau right/Asia/Magadan right/Asia/Makassar right/Asia/Manila right/Asia/Muscat right/Asia/Nicosia right/Asia/Novokuznetsk right/Asia/Novosibirsk right/Asia/Omsk right/Asia/Oral right/Asia/Phnom_Penh right/Asia/Pontianak right/Asia/Pyongyang right/Asia/Qatar right/Asia/Qyzylorda right/Asia/Rangoon right/Asia/Riyadh right/Asia/Riyadh87 right/Asia/Riyadh88 right/Asia/Riyadh89 right/Asia/Saigon right/Asia/Sakhalin right/Asia/Samarkand right/Asia/Seoul right/Asia/Shanghai right/Asia/Singapore right/Asia/Taipei right/Asia/Tashkent right/Asia/Tbilisi right/Asia/Tehran right/Asia/Tel_Aviv right/Asia/Thimbu right/Asia/Thimphu right/Asia/Tokyo right/Asia/Ujung_Pandang right/Asia/Ulaanbaatar right/Asia/Ulan_Bator right/Asia/Urumqi right/Asia/Vientiane right/Asia/Vladivostok right/Asia/Yakutsk right/Asia/Yekaterinburg right/Asia/Yerevan right/Atlantic/ right/Atlantic/Azores right/Atlantic/Bermuda right/Atlantic/Canary right/Atlantic/Cape_Verde right/Atlantic/Faeroe right/Atlantic/Faroe right/Atlantic/Jan_Mayen right/Atlantic/Madeira right/Atlantic/Reykjavik right/Atlantic/South_Georgia right/Atlantic/St_Helena right/Atlantic/Stanley right/Australia/ right/Australia/ACT right/Australia/Adelaide right/Australia/Brisbane right/Australia/Broken_Hill right/Australia/Canberra right/Australia/Currie right/Australia/Darwin right/Australia/Eucla right/Australia/Hobart right/Australia/LHI right/Australia/Lindeman right/Australia/Lord_Howe right/Australia/Melbourne right/Australia/NSW right/Australia/North right/Australia/Perth right/Australia/Queensland right/Australia/South right/Australia/Sydney right/Australia/Tasmania right/Australia/Victoria right/Australia/West right/Australia/Yancowinna right/Brazil/ right/Brazil/Acre right/Brazil/DeNoronha right/Brazil/East right/Brazil/West right/CET right/CST6CDT right/Canada/ right/Canada/Atlantic right/Canada/Central right/Canada/East-Saskatchewan right/Canada/Eastern right/Canada/Mountain right/Canada/Newfoundland right/Canada/Pacific right/Canada/Saskatchewan right/Canada/Yukon right/Chile/ right/Chile/Continental right/Chile/EasterIsland right/Cuba right/EET right/EST right/EST5EDT right/Egypt right/Eire right/Etc/ right/Etc/GMT right/Etc/GMT+0 right/Etc/GMT+1 right/Etc/GMT+10 right/Etc/GMT+11 right/Etc/GMT+12 right/Etc/GMT+2 right/Etc/GMT+3 right/Etc/GMT+4 right/Etc/GMT+5 right/Etc/GMT+6 right/Etc/GMT+7 right/Etc/GMT+8 right/Etc/GMT+9 right/Etc/GMT-0 right/Etc/GMT-1 right/Etc/GMT-10 right/Etc/GMT-11 right/Etc/GMT-12 right/Etc/GMT-13 right/Etc/GMT-14 right/Etc/GMT-2 right/Etc/GMT-3 right/Etc/GMT-4 right/Etc/GMT-5 right/Etc/GMT-6 right/Etc/GMT-7 right/Etc/GMT-8 right/Etc/GMT-9 right/Etc/GMT0 right/Etc/Greenwich right/Etc/UCT right/Etc/UTC right/Etc/Universal right/Etc/Zulu right/Europe/ right/Europe/Amsterdam right/Europe/Andorra right/Europe/Athens right/Europe/Belfast right/Europe/Belgrade right/Europe/Berlin right/Europe/Bratislava right/Europe/Brussels right/Europe/Bucharest right/Europe/Budapest right/Europe/Chisinau right/Europe/Copenhagen right/Europe/Dublin right/Europe/Gibraltar right/Europe/Guernsey right/Europe/Helsinki right/Europe/Isle_of_Man right/Europe/Istanbul right/Europe/Jersey right/Europe/Kaliningrad right/Europe/Kiev right/Europe/Lisbon right/Europe/Ljubljana right/Europe/London right/Europe/Luxembourg right/Europe/Madrid right/Europe/Malta right/Europe/Mariehamn right/Europe/Minsk right/Europe/Monaco right/Europe/Moscow right/Europe/Nicosia right/Europe/Oslo right/Europe/Paris right/Europe/Podgorica right/Europe/Prague right/Europe/Riga right/Europe/Rome right/Europe/Samara right/Europe/San_Marino right/Europe/Sarajevo right/Europe/Simferopol right/Europe/Skopje right/Europe/Sofia right/Europe/Stockholm right/Europe/Tallinn right/Europe/Tirane right/Europe/Tiraspol right/Europe/Uzhgorod right/Europe/Vaduz right/Europe/Vatican right/Europe/Vienna right/Europe/Vilnius right/Europe/Volgograd right/Europe/Warsaw right/Europe/Zagreb right/Europe/Zaporozhye right/Europe/Zurich right/Factory right/GB right/GB-Eire right/GMT right/GMT+0 right/GMT-0 right/GMT0 right/Greenwich right/HST right/Hongkong right/Iceland right/Indian/ right/Indian/Antananarivo right/Indian/Chagos right/Indian/Christmas right/Indian/Cocos right/Indian/Comoro right/Indian/Kerguelen right/Indian/Mahe right/Indian/Maldives right/Indian/Mauritius right/Indian/Mayotte right/Indian/Reunion right/Iran right/Israel right/Jamaica right/Japan right/Kwajalein right/Libya right/MET right/MST right/MST7MDT right/Mexico/ right/Mexico/BajaNorte right/Mexico/BajaSur right/Mexico/General right/Mideast/ right/Mideast/Riyadh87 right/Mideast/Riyadh88 right/Mideast/Riyadh89 right/NZ right/NZ-CHAT right/Navajo right/PRC right/PST8PDT right/Pacific/ right/Pacific/Apia right/Pacific/Auckland right/Pacific/Chatham right/Pacific/Easter right/Pacific/Efate right/Pacific/Enderbury right/Pacific/Fakaofo right/Pacific/Fiji right/Pacific/Funafuti right/Pacific/Galapagos right/Pacific/Gambier right/Pacific/Guadalcanal right/Pacific/Guam right/Pacific/Honolulu right/Pacific/Johnston  . .. pppfirmware}ngroup:spwd.db protocols+services+ fstabE resolv.conf\ hostsE ... ... .B ..ztsscaleP: .B ..misc-\keymaps . ..termcapwheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root bin:*:7: news:*:8: wsrc:*:9: users:*:10: auth:*:11: games:*:13: staff:*:20:root smmsp:*:25: popa3d:*:26: sshd:*:27: _portmap:*:28: _identd:*:29: _rstatd:*:30: guest:*:31:root _rusersd:*:32: _fingerd:*:33: _sshagnt:*:34: _x11:*:35: utmp:*:45: _kdc:*:59: _kadmin:*:60: _lkm:*:61: _spamd:*:62: _radius:*:63: _token:*:64: _shadow:*:65: crontab:*:66: www:*:67: _isakmpd:*:68: network:*:69: named:*:70: proxy:*:71: authpf:*:72: _syslogd:*:73: _pflogd:*:74: _bgpd:*:75: _tcpdump:*:76: _dhcp:*:77: _mopd:*:78: _tftpd:*:79: _rbootd:*:80: _afs:*:81: _ppp:*:82: _ntp:*:83: _ftp:*:84: _ospfd:*:85: _hostapd:*:86: _dvmrpd:*:87: _ripd:*:88: _relayd:*:89: _ospf6d:*:90: _snmpd:*:91: _rtadvd:*:92: _ypldap:*:93: _btd:*:94: _smtpd:*:95: _rwalld:*:96: _nsd:*:97: _ldpd:*:98: dialer:*:117: nogroup:*:32766: nobody:*:32767: a  n} of!HC s n $  F A  r , r _nsd*aaNSD Daemon/var/empty/sbin/nologin2._relayd*YYRelay Daemon/var/empty/sbin/nologin2&_afs*QQafs Daemon/var/empty/sbin/nologin2_syslogd*IISyslog Daemon/var/empty/sbin/nologin2_kdc*;;Kerberos Server/var/empty/sbin/nologin2popa3d*POP3 Server/var/empty/sbin/nologin2_ypldap*]]YP to LDAP Daemon/var/empty/sbin/nologin3]_ospfd*UUOSPF Daemon/var/empty/sbin/nologin3U_dhcp*MMDHCP programs/var/empty/sbin/nologin3M_identd*identd/var/empty/sbin/nologin3_smtpd*__SMTP Daemon/var/empty/sbin/nologin1_smtpd_ppp*RRPPP utilities/var/empty/sbin/nologin1_ppp_mopd*NNMOP Daemon/var/empty/sbin/nologin1_mopd_rusersd* rpc.rusersd/var/empty/sbin/nologin1_rusersd_identd*identd/var/empty/sbin/nologin1_identdpopa3d*POP3 Server/var/empty/sbin/nologin1popa3d 08`K<  K(`[~ [~K`@@<@TU K b K?AK1'KO KO NAK+K+K+ CK 5K 5K 5 L&AK[KM"KM" 9 uaAKZK^$K? <AK^$Ku Ku +T׭K96KC8KC8fuK9K_K_`hpxPH)KK(KOKOA+KK #K #zjKmTKmTKmT/tmp/fstab.shadowK K K /tmp/resolv.conf.shadowO KO KO KO /tmp/hostseKu KК KКXtĮhLt `L]p#$r-"%Jh33ԁ 㶶F.`P}{\G?-'G3IoЙB rUC4b feoˮte',ܝ:_W`{T@J z,=cpܩ3wF"0Jɜ{N-Zܭ8ςn _lmǏ ZLPxAZcu ( YYIV3ݎ@ 8-;]p}$Z|` `Y*A;edn^AJldawL˵Dx2I;=~,3D Tnjusmi{(r6]kO<|@ԈE{a}xIFE it^׬xf8!]j.0i`@zu7đ>GNi 'K I1tH^' `*:GNƙG+*+ZeA { LDoj > 9 L G n i ( ( _ldpd*bbLDP Daemon/var/empty/sbin/nologin2/_ospf6d*ZZOSPF6 Daemon/var/empty/sbin/nologin2'_ppp*RRPPP utilities/var/empty/sbin/nologin2_pflogd*JJpflogd privsep/var/empty/sbin/nologin2_kadmin*<<Kerberos Admin Server/var/empty/sbin/nologin2sshd*sshd privsep/var/empty/sbin/nologin2nobody*Unprivileged user for NFS/nonexistent/sbin/nologin3_btd*^^Bluetooth Daemon/var/empty/sbin/nologin3^_hostapd*VVHostAP Daemon/var/empty/sbin/nologin3V_mopd*NNMOP Daemon/var/empty/sbin/nologin3Nnamed*FFBIND Name Service Daemon/var/named/sbin/nologin3F_spamd*>>Spam Daemon/var/empty/sbin/nologin3>_rstatd*rpc.rstatd/var/empty/sbin/nologin3_relayd*YYRelay Daemon/var/empty/sbin/nologin1_relayd_isakmpd*DDisakmpd privsep/var/empty/sbin/nologin1_isakmpdsmmsp*Sendmail Message Submission Program/nonexistent/sbin/nologin1smmsp.fa#A< r j %  > 9 ` [   D ? _ _ nobody*Unprivileged user for NFS/nonexistent/sbin/nologin20_snmpd*[[SNMP Daemon/var/empty/sbin/nologin2(_ntp*SSNTP Daemon/var/empty/sbin/nologin2 _bgpd*KKBGP Daemon/var/empty/sbin/nologin2_spamd*>>Spam Daemon/var/empty/sbin/nologin2_portmap*portmap/var/empty/sbin/nologin2_smtpd*__SMTP Daemon/var/empty/sbin/nologin3__dvmrpd*WWDVMRP Daemon/var/empty/sbin/nologin3W_tftpd*OOTFTP Daemon/var/empty/sbin/nologin3Oproxy*GGProxy Services/nonexistent/sbin/nologin3G_btd*^^Bluetooth Daemon/var/empty/sbin/nologin1_btd_ypldap*]]YP to LDAP Daemon/var/empty/sbin/nologin1_ypldap_snmpd*[[SNMP Daemon/var/empty/sbin/nologin1_snmpd_ospf6d*ZZOSPF6 Daemon/var/empty/sbin/nologin1_ospf6d_ftp*TTFTP Daemon/var/empty/sbin/nologin1_ftp_ntp*SSNTP Daemon/var/empty/sbin/nologin1_ntp_afs*QQafs Daemon/var/empty/sbin/nologin1_afs_rbootd*PPrbootd Daemon/var/empty/sbin/nologin1_rbootd_tftpd*OOTFTP Daemon/var/empty/sbin/nologin1_tftpd_kdc*;;Kerberos Server/var/empty/sbin/nologin1_kdc_x11*##X Server/var/empty/sbin/nologin1_x11_rstatd*rpc.rstatd/var/empty/sbin/nologin1_rstatdbin*Binaries Commands and Source,,,//sbin/nologin1binoi"ID p k 1 , = 8 X _rtadvd*\\IPv6 Router Advertisement Daemon/var/empty/sbin/nologin2)_ftp*TTFTP Daemon/var/empty/sbin/nologin2!_tcpdump*LLtcpdump privsep/var/empty/sbin/nologin2uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico2_identd*identd/var/empty/sbin/nologin2 rootdaemonCharlie &/root/bin/ksh2_rwalld*``rpc.rwalld/var/empty/sbin/nologin3`_ripd*XXRIP Daemon/var/empty/sbin/nologin3X_rbootd*PPrbootd Daemon/var/empty/sbin/nologin3P_rusersd* rpc.rusersd/var/empty/sbin/nologin3 rootdaemonCharlie &/root/bin/ksh3_hostapd*VVHostAP Daemon/var/empty/sbin/nologin1_hostapdproxy*GGProxy Services/nonexistent/sbin/nologin1proxy_portmap*portmap/var/empty/sbin/nologin1_portmapsshd*sshd privsep/var/empty/sbin/nologin1sshd$[T pk'" { 4 / ` [   C > ^ _ypldap*]]YP to LDAP Daemon/var/empty/sbin/nologin2*_ospfd*UUOSPF Daemon/var/empty/sbin/nologin2"_dhcp*MMDHCP programs/var/empty/sbin/nologin2www*CCHTTP Server/var/www/sbin/nologin2_rstatd*rpc.rstatd/var/empty/sbin/nologin2 daemon*The devil himself/root/sbin/nologin2_nsd*aaNSD Daemon/var/empty/sbin/nologin3a_relayd*YYRelay Daemon/var/empty/sbin/nologin3Y_afs*QQafs Daemon/var/empty/sbin/nologin3Q_syslogd*IISyslog Daemon/var/empty/sbin/nologin3I_fingerd*!!fingerd/var/empty/sbin/nologin3!smmsp*Sendmail Message Submission Program/nonexistent/sbin/nologin3daemon*The devil himself/root/sbin/nologin3nobody*Unprivileged user for NFS/nonexistent/sbin/nologin1nobody_ldpd*bbLDP Daemon/var/empty/sbin/nologin1_ldpd_ospfd*UUOSPF Daemon/var/empty/sbin/nologin1_ospfd_pflogd*JJpflogd privsep/var/empty/sbin/nologin1_pflogd_kadmin*<<Kerberos Admin Server/var/empty/sbin/nologin1_kadmin.vm,%KB K F   x s   } 8 3 b ]   } 7 7 _btd*^^Bluetooth Daemon/var/empty/sbin/nologin2+_hostapd*VVHostAP Daemon/var/empty/sbin/nologin2#_mopd*NNMOP Daemon/var/empty/sbin/nologin2_isakmpd*DDisakmpd privsep/var/empty/sbin/nologin2_rusersd* rpc.rusersd/var/empty/sbin/nologin2 operator*System &/operator/sbin/nologin2_ldpd*bbLDP Daemon/var/empty/sbin/nologin3b_ospf6d*ZZOSPF6 Daemon/var/empty/sbin/nologin3Z_ppp*RRPPP utilities/var/empty/sbin/nologin3R_pflogd*JJpflogd privsep/var/empty/sbin/nologin3Juucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico3Bpopa3d*POP3 Server/var/empty/sbin/nologin3operator*System &/operator/sbin/nologin3_nsd*aaNSD Daemon/var/empty/sbin/nologin1_nsd_rtadvd*\\IPv6 Router Advertisement Daemon/var/empty/sbin/nologin1_rtadvd_dvmrpd*WWDVMRP Daemon/var/empty/sbin/nologin1_dvmrpd_tcpdump*LLtcpdump privsep/var/empty/sbin/nologin1_tcpdump_bgpd*KKBGP Daemon/var/empty/sbin/nologin1_bgpd_syslogd*IISyslog Daemon/var/empty/sbin/nologin1_syslogd_spamd*>>Spam Daemon/var/empty/sbin/nologin1_spamdoperator*System &/operator/sbin/nologin1operatordaemon*The devil himself/root/sbin/nologin1daemonrootdaemonCharlie &/root/bin/ksh1root$\Vlg%  U P  } 2 - P K   p _smtpd*__SMTP Daemon/var/empty/sbin/nologin2,_dvmrpd*WWDVMRP Daemon/var/empty/sbin/nologin2$_tftpd*OOTFTP Daemon/var/empty/sbin/nologin2named*FFBIND Name Service Daemon/var/named/sbin/nologin2_fingerd*!!fingerd/var/empty/sbin/nologin2 bin*Binaries Commands and Source,,,//sbin/nologin2_snmpd*[[SNMP Daemon/var/empty/sbin/nologin3[_ntp*SSNTP Daemon/var/empty/sbin/nologin3S_bgpd*KKBGP Daemon/var/empty/sbin/nologin3Kwww*CCHTTP Server/var/www/sbin/nologin3C_kdc*;;Kerberos Server/var/empty/sbin/nologin3;_x11*##X Server/var/empty/sbin/nologin3#sshd*sshd privsep/var/empty/sbin/nologin3bin*Binaries Commands and Source,,,//sbin/nologin3_rwalld*``rpc.rwalld/var/empty/sbin/nologin1_rwalldnamed*FFBIND Name Service Daemon/var/named/sbin/nologin1namedwww*CCHTTP Server/var/www/sbin/nologin1wwwuucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico1uucplf% >9 M H ] X  B _rwalld*``rpc.rwalld/var/empty/sbin/nologin2-_ripd*XXRIP Daemon/var/empty/sbin/nologin2%_rbootd*PPrbootd Daemon/var/empty/sbin/nologin2proxy*GGProxy Services/nonexistent/sbin/nologin2_x11*##X Server/var/empty/sbin/nologin2 smmsp*Sendmail Message Submission Program/nonexistent/sbin/nologin2_rtadvd*\\IPv6 Router Advertisement Daemon/var/empty/sbin/nologin3\_ftp*TTFTP Daemon/var/empty/sbin/nologin3T_tcpdump*LLtcpdump privsep/var/empty/sbin/nologin3L_isakmpd*DDisakmpd privsep/var/empty/sbin/nologin3D_kadmin*<<Kerberos Admin Server/var/empty/sbin/nologin3<_portmap*portmap/var/empty/sbin/nologin3_ripd*XXRIP Daemon/var/empty/sbin/nologin1_ripd_dhcp*MMDHCP programs/var/empty/sbin/nologin1_dhcp_fingerd*!!fingerd/var/empty/sbin/nologin1_fingerdip 0 IP icmp 1 ICMP tcp 6 TCP udp 17 UDP ftp-data 20/tcp ftp 21/tcp domain 53/tcp nameserver domain 53/udp nameserver www 80/tcp http shell 514/tcp cmd nfsd 2049/udp nfs nfsd 2049/tcp nfs dumb|80-column dumb tty:\ :am:\ :co#80:\ :bl=^G:cr=^M:do=^J:sf=^J: vt100|vt100-am|dec vt100 (w/advanced video):\ :5i:am:bs:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :@8=\EOM:DO=\E[%dB:K1=\EOq:K2=\EOr:K3=\EOs:K4=\EOp:K5=\EOn:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=^O:as=^N:bl=^G:cb=\E[1K:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:do=^J:\ :eA=\E(B\E)0:ho=\E[H:k0=\EOy:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k5=\EOt:k6=\EOu:k7=\EOv:k8=\EOl:k9=\EOw:k;=\EOx:\ :kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:kr=\EOC:ks=\E[?1h\E=:\ :ku=\EOA:l1=pf1:l2=pf2:l3=pf3:l4=pf4:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[0m:mr=\E[7m:nd=\E[C:pf=\E[4i:po=\E[5i:\ :ps=\E[0i:rc=\E8:rs=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :..sa=\E[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t\016%e\017%;$<2>:\ :sc=\E7:se=\E[m:sf=^J:so=\E[7m:sr=\EM:st=\EH:ta=^I:ue=\E[m:\ :up=\E[A:us=\E[4m: vt220|vt200|dec vt220:\ :5i:am:bs:mi:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :%0=\E[29~:%1=\E[28~:*6=\E[4~:@0=\E[1~:AL=\E[%dL:\ :DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:F1=\E[23~:F2=\E[24~:\ :F3=\E[25~:F4=\E[26~:F7=\E[31~:F8=\E[32~:F9=\E[33~:\ :FA=\E[34~:IC=\E[%d@:LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:\ :SA=\E[?7h:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\E(B:al=\E[L:as=\E(0:bl=^G:cb=\E[1K:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :ct=\E[3g:dc=\E[P:dl=\E[M:do=^J:eA=\E)0:ec=\E[%dX:ei=\E[4l:\ :ho=\E[H:if=/usr/share/tabset/vt100:im=\E[4h:\ :is=\E[?7h\E[>\E[?1h\E F\E[?4l:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k6=\E[17~:k7=\E[18~:k8=\E[19~:k9=\E[20~:\ :k;=\E[21~:kI=\E[2~:kN=\E[6~:kP=\E[5~:kb=^H:kd=\E[B:\ :kl=\E[D:kr=\E[C:ku=\E[A:l1=pf1:l2=pf2:l3=pf3:l4=pf4:le=^H:\ :mb=\E[5m:md=\E[1m:me=\E[0m:mr=\E[7m:nd=\E[C:nw=\EE:\ :pf=\E[4i:po=\E[5i:ps=\E[i:r1=\E[?3l:rc=\E8:sc=\E7:\ :se=\E[27m:sf=\ED:so=\E[7m:sr=\EM:st=\EH:ta=^I:ue=\E[24m:\ :up=\E[A:us=\E[4m:vb=\E[?5h\E[?5l: #!/bin/ksh MODE=install . install.sub cd /tmp DISK= DISKS_DONE= _DKDEVS=$(get_dkdevs) rm -f /tmp/fstab.shadow /tmp/fstab /tmp/fstab.* while :; do DISKS_DONE=$(addel "$DISK" $DISKS_DONE) _DKDEVS=$(rmel "$DISK" $_DKDEVS) if isin $ROOTDISK $_DKDEVS; then resp=$ROOTDISK rm -f fstab else ask_which "disk" "do you wish to initialize" \ '$(l=$(get_dkdevs); for a in $DISKS_DONE; do l=$(rmel $a $l); done; bsort $l)' \ done [[ $resp == done ]] && break fi DISK=$resp makedev $DISK || continue rm -f *.$DISK AUTOROOT=n md_prep_disklabel $DISK || { DISK= ; continue ; } grep -qs " / ffs " fstab.$ROOTDISK || \ { DISK= ; echo "'/' must be configured!" ; continue ; } if [[ -f fstab.$DISK ]]; then while read _pp _mp _rest; do [[ fstab.$DISK == $(grep -l " $_mp " fstab.*) ]] || \ { _rest=$DISK ; DISK= ; break ; } done /etc/fstab rm fstab.$_rest set -- $(grep -h " $_mp " fstab.*[0-9]) echo "$_pp and $1 can't both be mounted at $_mp." continue fi _i=${#_fsent[*]} while read _pp _mp _fstype _rest; do [[ $_fstype == ffs ]] || continue _OPT= [[ $_mp == / ]] && _OPT=$MDROOTFSOPT newfs -q $_OPT ${_pp##/dev/} _fsent[$_i]="$_mp!$_pp" : $(( _i += 1 )) done &1 | sed -ne \ "/^ *\([a-p]\): .* swap /s,,/dev/$DISK\1 none swap sw 0 0,p" | \ grep -v "^/dev/$SWAPDEV " >>fstab done for _mp in $(bsort ${_fsent[*]}); do _pp=${_mp##*!} _mp=${_mp%!*} echo -n "$_pp $_mp ffs rw" [[ $_mp == / ]] && { echo " 1 1" ; continue ; } echo -n ",nodev" case $_mp in /sbin|/usr) ;; /usr/bin|/usr/sbin) ;; /usr/libexec|/usr/libexec/*) ;; /usr/local|/usr/local/*) ;; /usr/X11R6|/usr/X11R6/bin) ;; *) echo -n ",nosuid" ;; esac echo " 1 2" done >>fstab cd / munge_fstab mount_fs "-o async" install_sets if [[ -z $TZ ]]; then ( cd /mnt/usr/share/zoneinfo ls -1dF `tar cvf /dev/null [A-Za-y]*` >/tmp/tzlist ) echo set_timezone /tmp/tzlist fi if [[ -s $SERVERLISTALL ]]; then _i= [[ -n $installedfrom ]] && _i="install=$installedfrom" [[ -n $TZ ]] && _i="$_i&TZ=$TZ" [[ -n $method ]] && _i="$_i&method=$method" [[ -n $_i ]] && ftp $FTPOPTS -a -o - \ "http://129.128.5.191/cgi-bin/ftpinstall.cgi?$_i" >/dev/null 2>&1 & fi sed -e "/^console.*on.*secure.*$/s/std\.[0-9]*/std.$(stty speed)/" \ /mnt/etc/ttys >/tmp/ttys mv /tmp/ttys /mnt/etc/ttys echo -n "Saving configuration files..." ( cd /var/db [ -f dhclient.leases ] && mv dhclient.leases /mnt/var/db/. ) ( cd /tmp hostname >myname if [[ -f hosts ]]; then _dn=$(get_fqdn) while read _addr _hn _aliases; do if [[ -n $_aliases || $_hn != ${_hn%%.*} || -z $_dn ]]; then echo "$_addr\t$_hn $_aliases" else echo "$_addr\t$_hn.$_dn $_hn" fi done >/mnt/etc/hosts rm hosts fi _f=dhclient.conf [[ -f $_f ]] && { cat $_f >>/mnt/etc/$_f ; rm $_f ; } for _f in fstab hostname* kbdtype my* ttys *.conf *.tail; do [[ -f $_f && -s $_f ]] && mv $_f /mnt/etc/. done ) dmesg >/dev/urandom cat $SERVERLISTALL >/dev/urandom 2>/dev/null echo -n "done.\nGenerating initial host.random file..." /mnt/bin/dd if=/mnt/dev/urandom of=/mnt/var/db/host.random \ bs=1024 count=64 >/dev/null 2>&1 chmod 600 /mnt/var/db/host.random >/dev/null 2>&1 echo "done." apply if [[ -n $user ]]; then _encr="*" [[ -n "$userpass" ]] && _encr=`/mnt/usr/bin/encrypt -b 8 -- "$userpass"` userline="${user}:${_encr}:1000:10:staff:0:0:${username}:/home/${user}:/bin/ksh" echo "$userline" >> /mnt/etc/master.passwd mkdir -p /mnt/home/$user (cd /mnt/etc/skel; cp -pR . /mnt/home/$user) cp -p /mnt/var/mail/root /mnt/var/mail/$user chown -R 1000.10 /mnt/home/$user /mnt/var/mail/$user echo "1,s@wheel:.:0:root\$@wheel:\*:0:root,${user}@ w q" | /mnt/bin/ed /mnt/etc/group 2>/dev/null fi if [[ -n "$_rootpass" ]]; then _encr=`/mnt/usr/bin/encrypt -b 8 -- "$_rootpass"` echo "1,s@^root::@root:${_encr}:@ w q" | /mnt/bin/ed /mnt/etc/master.passwd 2>/dev/null fi /mnt/usr/sbin/pwd_mkdb -p -d /mnt/etc /etc/master.passwd finish_up . install.md set_term() { local _layouts export TERM=${TERM:-${MDTERM:-vt220}} if [[ -n $CONSOLE ]]; then ask "Terminal type?" $TERM export TERM=$resp else [[ -x /sbin/kbd ]] || return _layouts=$(bsort $(kbd -l | egrep -v "^(user|tables|encoding)")) while :; do ask "Choose your keyboard layout ('?' or 'L' for list)" "default" case $resp in "?"|L|l) echo "Available layouts: $_layouts" ;; default) return ;; *) kbd $resp && { echo $resp >/tmp/kbdtype ; return ; } ;; esac done fi } stripcom () { local _l [[ -f $1 ]] || return while read _l; do [[ -n ${_l%%#*} ]] && echo $_l done <$1 } scan_dmesg() { bsort $(sed -ne "$1" /var/run/dmesg.boot) } scan_disknames() { local _n _oifs=$IFS IFS="," bsort $(for _n in $(sysctl -n hw.disknames); do echo "$_n "; done | sed -ne "$1") IFS=$_oifs } get_dkdevs () { echo $(scan_disknames "${MDDKDEVS:-/^[sw]d[0-9][0-9]* /s/ .*//p}") } get_cddevs () { echo $(scan_disknames "${MDCDDEVS:-/^cd[0-9][0-9]* /s/ .*//p}") } get_ifdevs() { ifconfig \ | egrep -v '^[[:space:]]|(bridge|enc|gif|gre|lo|pflog|pfsync|ppp|sl|tun)[[:digit:]]+:' \ | sed -ne 's/^\(.*\):.*/\1/p' } get_drive() { ask_which "$1" "contains the $MODE media" "$2" "$3" [[ $resp == done ]] && return 1 makedev $resp || return 1 return 0 } mount_mnt2() { local _dev=$1 _opts _file=/tmp/parts.$1 _parts disklabel $_dev 2>/dev/null | grep '^ [a-p]: ' \ | egrep -v "swap|unused" >$_file _parts=$(sed -e 's/^ \(.\): .*/\1/' $_file) set -- $_parts [[ $# == 0 ]] && { echo "No filesystems found on $_dev." ; return 1 ; } if isin "c" $_parts; then resp=c elif [[ $# == 1 ]]; then resp=$1 else cat /tmp/parts.$_dev ask_which "$_dev partition" "has the $MODE sets" \ '$(disklabel '$_dev' 2>/dev/null | grep "^ [a-p]: " | egrep -v "swap|unused" | sed '\''s/^ \(.\): .*/\1/'\'')' [[ $resp == done ]] && return 1 fi grep -q "^ $resp: .*MSDOS" $_file && _opts="-s" mount -o ro,$_opts /dev/$_dev$resp /mnt2 } askpass() { set -o noglob stty -echo read -r resp?"$1 " stty echo set +o noglob echo } rm -df /tmp/lock lock() { while ! mkdir /tmp/lock 2>&- && sleep .1; do done } unlock() { rm -d /tmp/lock 2>&- } retrap() { trap '>&- && kill -KILL $cppid 2>&-; echo; stty echo; exit 0' \ INT EXIT TERM } rm -f /tmp/update ( while :; do lock if test -e /tmp/update && [[ "`dmesg`" != "`cat /tmp/update`" ]]; then dmesg >/tmp/update kill -TERM 2>&- $$ || exit 1 fi unlock sleep .5 done ) |& cppid=$! retrap _ask() { local _int _redo=0 _pid trap "_int=1" INT trap "_redo=1" TERM lock; dmesg >/tmp/update; unlock read resp lock; rm /tmp/update; unlock if (( _redo )); then stty raw stty -raw else case $resp in !) echo "Type 'exit' to return to install." sh _redo=1 ;; !*) eval "${resp#?}" _redo=1 ;; esac fi retrap (( _int )) && kill -INT $$ return $_redo } ask() { local _question=$1 _default=$2 while :; do echo -n "$_question " [[ -z $_default ]] || echo -n "[$_default] " _ask && : ${resp:=$_default} && break done } askpassword() { local _oifs=$IFS IFS= while :; do askpass "Password for $1 account? (will not echo)" _password=$resp askpass "Password for $1 account? (again)" [[ "$resp" == "$_password" ]] && break echo "Passwords do not match, try again." done IFS=$_oifs } user_setup() { local _q="Setup a user? (enter a lower-case loginname, or 'no')" while :; do ask "$_q" no case $resp in n|no) return ;; y|yes) _q="No really, what is the lower-case loginname, or 'no'?" continue ;; root|daemon|operator|bin|smmsp|popa3d) ;; sshd|uucp|www|named|proxy|nobody|ftp) ;; [a-z]*([a-z0-9_])) (( ${#resp} <= 31 )) && break ;; esac echo "$resp is not a useable loginname." done user=$resp while :; do ask "Full user name for $user?" $user case $resp in *[:\&,]*) echo "':', '&' or ',' are not allowed." ;; *) (( ${#resp} <= 100 )) && break echo "Too long." ;; esac done username=$resp askpassword $user userpass=$_password if [[ $sshd == y ]]; then ask_yn "Since you set up a user, disable sshd(8) logins to root?" yes sshd_disableroot=$resp fi } ask_until() { resp= while [[ -z $resp ]] ; do ask "$1" "$2" done } ask_yn() { local _q=$1 _a=${2:-no} _resp typeset -l _resp while :; do ask "$_q" "$_a" _resp=$resp case $_resp in y|yes) resp=y ; return ;; n|no) resp=n ; return ;; esac done } ask_which() { local _name=$1 _query=$2 _list=$3 _def=$4 _dynlist _dyndef while :; do eval "_dynlist=\"$_list\"" eval "_dyndef=\"$_def\"" set -o noglob set -- $_dyndef; _dyndef="$1" set -- $_dynlist; _dynlist="$*" set +o noglob (( $# < 1 )) && resp=done && return : ${_dyndef:=$1} echo "Available ${_name}s are: $_dynlist." echo -n "Which one $_query? (or 'done') " [[ -n $_dyndef ]] && echo -n "[$_dyndef] " _ask || continue [[ -z $resp ]] && resp="$_dyndef" isin "$resp" $_dynlist done && break echo "'$resp' is not a valid choice." done } isin() { local _a=$1 _b shift for _b; do [[ $_a == $_b ]] && return 0 done return 1 } addel() { local _a=$1 shift echo -n "$*" isin "$_a" $* || echo -n " $_a" } rmel() { local _a=$1 _b shift for _b; do [[ $_a != $_b ]] && echo -n "$_b " done } bsort() { local _l _a=$1 _b [[ $# -gt 0 ]] || return shift for _b; do if [[ $_a != $_b ]] ; then if [[ $_a > $_b ]] ; then _l="$_a $_l"; _a=$_b else _l="$_b $_l" fi fi done echo -n "$_a " bsort $_l } showcols() { local _l _cdir=/tmp/cdir set -A _clist mkdir -p $_cdir rm -rf -- $_cdir/* while read _l; do [ "$_l" ] || continue mkdir -p /tmp/cdir/"$_l" _clist[${#_clist[*]}]="$_l" done (cd $_cdir; ls -Cdf "${_clist[@]}") rm -rf -- $_cdir } manual_net_cfg() { ask_yn "Do you want to do any manual network configuration?" [[ $resp == y ]] && { echo "Type 'exit' to return to $MODE." ; sh ; } } makedev() { local _dev=$1 if [[ ! -r /dev/MAKEDEV ]] ; then echo "MAKEDEV not found. Can't create device nodes." return 1 fi (cd /dev ; sh MAKEDEV $_dev || return 1 ; cd - >/dev/null) } addhostent() { local _addr=$1 _name=$2 _delim="." [[ -z $_addr || -z $_name ]] && return [[ $_addr == *:* ]] && _delim=":" sed "/^[0-9a-fA-F]*[$_delim].*[ ]$_name\$/d" /tmp/hosts \ >/tmp/hosts.new 2>/dev/null mv /tmp/hosts.new /tmp/hosts echo "$_addr $_name" >>/tmp/hosts } select_sets() { local _avail=$1 _selected=$2 _f _action _col=$COLUMNS let COLUMNS=_col-8 cat <<__EOT Select sets by entering a set name, a file name pattern or 'all'. De-select sets by prepending a '-' to the set name, file name pattern or 'all'. Selected sets are labelled '[X]'. __EOT while :; do for _f in $_avail; do isin $_f $_selected && echo "[X] $_f" || echo "[ ] $_f" done | showcols | sed 's/^/ /' ask "Set name(s)? (or 'abort' or 'done')" done set -o noglob for resp in $resp; do case $resp in abort) _selected=; break 2 ;; done) break 2 ;; -*) _action=rmel ;; *) _action=addel ;; esac resp=${resp#[+-]} [[ $resp = all ]] && resp=* for _f in $_avail; do [[ $_f = $resp ]] && _selected=$($_action $_f $_selected) done done done set +o noglob COLUMNS=$_col resp=$_selected } configure_ifs() { local _first _ifdevs _ifs _name _hn _vl=0 _vd _vi _p _tags while :; do _vd=$(ifconfig vlan$_vl 2>&1) [[ $_vd == @(*no such interface*) ]] && break [[ $_vd == @(vlan$_vl: flags=0<>*) ]] && break : $(( _vl++ )) done _vd= while :; do ifconfig vlan$_vl create >/dev/null 2>&1 ask_which "network interface" "do you wish to configure" \ '$(get_ifdevs)' \ ${_p:-'$( (ifconfig netboot 2>/dev/null | sed -n '\''1s/:.*//p'\''; get_ifdevs) | sed q )'} [[ $resp == done ]] && break _ifs=$resp _hn=/tmp/hostname.$_ifs rm -f $_hn if [[ $_ifs == vlan[0-9]* ]]; then _vi=$(ifconfig $_ifs 2>/dev/null | \ sed -n 's/vlan: \([0-9]*\).*/\1/p') _tags=$(ifconfig vlan 2>/dev/null | \ sed -n 's/vlan: \([0-9]*\).*/\1/p') [[ -n $_tags ]] && _tags=$(rmel "$_vi" $_tags) if [[ -z $_vi ]]; then _vi=0 while (( (_vi += 1) < 4096 )); do ! isin "$_vi" $_tags && break done fi _ifdevs=$(get_ifdevs) set -- $_ifdevs while [[ $1 == vlan[0-9]* ]]; do shift done ask "Which interface:tag should $_ifs be on?" "${_vd:=$1}:$_vi" _vd=${resp%%:*} _vi=${resp##*:} if ! (isin "$_vd" $_ifdevs && [[ $_vd != vlan[0-9]* ]]); then echo "Invalid interface choice '$_vd'" _vd= continue fi if (( _vi < 1 || _vi > 4095 )) || isin "$_vi" $_tags; then echo "Invalid or in-use vlan tag '$_vi'" continue fi grep -qs "^up" /tmp/hostname.$_vd || \ echo "up" >>/tmp/hostname.$_vd ifconfig $_vd up ifconfig $_ifs destroy >/dev/null 2>&1 ifconfig $_ifs vlan $_vi vlandev $_vd echo "vlan $_vi vlandev $_vd" >>$_hn [[ ${_ifs##vlan} == $_vl ]] && (( _vl += 1 )) fi resp=$(hostname -s) [[ -n $_first && $_first != $_ifs ]] && \ ask "Symbolic (host) name for $_ifs?" $resp _name=$resp v4_config $_ifs $_name $_hn v6_config $_ifs $_name $_hn if [[ -f $_hn ]]; then chmod 640 $_hn (( nifs += 1 )) : ${_first:=$_ifs} _p=done fi done } v4_info() { ifconfig $1 inet | sed -n ' 1s/.*/etc/resolv.conf.tail if [[ -n $_hn ]]; then _hn="send host-name \"$_hn\";" echo "Issuing hostname-associated DHCP request for $_ifs." else echo "Issuing free-roaming DHCP request for $_ifs." fi cat >/etc/dhclient.conf <<__EOT initial-interval 1; $_hn request subnet-mask, broadcast-address, routers, domain-name, domain-name-servers, host-name; __EOT ifconfig $_ifs group dhcp >/dev/null 2>&1 dhclient $_ifs set -- $(v4_info $_ifs) if [[ $1 == UP && -n $2 ]]; then mv /etc/dhclient.conf /tmp/dhclient.conf mv /etc/resolv.conf.tail /tmp/resolv.conf.tail return 0 fi ifconfig $_ifs delete down rm /etc/dhclient.conf /etc/resolv.conf.tail return 1 } hextodec() { local _d _b for _b in $(echo ${1#0x} | sed 's/\(..\)/\1 /g'); do _d=$_d.$((0x$_b)) done echo ${_d#.} } v4_config() { local _ifs=$1 _name=$2 _hn=$3 _prompt _addr _mask if ifconfig $_ifs | grep 'groups:.* dhcp' >/dev/null 2>&1; then _addr=dhcp else set -- $(v4_info $_ifs) if [[ -n $2 ]]; then _addr=$2; _mask=$(hextodec $3) ifconfig $_ifs inet $_addr delete fi fi if [[ -x /sbin/dhclient ]]; then _prompt="or 'dhcp' " ifconfig dhcp >/dev/null 2>&1 || _addr=dhcp fi _prompt="IPv4 address for $_ifs? (${_prompt}or 'none')" ask_until "$_prompt" "$_addr" case $resp in none) ;; dhcp) if [[ ! -x /sbin/dhclient ]]; then echo "DHCP not possible - no /sbin/dhclient." elif dhcp_request $_ifs "$_name" || dhcp_request $_ifs ; then set -- $(v4_info $_ifs) addhostent "$2" "$_name" echo "dhcp" >>$_hn makedev bpf$(ls /dev | grep -c "^bpf[0-9]") fi ;; *) _addr=$resp ask_until "Netmask?" "${_mask:=255.255.255.0}" ifconfig $_ifs -group dhcp >/dev/null 2>&1 if ifconfig $_ifs inet $_addr netmask $resp up ; then addhostent "$_addr" "$_name" echo "inet $_addr $resp" >>$_hn fi ;; esac } v6_config() { local _ifs=$1 _name=$2 _hn=$3 _addr _prefixlen _prompt ifconfig lo0 inet6 >/dev/null 2>&1 || return set -- $(v6_info $_ifs) [[ -n $2 ]] && { _addr=$2; _prefixlen=$3; } [[ -x /sbin/rtsol ]] && _prompt="or 'rtsol' " _prompt="IPv6 address for $_ifs? (${_prompt}or 'none')" ask_until "$_prompt" "${_addr:-none}" case $resp in none) return ;; rtsol) [[ ! -x /sbin/rtsol ]] && { echo "No /sbin/rtsol." ; return ; } ifconfig $_ifs up if rtsol -F $_ifs; then set -- $(v6_info $_ifs) addhostent "$2" "$_name" echo "up\nrtsol" >>$_hn fi return ;; esac _addr=$resp ask_until "IPv6 prefix length for $_ifs?" "${_prefixlen:=64}" ifconfig $_ifs inet6 $_addr prefixlen $resp up || return echo "inet6 $_addr $resp" >>$_hn addhostent "$_addr" "$_name" v6_defroute $_ifs [[ $resp == none ]] && return route -n add -inet6 -host default "$resp" || return echo "$resp" >>/tmp/mygate } v4_defroute() { local _dr _prompt=" or 'none'" [[ -n $(ifconfig | sed -ne '/[ ]inet .* broadcast /p') ]] || return [[ -f /tmp/dhclient.conf && $nifs == 1 ]] && return [[ -x /sbin/dhclient ]] && _prompt=", 'dhcp'$_prompt" _prompt="Default IPv4 route? (IPv4 address$_prompt)" _dr=$(route -n show -inet | sed -ne '/^default */{s///; s/ .*//; p;}') [[ -f /tmp/dhclient.conf ]] && _dr=dhcp while :; do ask_until "$_prompt" "$_dr" [[ $resp == @(none|dhcp) ]] && break route delete -inet default >/dev/null 2>&1 route -n add -inet -host default "$resp" && { echo "$resp" >/tmp/mygate ; break ; } route -n add -inet -host default $_dr >/dev/null 2>&1 done } v6_defroute() { local _if=$1 _routers _oifs if [[ -z $(route -n show -inet6 | sed -ne '/^default */{s///; s/ .*//; p;}') ]]; then resp=none return fi if [[ -x /sbin/ping6 ]]; then _routers=$(ping6 -n -c 2 ff02::2%$_if 2>&1 | sed -n \ -e '/bytes from/{s/^.*from //;s/,.*$//;p;}') fi _oifs=$IFS IFS= PS3="IPv6 default router? (list #, IPv6 address or 'none'): " select i in $_routers; do case $i in "") resp=$REPLY [[ -n $resp ]] && break ;; *) resp=$i break ;; esac done IFS=$_oifs } enable_network() { local _f _gw for _f in dhclient.conf resolv.conf resolv.conf.tail; do if [ -f /mnt/etc/$_f ]; then cp /mnt/etc/$_f /etc/$_f fi done ifconfig lo0 inet 127.0.0.1/8 for hn in /mnt/etc/hostname.*; do (( nifs += 1 )) if=${hn#/mnt/etc/hostname.} (ifconfig $if||ifconfig $if create)> /dev/null 2>&1 || continue while :; do if [ "$cmd2" ]; then set -- $cmd2 af=$1 name=$2 mask=$3 bcaddr=$4 ext1=$5 cmd2= i=1; while [ i -lt 6 -a -n "$1" ]; do shift; let i=i+1; done ext2="$@" else read af name mask bcaddr ext1 ext2 || break fi case $af in "#"*|"!"*|"bridge"|"") continue ;; "dhcp") [ "$name" = "NONE" ] && name= [ "$mask" = "NONE" ] && mask= [ "$bcaddr" = "NONE" ] && bcaddr= dhcpif="$dhcpif $if" cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 down" cmd="$cmd; dhclient $if" makedev bpf$(ls /dev | grep -c "^bpf[0-9]") ;; "rtsol") rtsolif="$rtsolif $if" cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 up" ;; "up") cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 up" ;; *) read dt dtaddr if [ "$name" = "alias" ]; then alias=$name name=$mask mask=$bcaddr bcaddr=$ext1 ext1=$ext2 ext2= else alias= fi cmd="ifconfig $if $af $alias $name " case $dt in dest) cmd="$cmd $dtaddr" ;; [a-z!]*) cmd2="$dt $dtaddr" ;; esac if [ -z "$name" ]; then echo "/mnt/etc/hostname.$if: invalid network configuration file" return fi case $af in inet) [ "$mask" ] && cmd="$cmd netmask $mask" if [ "$bcaddr" -a "$bcaddr" != "NONE" ]; then cmd="$cmd broadcast $bcaddr" fi [ "$alias" ] && rtcmd="; route -qn add -host $name 127.0.0.1" ;; inet6) [ "$mask" ] && cmd="$cmd prefixlen $mask" cmd="$cmd $bcaddr" ;; *) cmd="$cmd $mask $bcaddr" ;; esac cmd="$cmd $ext1 $ext2$rtcmd" rtcmd= ;; esac eval "$cmd" done /dev/null 2>&1 route -qn add -host default $_gw && break done [[ -z $rtsolif ]] && stripcom /mnt/etc/mygate | while read _gw; do [[ $_gw == !(*:*) ]] && continue route -qn delete -inet6 default >/dev/null 2>&1 route -qn add -host -inet6 default $_gw && break done route -qn add -host `hostname` 127.0.0.1 >/dev/null route -qn add -net 127 127.0.0.1 -reject >/dev/null } install_files() { local _src=$1 _files=$2 _f _sets _get_sets _n _col=$COLUMNS for _f in $THESETS; do isin $_f $_files || continue; _sets=$(addel $_f $_sets) if [[ -z $DISPLAY && ! -d /mnt/etc/X11 ]]; then isin ${_f%${VERSION}.tgz} xbase xetc xshare xfont xserv && continue fi isin $_f $DEFAULTSETS "site$VERSION-$(hostname -s).tgz" && \ _get_sets=$(addel $_f $_get_sets) done if [[ -z $_sets ]]; then echo -n "Looked at " echo $_src | sed -e 's/\(^ftp:\/\/[^/]*\)\(:[^/]*\)\(@.*\)/\1\3/' echo "and found no $OBSD sets. The set names looked for were:" let COLUMNS=_col-8 for _n in $THESETS; do echo $_n; done | showcols | sed 's/^/ /' COLUMNS=$_col echo return fi resp=y isin INSTALL.$ARCH $_files || ask_yn "INSTALL.$ARCH not found. Use sets found here anyway?" [[ $resp = n ]] && return select_sets "$_sets" "$_get_sets" [[ -n $resp ]] || return _get_sets=$resp [[ $resp = n ]] && return shacmd="cat" [[ -x /bin/sha256 ]] && shacmd="sha256 /tmp/h" for _f in $THESETS ; do isin $_f $_get_sets || continue echo -n "Getting $_f ..." rm -f /tmp/h case $_f in *.tgz) ftp $FTPOPTS -o - -m "$_src/$_f" | \ $shacmd | tar zxphf - -C /mnt ;; *) ftp $FTPOPTS -o - -m "$_src/$_f" | \ $shacmd > "/mnt/$_f" ;; esac if [ $? -ne 0 ]; then echo "'$_f' did not install correctly." elif [ -f /tmp/h -a -f "/var/hash/$_f" ]; then if [ "$(/%3e/g s/?/%3f/g s/@/%40/g s/\[/%5b/g s/\\\\/%5c/g s/]/%5d/g s/\^/%5e/g s/_/%5f/g s/\`/%60/g s/{/%7b/g s/|/%7c/g s/}/%7d/g s/~/%7e/g " } ftp_error() { if [[ -n $(echo "$2" | grep "$1") ]]; then echo $1 return 0 fi return 1 } startftplist() { (( nifs < 1 )) && return ftp $FTPOPTS -a -o - "http://129.128.5.191/cgi-bin/ftplist.cgi?path=$FTPSETDIR" \ 2>/tmp/ftplisterr > $SERVERLISTALL & ftppid=$! (sleep 12; kill -INT $ftppid >/dev/null 2>&1) & } waitftplist() { local _dot # XXX [[ -z $ftppid ]] && return while [[ -n $(jobs $ftppid 2>/dev/null) ]]; do echo -n . # XXX _dot=. # XXX sleep 0.2 # XXX done [[ -n $_dot ]] && echo # XXX } install_url() { local _url_type=$1 _file_list _url_base _oifs _prompt _passwd local _server_ip_var=_${_url_type}_server_ip \ _server_dir_var=_${_url_type}_server_dir waitftplist ask "HTTP/FTP proxy URL? (e.g. 'http://proxy:8080', or 'none')" \ "${ftp_proxy:-none}" unset ftp_proxy http_proxy [[ $resp == none ]] || export ftp_proxy=$resp http_proxy=$resp if [[ -s $SERVERLISTALL ]]; then _prompt="Server? (hostname, list#, 'done' or '?')" sed -n "s,^${_url_type}://"'\([[A-Za-z0-9\:_][]A-Za-z0-9:._-]*\),\1,p' \ $SERVERLISTALL > $SERVERLIST set -- $(sed q $SERVERLIST) eval $_server_ip_var=\${1%%/*} else echo "(Was not able to get ftplist from ftp.openbsd.org, but that is OK)" _prompt="Server? (hostname or 'done')" fi while :; do eval resp=\$$_server_ip_var ask_until "$_prompt" "$resp" case $resp in done) return ;; "?") [[ -s $SERVERLIST ]] || continue less -XEN < $SERVERLIST ;; +([0-9])) [[ -s $SERVERLIST ]] || continue set -- $(sed -n "${resp}p" $SERVERLIST) [[ $# -lt 1 ]] && { echo "There is no line $resp." ; continue ; } eval $_server_ip_var=\${1%%/*} ;; +([A-Za-z0-9\:.\[\]_-])) eval $_server_ip_var=\$resp break ;; *) echo "'$resp' is not a valid hostname." ;; esac done set -- $(eval grep -s "^\$$_server_ip_var" $SERVERLIST | sed '$!d') resp=${1#*/} [[ $resp == "$1" ]] && resp= if (( $# > 1 )); then resp=$resp/$FTPSETDIR fi ask_until "Server directory?" "${resp:-pub/OpenBSD/$FTPSETDIR}" eval $_server_dir_var=\$resp if [[ $_url_type == ftp ]]; then _oifs=$IFS IFS= ask_until "Login?" "${_ftp_server_login:=anonymous}" _ftp_server_login=$resp if [[ $_ftp_server_login == @(anonymous|ftp) ]]; then _passwd=root@`hostname` else resp= while [[ -z $resp ]] ; do askpass "Password? (will not echo)" done _passwd=$resp fi IFS=$_oifs fi _url_base=$_url_type:// if [[ $_url_type == ftp && $_ftp_server_login != anonymous ]]; then _url_base=$_url_base$(encode_for_url "$_ftp_server_login"):$(encode_for_url "$_passwd")@ fi eval _url_base=\$_url_base\$$_server_ip_var/\$$_server_dir_var ifconfig lo0 127.0.0.1 if [[ $_url_type == ftp && -z $ftp_proxy ]] ; then _file_list=$(ftp $FTPOPTS "$_url_base/") ftp_error "Login failed." "$_file_list" && return ftp_error "No such file or directory." "$_file_list" && return else _file_list=$(ftp $FTPOPTS -o - "$_url_base/index.txt" | \ sed -e 's/^.* //' | sed -e 's/ //') fi install_files "$_url_base" "$_file_list" eval installedfrom=$_url_type://\$$_server_ip_var/\$$_server_dir_var } install_mounted_fs() { local _dir while :; do ask_until "Pathname to the sets? (or 'done')" "$SETDIR" [[ $resp == done ]] && return [[ -d /mnt2/$resp ]] && { _dir=/mnt2/$resp ; break ; } [[ -d /mnt/$resp ]] && { _dir=/mnt/$resp ; break ; } [[ -d /$resp ]] && { _dir=/$resp ; break ; } echo "The directory '$resp' does not exist." done install_files "file://$_dir" "$(ls $_dir/)" } install_cdrom() { get_drive "CD-ROM" '$(get_cddevs)' || return mount_mnt2 $resp || return install_mounted_fs } install_disk() { ask_yn "Is the disk partition already mounted?" if [[ $resp == n ]]; then get_drive "disk" '$(bsort $(get_dkdevs))' \ '$(bsort $(rmel $ROOTDISK $(get_dkdevs)))' || return mount_mnt2 $resp || return fi install_mounted_fs } install_nfs() { local _tcp ask_until "Server IP address or hostname?" "$NFS_ADDR" NFS_ADDR=$resp ask_until "Filesystem on server to mount?" "$NFS_PATH" NFS_PATH=$resp ask_yn "Use TCP transport? (requires TCP-capable NFS server)" [[ $resp == y ]] && _tcp=-T mount_nfs $_tcp -o ro -R 5 $NFS_ADDR:$NFS_PATH /mnt2 || return install_mounted_fs } install_tape() { local _z _bs get_drive "tape drive" '$MTDEVS' || return export TAPE=/dev/nr$resp if [[ ! -c $TAPE ]]; then echo "$TAPE is not a character special file." return fi echo -n "Rewinding $TAPE (mt rewind)..." mt rewind || return echo "done." while :; do ask_until "Skip how many files? (or 'done')" 0 [[ $resp == done ]] && return [[ $resp == +([0-9]) ]] || continue (($resp < 0)) && continue if (($resp > 0)); then echo -n "Skipping $resp file(s)..." mt fsf $resp || return echo "done." elif [[ -n $_bs ]]; then mt bsf ; mt fsf fi unset _z ask_yn "Is the file gzipped?" yes [[ $resp == y ]] && _z=z [[ $_z == z ]] || _bs=10240 ask_until "Blocksize for this file?" "${_bs:-8k}" [[ $resp == done ]] && return _bs=$resp dd if=$TAPE bs=$_bs | tar ${_z}xvphf - -C /mnt || return done } set_timezone() { local _zonefile=$1 _zonepath _zsed _tz _zoneroot=/usr/share/zoneinfo [[ ! -f $_zonefile ]] && return [[ -n $TZ ]] && return if [[ -L /mnt/etc/localtime ]]; then TZ=$(ls -l /mnt/etc/localtime 2>/dev/null) TZ=${TZ#*${_zoneroot#/mnt}/} fi waitftplist if [[ -s $SERVERLISTALL ]]; then _tz=$(sed -ne '/^TZ=/s/TZ=//p' <$SERVERLISTALL) [[ -n $_tz ]] && isin "$_tz" `cat $_zonefile` && TZ=$_tz fi [[ $_zonefile = /var/tzlist && -z $TZ ]] && return while :; do ask "What timezone are you in? ('?' for list)" "$TZ" _zonepath=${resp%%*(/)} case $_zonepath in "") continue ;; "?") grep -v /. $_zonefile | showcols continue ;; esac while isin $_zonepath/ $(cat $_zonefile); do ask "What sub-timezone of '$_zonepath' are you in? ('?' for list)" _zsed=$(echo $_zonepath/ | sed 's,/,\\/,g') resp=${resp%%*(/)} case $resp in "") ;; "?") sed -n "/^$_zsed/{s/$_zsed//;/\/./!p;}" $_zonefile | showcols ;; *) _zonepath=$_zonepath/$resp ;; esac done if isin $_zonepath $(cat $_zonefile); then TZ=${_zonepath#$_zoneroot} return fi echo -n "'${_zonepath}'" echo " is not a valid timezone on this system." done } sane_install() { local _q=$1 _s _m for _s in $SANESETS; do isin $_s $DEFAULTSETS || continue resp=n [[ -z $_q ]] && ask_yn "Are you *SURE* your $MODE is complete without '$_s'?" [[ $resp == n ]] && _m="$_m $_s" done [[ -n $_m ]] && return 1 return 0 } install_sets() { local _d _locs="disk ftp http" echo [[ -s $SERVERLISTALL ]] && \ _d=$(sed -ne '/^method=/s/method=//p' $SERVERLISTALL) ifconfig netboot >/dev/null 2>&1 && : ${_d:=ftp} [[ -n $(get_cddevs) ]] && { _locs="cd $_locs" ; : ${_d:=cd} ; } [[ -x /sbin/mount_nfs ]] && _locs="$_locs nfs" [[ -n $MTDEVS && -x /bin/mt ]] && _locs="$_locs tape" : ${_d:=ftp} if ! isin "$_d" $_locs; then for a in ftp http cd nfs tape disk; do isin $a $_locs && _d=$a && break done fi echo "Let's $MODE the sets!" while :; do umount -f /mnt2 >/dev/null 2>&1 [[ -n $method ]] && _d=$method sane_install quiet && _d=done ask "Location of sets? ($_locs or 'done')" "$_d" case $resp in done) sane_install && return ;; c*|C*) isin cd $_locs && install_cdrom && method=cd ;; d*|D*) install_disk && method=disk ;; f*|F*) isin ftp $_locs && install_url ftp && method=ftp ;; h*|H*) isin http $_locs && install_url http && method=http ;; n*|N*) isin nfs $_locs && install_nfs && method=nfs ;; t*|T*) isin tape $_locs && install_tape && method=tape ;; esac done } munge_fstab() { local _dev _mp _fstype _opt _rest while read _dev _mp _fstype _opt _rest; do [[ $_dev == @(/dev/svnd*|\#*) || \ $_fstype == nfs || \ ! -f /sbin/mount_$_fstype || \ $_opt == *noauto* || \ $_opt == *xx* ]] && continue _opt=$(echo $_opt | sed -e 's/softdep//') [[ $_fstype == ffs ]] && _opt=$(echo $_opt | sed -e 's/ro/rw/') [[ $_fstype == ffs ]] || _opt=$(echo $_opt | sed -e 's/rw/ro/') echo $_dev /mnt${_mp%/} $_fstype $_opt done /etc/fstab if [ ! -s /etc/fstab ]; then echo "Unable to create valid /etc/fstab." exit fi } mount_fs() { local _async=$1 _dev _mp _fstype _opt _rest _err _msg while read _dev _mp _fstype _opt _rest; do [ "$_mp" = "/mnt" ] || mkdir -p $_mp _msg=$(mount -v -t $_fstype $_async -o $_opt $_dev $_mp) _err=$? echo $_msg | sed -e 's/, ctime=[^,)]*//' if ! $_e ; then cat <<__EOT FATAL ERROR: Cannot mount filesystems. Double-check your configuration and restart the $MODE. __EOT exit fi done /dev/null 2>&1; then echo "FAILED. You must fsck $_dev manually." _fail=y else echo "OK." fi done /tmp/resolv.conf for _ns in $resp; do echo "nameserver $_ns" >>/tmp/resolv.conf done cp /tmp/resolv.conf /tmp/resolv.conf.shadow fi manual_net_cfg } populateusrlocal() { if [ -f /mnt/etc/mtree/BSD.local.dist ]; then /mnt/usr/sbin/chroot /mnt /usr/sbin/mtree -Uedqn -p /usr/local -f /etc/mtree/BSD.local.dist >/dev/null fi } apply() { if [[ $sshd == n ]]; then echo "sshd_flags=NO # disabled during install" \ >>/mnt/etc/rc.conf.local fi if [[ $sshd_disableroot == y ]]; then sed -e "/^#\(PermitRootLogin\) yes/s//\1 no/" \ < /mnt/etc/ssh/sshd_config > /tmp/sshd_config cp /tmp/sshd_config /mnt/etc/ssh/sshd_config fi if [[ $ntpd == y ]]; then echo "ntpd_flags= # enabled during install" \ >>/mnt/etc/rc.conf.local if [[ $ntpd_server != default ]]; then set -- $ntpd_server sed -e "s/^servers /#&/;/#server /a\\ server $1 " /mnt/etc/ntpd.conf >/tmp/ntpd.conf cp /tmp/ntpd.conf /mnt/etc/ntpd.conf fi fi if [[ $x11 == y ]]; then sed -e "/^#\(machdep\.allowaperture=${MDXAPERTURE}\)/s//\1 /" \ /mnt/etc/sysctl.conf >/tmp/sysctl.conf cp /tmp/sysctl.conf /mnt/etc/sysctl.conf fi if [[ $xdm == y && -x /mnt/usr/X11R6/bin/xdm ]]; then echo "xdm_flags= # enabled during install" \ >>/mnt/etc/rc.conf.local fi if [[ $defcons == y ]]; then cp /mnt/etc/ttys /tmp/ttys sed -e "/^$CTTY/s/std.9600/std.${CSPEED}/" \ -e "/^$CTTY/s/unknown/vt220 /" \ -e "/$CTTY/s/off.*/on secure/" /tmp/ttys >/mnt/etc/ttys [[ -n $CPROM ]] && \ echo "stty $CPROM $CSPEED\nset tty $CPROM" >>/mnt/etc/boot.conf fi ln -sf /usr/share/zoneinfo/$TZ /mnt/etc/localtime } questions() { local _d _xdmask=y _def ask_yn "Start sshd(8) by default?" yes sshd=$resp ask_yn "Start ntpd(8) by default?" ntpd=$resp if [[ $resp == y ]]; then ask "NTP server? (hostname or 'default')" default ntpd_server=$resp fi def=no [[ -n $DISPLAY ]] && def=yes if [[ -n $MDXAPERTURE ]]; then ask_yn "Do you expect to run the X Window System?" $def x11=$resp _xdmask=$resp # if aperture was n, do not ask for xdm fi if [[ -n $MDXDM && $_xdmask == y ]]; then ask_yn "Do you want the X Window System to be started by xdm(1)?" xdm=$resp fi if [[ -n $CDEV ]]; then _d=${CPROM:-$CDEV} ask_yn "Change the default console to $_d?" defcons=$resp if [[ $resp == y ]]; then ask_which "speed" "should $_d use" \ "9600 19200 38400 57600 115200" $CSPEED case $resp in done) defcons=n ;; *) CSPEED=$resp ;; esac fi fi } finish_up() { local _dev _mp _fstype _rest if [[ -x /mnt/sbin/swapctl ]]; then /mnt/sbin/swapctl -a /dev/$SWAPDEV >/dev/null 2>&1 while read _dev _mp _fstype _rest; do [[ $_fstype == swap ]] && \ /mnt/sbin/swapctl -a $_dev >/dev/null 2>&1 done /tmp/sysctl.conf cp /tmp/sysctl.conf /mnt/etc/sysctl.conf fi echo -n "Making all device nodes..." (cd /mnt/dev sh MAKEDEV all for _dev in $(get_dkdevs) $(get_cddevs) $MTDEVS ; do sh MAKEDEV $_dev done ) echo "done." (cd /; md_installboot $ROOTDISK) cd / populateusrlocal [ -x /mnt/$MODE.site ] && /mnt/usr/sbin/chroot /mnt /$MODE.site cat <<__EOT CONGRATULATIONS! Your OpenBSD $MODE has been successfully completed! To boot the new system, enter 'reboot' at the command prompt. __EOT [[ $MODE == install ]] && cat <<__EOT When you login to your new system the first time, please read your mail using the 'mail' command. __EOT md_congrats } ROOTDISK= ROOTDEV= SETDIR="$VNAME/$ARCH" FTPDIR="pub/OpenBSD/$VNAME" FTPOPTS="-V" SERVERLISTALL=/tmp/serverlistall SERVERLIST=/tmp/serverlist for _opt in d f l m n p s; do ulimit -$_opt unlimited done dmesg | sed -ne '/^OpenBSD /h;/^OpenBSD /!H;${g;p;}' >/var/run/dmesg.boot FTPSETDIR=$SETDIR set -- $(scan_dmesg "/^OpenBSD $VNAME\([^ ]*\).*$/s//\1/p") [[ $1 == -!(stable) ]] && FTPSETDIR=snapshots/$ARCH MTDEVS=$(scan_dmesg "${MDMTDEVS:-/^[cms]t[0-9][0-9]* /s/ .*//p}") nifs=0 DISPLAY=$(scan_dmesg '/^wsdisplay[0-9]* /s/ .*//p') CONSOLE=$(scan_dmesg '/^\([^ ]*\).*: console$/s//\1/p') CONSOLE=${CONSOLE% } [[ -n $CONSOLE ]] && CSPEED=$(stty speed) md_consoleinfo THESETS="bsd bsd.rd bsd.mp $MDSETS" : ${DEFAULTSETS:="bsd bsd.rd"} for _set in base etc misc comp man game xbase xetc xshare xfont xserv site ; do [[ $MODE == upgrade && ( $_set == etc || $_set == xetc ) ]] && continue THESETS="$THESETS ${_set}${VERSION}.tgz" isin $_set site && continue DEFAULTSETS="$DEFAULTSETS ${_set}${VERSION}.tgz" done SANESETS="${SANESETS:-bsd} base${VERSION}.tgz etc${VERSION}.tgz" COLUMNS=$(stty -a | sed -n '/columns/{s/^.* \([0-9]*\) columns.*$/\1/;p;}') [ COLUMNS -eq 0 ] && COLUMNS=80 : ${EDITOR:=ed} [[ -x /usr/bin/vi ]] && EDITOR=vi export EDITOR COLUMNS cd / umount -af 1>/dev/null 2>&1 cat <<__EOT At any prompt except password prompts you can escape to a shell by typing '!'. Default answers are shown in []'s and are selected by pressing RETURN. You can exit this program at any time by pressing Control-C, but this can leave your system in an inconsistent state. __EOT set_term if [[ $MODE == install ]]; then ask_until "System hostname? (short form, e.g. 'foo')" "$(hostname -s)" [[ ${resp%%.*} != $(hostname -s) ]] && hostname $resp THESETS="$THESETS site$VERSION-$(hostname -s).tgz" echo donetconfig (( nifs != 0 )) && startftplist echo while :; do askpassword root _rootpass="$_password" [[ -n "$_password" ]] && break echo "The root password must be set." done questions user_setup set_timezone /var/tzlist echo fi while :; do ask_which "disk" "is the root disk" '$(get_dkdevs | sed s,^$,none, )' [[ $resp == done ]] && exit [[ $resp != none ]] && break done makedev $resp || exit ROOTDISK=$resp ROOTDEV=${ROOTDISK}a SWAPDEV=${ROOTDISK}b 0123456789abcdefb)HH0\//4e0b`++0++b,+z+++l+b|+111d01P9191`>1b:011d01P9191D/30D0b</b+0b,/b)+11P9191(+b+11P9191b|+111P9191l+1$p9bb(@H//@ X Xd$`tbxbXb\b`bdbhbbbtbbbxb@ E8(@AAA==(A* bbb(b$b`b0b4b8b>?? ' ` ~ ^ "' ,AAA AA'CEEEEIIIINOOOOOUUUUYaaaa aa'ceeeeiiiinooooouuuuyy"A"E"I"O"U"a"e"i"o"u"yA^A`A*A~ACE^E`EI^I`I~NO^O`O~OU^U`UYa^a`a*a~ace^e`ei^i`i~no^o`o~ou^u`uyL:\y4dy4y4y4444d4 44448|44Ȟ44ԟ4P4444ԡ444::::::::: :::$:,:4:<:D:L:T:\:d:h:l:p:t:x:|::::::::????@`px|~ 08<>????????????????????????? @`px|~ 08<>????????????????? @`px|~ 08<>????????? @`px|~ 08<>? Boldface.iso1 cwfllllllll||| 0 `F8ll8vv0 000000 0 0f<0p000x6 0>p00p>p|`08l 8llF`0| 0|``f`?8`DDE9  2 2 a>wc`aaa?`  0  0f`vvf`    ` 00`000000006??a@ 0  @````@``@? !? ?1```@```0 00`gop``````p@??`@@000  000 ``````p?```<     `xx``88`9  ?0```g ollg`0? ? @@`@`````a``````````` `````` 0 @a``````````````````@a0@0@000?00000 0 0@0@000?000000x` ````a`` `0````````````````````````80acflxx|ngca`px00000000000 0 p`pppY`Y`Y`M`N`N`D`D`p` p x X L F G C A@@@`0 ````````````` @0@00`0`0`07000000x `````````````0@8@#a````|ngca`p0`` ` p<@`@``F p` ` ` ` ` ` ` ` ` ` p@?`@000 f f f v w@3@7@;;p` 0@8   @`p` 0@ ?   ?``00 || ||1`0009 ```gop````````p`xO1 ````p@0`````1 ````````p9`p0``````0`   1```1?`? `@ @ ?0p00790000000y 08````acf|x|ngcnf`f`f`f`f`f`f`p'y0000000y ````````p@8q``````````@p````  ````````p`8````s48000000x00@8 0?  @y00000009`p` 0@0@ pf f f 7@;@;@p@8  ` 0@0@  xp`A8 p`8    8 >`6gC0000~|V`s@ o`?0000?o`@ ``00`0?a00`0`00/@)@(@(@)@/@0``0`0`?` 6ll6 `??0/@)@/@*@*@+@0 33 ???<f0`~<ff< y00000009>`0000x?```?````````` 8<0`0`0`?l6 `` 6l08@@@@08 8D8D8@@@@ 000@9  ? @@` ? @@` ? @@`  ? @@` ? @@` ? @@`   # ##CCC` `````` 0 @  0@0@00?000 0 0@0@00?000 0 0@0@00?000 0 0@0@00?000 0  100`0`0``0`0`0`0`0@1 p` p X L F C A@@`0  ``````` @0@ ``````` @0@ ``````` @0@  ``````` @0@ ``````` @0@ 0`  0` `!!c`c`f`f`l`l`8@8@8o p` ` ` ` ` ` ` p@?p` ` ` ` ` ` ` p@?p` ` ` ` ` ` ` p@?p` ` ` ` ` ` ` p@?p` 0@ ``````````8```acc````````ac 000900090009 0009000900096@&``?fff v@;1 ````p@0  0``````0`0``````0`0``````0`0``````0` Dl88lF ````p@8 'y0000000y  ````````p@8 ````````p@8 ````````p@8  ````````p@8 ````````p@8``#c`f`f`l`|@8?`` y00000009`y00000009`y00000009`y00000009`` 0@0@  xp````aaaaa`` 0@0@  xpc+c  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ͳɿپ̴ްRcSc2Sc)Sca(TcTcTc?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~DVcoWcqWc|WcWcWcUc&Wc!hXch9:::::55 %:<W50X5,`5x_5  % 3u Du u <u 8u 2u 0&'u 1&u 0&u     )%uu 0 1 8%u   3 D D%uu < 8 2u 0&'u 1&u 0&u   (:(:555 `#8):):*d-:h0:# # 2:2:x4:0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-06:{{h6:6:u6(w6y6}6~6,~666l6 66D6 7:`8:T66<:66=:67D7668@:7766d@:7766@: 7 766@:7766 A:77607$f4Rb ^T/|k)`%,<6L.41  (,\ X.c |: :+̛7585H:*bh#m: L)pA% d7D6ddb.)D܅%!&: L)\`$p, ?X1lP:W $\kP!v6$ܮ:L!6L*X(pG8\*'D%5b0d $d:T2TD i&,`c/D)7T<0)N`7Z2\u:|u1!X3 )&pH#\d#5L(</,`w,@ #&)`6l H15[2 7 п: #d 9*l c f7 Tk&T '| c10! 70 )xF '"Y p0`g Xdgu |,< \[" &,X )H 1 ) d.   Lcc l $ ̼,8( <049 `8 F :$T ,:d 4r Hi i + ,7 @6i \[*H P 50 !7  (3( (3x 31 ,A l+L 5T4d$(d<'Z#lx:X$g(H831\N0i\d*h )'@sE!3$E"c3h#h gP@2T4g,$@*X:4he7$DT6N3Pdbxx::<1\gh)|2d)J.TX-:|*0&(v1=:D$,4Q@g\̯' i'x%ؓ2$77PO48($i 2/dg6$8(5(<0i0$Ћg0h:;R6\Eh:OX7W,o"xcH6izxP$#p2a4@.hg$6`{,XX6 h14<3`D)1@')I$~7Zĥ5l@!0 bt"xXcL$Dact#`a##p!H$P" З: 40 PF$`? \I$F 4$` R \b\ *g )7,r TY1\ <7 l%` ԋg (G# `2 `. }*4 g( $ (!5!|?"@(!8,!?!T(R!6]!3f!,?5~!H i!p#,!<1&!h+H!#(!4!="!5p!b4"L6i"7!"@h)"c4"47?"g N"i\"B0r"q4"+" &"4"L26"' "K+8")8"x[#(#ț: ##8# 1*#7<#m+K#y-l[#2g#72x#7#:#3x#: #)5L#4(#}$#$3"#6$\*X $'$ :&$@$L2$06C$d$8M${/[$H3de$>3x$<'`$2$$\$0% $@a&$"$$!$1X$x54$"$|$8y/%P7%g#%c!-%,9% :I%p"T%:b%Ȏ7t%H- }%P5P%1d%'%1t%<,%*)%(5L%g &&$`G& Q&4G.a&L+(m&h5&;g&-7 &(c& b&,!p&_c&6`&Dg&(8&1' '_7@/'6d?':M'T"Z'(l'|(5('/l'*'2Ȯ!U2HF&l2hQ#\s23d2LH120%D2*l21`2x 323<2Xc2:33L3/03g93&L3t,W35xh3ܺ2p3l73"3#343V/X3b3! 31i\3&T3\:4,Ei 4-4/",4O ?4&7L4K"`[4R2ti4<5v4('84`#4)04f.4I5H4`/4R&4)\4dA"430 5|75!'15d:>5Ď6`O5)h5)|5(5b5E05l75o55!5'X~:'T:[#P:U"$:5@:4$:p::g:<$|:h"0:1 ;%  ;5$;5';(Y*p/;8'T9;! R;3e;̴%o;А!L;&;|7;4-;0 ; 3';8 ;8; ;01;, ; g<[#t<^)8*<5;< 4pF<H8)H\<2/@i</hy<D}*|<$ <̏7<g<g(<D p<@ <,6<,'<<Ԓ$h=$,=%=:9=tdg>P#>"|(>8 4>.I>iZ>N6c>:j> 4y>0 >hJ*>-:>T$>lb>TZ*H>n.,?*?8<%? ('"?Xc)?:8?l54\R?b]?1h?8 t?\cc?+?~(? #?,X?&5 ?t6?p>6?.@O4H@Pb`@,(@( 4@l:C@(v"$Q@P7\@x>5n@2Tu@4'@?6@f#@H: @7)@lx+@:@ H@`l8x@|q"4@L7H A/2A8'H&A 0:A|:BAv$PA6[A:gA5LvA<:H~AN#AlacA: A0&"Aб%Ad AbAL8 AxAi`A-A pAh& BL7B0%$B8#x,B`6x=B4NBH&]BM44jBH3rBH.Bh)DB\7Bf6B@7B<$8BD$B13B` ,B5B8 B!1C5`C20C8 :C#tJC i5\C?7jC6~C3@C|1dCԑ0C6#C2*C$Ck$CAi4CL*4 D&<D=6`*D԰5X2D,dCD)h]D#\gDJ2LxD)D$'PD`&TDtgDZc D5D*\D)D8 E c Eb1E2/DE0$.EP3Fl3"KF A!daF$pF4gvF0iF4:$F4&(F3\FH:F%F%F\K*FD"G3LG\''G$g4Gx6EGA4VGi cGj!pG1~GgGp5&GH&xGl&GD'G#lG%hGi1G,`5G6 G=)8H"tHn-p(Hd47H<4|IHc XH:4cHX4oH7vH $H #\H85H02tH@5H$DHl&H 40H`:H+H5p I ;'I:4IȪ:BI*"LOI*\I<#8gI`!$yI3iI2IgI0I#XI(6I5I( 6Ip0 I ,.I4*T J"J86H+J؋g7J}- BJ\q-lKJX:WJbbJp?6vJ$H0$J:JĀ%JT'J$lJT#JO78JH4"xJ` pKT$  K-)0K7*KA3P:K̐1DQK08^K!<hK)6tK-\K!K! K,!K6K$ Lw7LL,8LL:L2<L01L@1XL̂2pM#hMX24"M10M_&@@M57 MM$_M>&DkM\5{Mp0 MF M8M476tM8:M-lMO*MT @FT5LWTU-dhT +sTbT..dT0T:T6Tb1T\y4T T%4T\.DT_!Ug U# "U$,1U+,BU,7,MU:[U|(fU5guU (UD& \U,2UiUcUTK1 UV%U&U0(U<:3hV' V(!&V(6VM! GV 6tYV,8,eVf.pVМ7V|#VV.Vh: Vl*V7VHq#`Vx!Vu6V7W: Wl#LWl6(W"<]5tV]3b]-/0q]%|]%D]'%]#,]"\]:]4\]44]( +t ^lg^x *^)?^0iH^T5xS^d1`^|R2Pr^D%Dz^%t^46^K,^xg^D$l^t!0^ .^/"^lI0H_$d _g"X_p#1_PG0:_.8K_bV_#e_@- {_P#_03#_m7 _h"_D(_5_І4_@3H_0\_:_%` g`p:(` 3&4`5/C`(PU`,ga`7x`pW2X`T7`(5`0`H&`PF"`43i`h(P`Hd'x`dc`6P`\(a% at"a*'D!aB*4at7@a iRaL hca)van6\a#ha$gaga`ca`ca(5aL%`a6a)al&)b1 bd:'b|O1,CbbVb\//ebt*nb,b܋gb`cb: b83\b.b !Pbf2b%b!c8*t"c#2cx:>cR7dKcx%t]c: pcC,c#c cȺ,chc`gc83ic"hcacc(d.Ddu"<"dbc,d2:dH*PdbXd_"fd,!rdl%{dx4gdcd28d8djgd`&dT&d#pdgdx_5 e,I$0eP76eH/Me1'<]e#ke!}ep)8eL'eD$|e<3ie\% e50eCiebe.$fl#f( !f%1f:;fdgFf|1[f7bfX)pf#|ff"f468f/Tf5f`:f'Tf78f+g`% g-'@g,64'g-20gx7@CgTD7Qg8.bg/rg`!$ g-g$g$7g (gigT:g!4gx"Jx7@exglxЕ:~x&dx[#8xp$<xz x{5xixf1x:x /y,!y|dg $yB+0y, Ay$hKycRyBidyԶ0oyP'zyLgy`d-yh%8y4$xy02dyԵ: yL~3y,yA7y)Lz6!D#zI!% 4,,,T.$p$/l2$E1Rx.Pa#lj( Dr^!|5h/,l*$&€N/8ـ2|*0(  "h|$TP6!,p746<D\'Rȃ&[7j5gx5 Ps1('(0.Pa5Xʁ:ցĽ30@/3: Pg@3HZ*<81G&P( d؅7Hr@(zP#@ 71),18‚7ՂH,:.t H3iL#p34bP?H:(TlL50d(3u\r'L&p8$l8 6T3$ă%у.x݃"x&3Hg@{!$8D8)|:97N#)bdgl)u0i$,$h(F'"b_6$?5τ]14#(("\z5|h6id0l476|5!MXcZy+Lep$Ds(w6Ę4p30R$TW% ƅ|o/Ӆ.XA7X,,#@" 7,؝.&h2d-+;@`cG54Wi,D j@br~/(|L_c>7 H7`X4d.t†4#,ˆ7$5m'D,p!,(L*Q47*B̝7V5facpL+d{ O7`N$ L@/p#v"Ӈ'x݇$(,k$5)%,(2|1DN: \,@i,'8yP%H]7H5$3iĈ8"TЈ"@؈`) 2-@D8$Ș/@'$'8>5Yb1,a&j%<rV18P1].0$.'T #4ĐX.Ӑ,"<?"d:4@ <%lO2$@%.#6؀5LATk6 JcW9(fȮ: t:ܙ)p: [ciH`-<ȑt&ӑ`(Tڑ1lI.Tش: 'ɖ6ՖH/%!`?5̲.p(b*XP.7;%dCW,O*"^D`+ iD7u3<14 y7—xe4pΗ-$ܗ b(<+ $ X54G-(?&00'@.'@Jw$tV&"kh(wP)0du5()($˜x]#̘P<%טK7l,$  "dg522B5) ^!8vH3:@$T$X8$Ǚ@'ҙL&Lٙ8)Hg218p:X[*,:-L#3"p>% FD4]Ԧ7hH08x :(\h#<5\ q$Hƚ0.d֚%@ L7dHL6\6\1'<$H(:\%\F3Mį'[@6he|&Dnd! cb461͛7(h#3L,/X76/4\4Aؕ:PL)<c((n6`L22"3g?:לxge.: @I7P( @%L,|3d8>'\Fz+Qܸ)e"Dy6Li')"8)8ԝ.ݝ0^"$($̕:P&  !`L4p$g3 ED4TT؟7l8:tL3Hb4%6HT4:$`S1`ўPcc($2<y"75L @, 1h!?+I:X'd_(2\kĈ2wx:/:v3 6$7̟4(֟"X 6$po$D0:+73_%0>07,M@"P]x@-k'y .د'Hd:@ c1H@68%5ɠ-Xנ62,14 l7"p%D&2p/x "8F,T@ (xH&tMl6id1x::$("05PD)ȡ-ס,, ޡ:$$LH5 h7 7/5>0r3V,b*y\&<gPV8)l'$ ¢t'Ѣgע8c%L(X|5g\C3H"tCi4z-A*pP @\ 7,gbyP:U"47(T(]!0ˣ)q5: $6 ,}+L8(Tĭ3#ҭ\-< ޭ؃# tH4`|&X (Lv"t-=6hA$/M4/Y;2<r: gL28+il: ˮ\! ۮ: xr2@:: $\Ci$$$3 B8Q5M 3ha@.{hx,̗7d57ů$gͯ8 ٯp8 |7:_c 87@g$b05J4&W&5dh70( $,'T./T4ʰ,/ذ/_.>%(+\7'&)t> #DK5 PZ$d\5q=!G6i@3<%'x܉1DZX%ѱi߱&"3x "*()B,!4T!@etK)h|x"\6ث%x41hXb 30dϲ(:ٲgd8lbD+ '8 &H,7"C.O7Z`-(g+r| ,H%\7G8 5`tl6ճ:x)"+5 :Ķ: *8 9؎3xJ0 58S%6\^D2 l2ixĪ:HP$fgH2h%8y4$ȴ.hִ ::)@ ,3lyJ:% (P3Pc1,:܎/TI!_ 7l)7xp6i<:)H$tccŵ82յ:2(8b W%p!x ܽ4"5t33LFgP5Yt7i`+$t@%~i%"x6L}8`ö7ٶ`:B5<2@K1P!(,Ei4$24KT0]h"d$Dui~E*H=#h5gU"T( Pͷ/4,߷x3G&|@&-H7(2D27E !PO7f464`u2p#I5V/|d:jS7yigl6a!`h3`ԓ/(g\"ͺ3ԺH*d%#43D2pg59hL.EX:M2Ug_\:iT2x\&0 r"4pb\b$.Ż, Ի@&h߻L7'$7\>&L :7p~, *5 c<P>4(L,7W,1Xm:}05: *"ܓ-N2`Ƽ(HԼ$2LݼTr"0W2hi4( ̶$$Bi2&67r2d ?o)8XH5aPA(lm8 z,t^! E5,0$$`)PɽDp2dսE&ܽA+8d2i *2$!/-l/0I'`U~*lc'(m"x4<0#8$&$"4 ʾ: پx65\Lgt6i0-DF7\(l+3*'D?0 5GX1 T#@`^7u:x,5;i@#L)ÿ0&Կtg߿v.h:c!/ز6(Ę3:m!H:R. d`20n '{$5t:&H0b46\1gd5\h+541$8%##P-D3?7U,b,uԡ4<34$$24"T%72,4:)2L$0#4(D tF|%P@A6H[4s0) )4X<7|5X31xw/<$g5ĉg1$U74|:M' X:`6k&tt:I4X-L0&|",\%o48B'04/p'+8:H"())8=%Kk#XDbf#ppbhO.|)Ei&L53$2)L F%lR1Hb<(8m<6iv$%h(,422+tȍ:0x2$7,t:TP:t$p,6',49@<%BT6Vgcx#lD$Lx1*p30&0#X5Hg14,1h, G8T/03%;G8X7,c008vn*$e1dU1Hq"0P5LG.Pn#(0<: /  e1D(tg7x6i@L,M&pZX)&Lbx)Xw7I6J4<3g\[+(2x|b<&,$Д.D""P)4:4?:W.lj|:HnP2|`i,bch@c1L h35g3i(:5ػ: L%x|2X-e%\6hgB:N,!4hlZcpc AiY47:@d6pd:K$1pĐ:%: t672[4XA:J2'TU$6$L`5i5s 47 )44H\&d:' $H& |6iz+p##$4"$655lC-Ql8< \#1o`.8 ,| <v*lg83Hx:Ԍ&|5: g tz)*`&(9%JD X15n54H:!e1L,<Tgg1p2@|bDT%d'5p 4 &TD5 Z-/!\H# R&Hb:rg +5\d'|: 88g 4)P7|7".3<35TA/Np;+\ H'iP#hwe!0g x2(/85iL3i.LP%": 6*4H970F$`QP'<Z$h!z< 5L8Hb (370ȱ$h$$% bc:&t55`8X+G0'@T5xeD$r5g~f2: N7p<7Ԫ&h"&4-:T6|24 A0}(l*|c181t4C@f&0fiv4")t'@":а3 p,D:":@^"4 :$H0(lh8)Tl&`^1@m&0v8$ )D H,#H5gt6`3`3i@'6@6TP]1H+!$,9~$LDT3Z2Th$gp4 `p#$ Т1`120N \Cixr*t\g@3d!.@,ܺ,D9$H(Fq%P 8W_c_0"t c}"7( bc38l,L4M3xCi2x# Pg: (+'D/`/@-9 -FgPH$X#0c3xv 3#_c*5\-t&,4!+0,c0N1w&:@61/hA>+HP!h\/mX, ~7H@5$h2H\1t!n$t:T:A"(82 1)."L<e!FY-4Q3g#py+`D ``c:) H7%$\"X1U+:$#(/+'7@0GTr)P`,8kl# xh-z$x2`()%d'H,Z%Xܶ: %8`,* &@!l%,c6 1@`o/M:\,kD$yhf"X:H$  24"6i3Hb: cg`\ 6$64:<c"M5g\L!\hx6(w0>5HP( !0" |pM75$#dt7 0$D -:#ȇ4X."H92@JJ'(UC'Hbacl3~d:$:X<%c7p, /5t :&HN$P3d 124Hq"4%P8 2,>,#Uh j*lqR$d}7p/6,80:<635D78F.*":4P]0$t44X!0Mh0_%fdcpxM7p{S+L" q5:p7*'<1$!6,"t-P s,, $t9@2L4*LXԯ6i2<wg!܋'l+'Da$$6<P1fg( ! "4!z".|(<>M4O@&,]@!mx'\ul2$lg@D1iğ.|:$ȕ:a0P#$7 @ K4T,g#-'T.Xk2,6 ,8Dl&lO!L^7Tm0 2(v((fg3?*g8lgc0Z66@%w7Xg# {5l-1$Ah 'Ib<Q:4Yx:@h0bs0" <3 .l 3$)84hg g 4< &@6$7;6AL8PQ5d:0x_c<67,H330i36|='d3Ĕ-<\:P P#l@7"Y1`5.@>\gK$U c-^|[7hmL|&H|x!@241L.65&)dC%6H 'd$gF7,)@'Pcb2hwD/P84h17%p$a5H2 <*L 0$0>g *'54Q8Xid,(JdcVlga(64k4} ,D,'<8 / ж: ,  [4&d$0|bF3!p/@-F$Qdy4`l$hpԆ7w ,`%x2xv-)I*t!,#4tb\(/4.",)H6243;tm"R6 g -5}P2/08,\*@4P%2#,8#(#5 8 &`Xc6!Lp7(Lb5Lld$7,x\j$<4|Ը!`H6$*()L 6"t,4 .`1)*04G"?<5S c]P6t(27D6n/,{,h:&,t,0" (|_!Ȑ8 %,P0(17l$D\7I(iZ!'@e)5PzA/ 2,%X: -(Q $8/'0"$, 886  . (!p#d/:8h:FY6pV Lk/y8:T-)@+$l Lh:/X/K64S2$H]4#04`::$gKdl*T$t*`c B&m x,A)X: T57Թ6h,4' 7Tt 7 t8xH!3P4$4),717"F̲+DQ=*|kw"  Ei4 ((M&4!$,,$"4D3t* <6x#<T3iXm&x8+HLi P1`%F840p#> J3ixYD)jtXcw3(\/Lh.@2i&,TM& cZ&1Lk&2@w&("&@."&:&$ &:&g&b&!X&؝7&ܯ X'L/X'6L&'+c<3'Z4h>'.I'0gX'H2$e'2n'`1t'1$'$('H'H'xg'4230'('$&' $4'Ē,'{$(Xc(/7(23(4:/0A( .TS(.!j(8r(/(*D($40(J4@($74(P2(*((80!)))4x.)3?)1|L)=2])Xbl) :{):)V*)6 )4)ԩ&)5<)6,)+*j$0*Д1!*w$t/*pF2P@*\Q4T*1,[* -j*.!4*c*87*45*)(*H(*5l*h24*32*g*) +$ig+& )+ J0 3+ c&B+M$V+ac`+6To+!p+7+:+&+,8+`*4+L:+=(H+$4h ,`:|+,p:2,|H7dA,%TJ,8R,(v5`,:q,<3,:,.@,(%,܉g,: ,Lf$,h5,#-  -Ⱦ+-x4<'-̟0p8-`,0D-L!P]-8 i-$)-)-#6<-x4\-t3-g-044-01<- (.(7.B8&.(&/.d24I.&<].!t.|1t|.E6.Xc.0.%d.&#.V"L.ج3.2l.&.ȵ8.~".5g/ :/:/$ (/69/Hg@/gG/(J2PX/$a/}6u/H5</6/</(/p#X/!0/\:/ (/x+.(/pc8/8!L0##0,*130:?0X%J0)^0̐8f03p0*D|0)40hi0)00(P0/0@70c0t80H: 1T41:'1,3#41@?#>1P&\P1h#\^1(#m1<(1x.1:1 |$l1\h%1p3P1D31t3161b2(:2 : 2m$,2 b32f0D ?2\1"I2XgR22 c26t2D2252[442|6D262T(2DM&82". 2(ig222ď:26L35@34#8)3-4P;3:B3p$`P3,.Z3|l1c3cq36~3\603q23,ig3bc3|+13.03d:3&3t:3=(35d4,84%t*41H74d2I4@cca4: i42z4|14>/4,1P4)4ċ,p4P%43"4/ 4i4t758A*156@5K3Q5xgZ5( l5@,~575Bi5|:$5%5`!|50X251058O$5& 6V&P6f1@6:'6$|7`963J634[64ga6;)hu6!46pb60676(`16L: 6l6H6(Bi6.26&p7"h7b7@&x'7(m/67`lgI7b4PX705ib7:{7 9"7_c7X3i7%,7k#7P)7("L7x:75x7: 8 7,8]!h*8:28L=7,>8<8I8iT8T4c8Ci{8Ѓ 8n68̽08C"08i8'T8t%8|*"8h 88<2@92(9,Q6h9(: 59\)8K988T97d9L&<l9&w9\%9!89X 9h'|9$) 9:9D!09@$P9u :Tb :4':4tA:t2M:0"i:7~:':L|3:3:1L:::"P:\$(:7:85;&`;,:;6%;r,5;+ ?;0bL;Ci];ic;ԫ(Lo;2Dy;-P;V#<;cg; :X;6;D';'0;7;d:<V7X<: &<hg$/<,t=<&LS<W%xa<D7p<H"<`*<g<p6P<02\<6d<\ 4<2iP<T)<Į:=$6P =5 =i%=t&p.=dD8$5=!8M=03i=3}=Ԏ7=J",=h7=lC4=#8=q$=$"D=dc=C6>(,>%#> %0>"$@>#\L>*X>_#c>5w> i >&>4,H>g>\$x>H#>1i>1X>D%>$>8, ?$92?7 ?g+?E(D8?gH?h(S?6^?&/n?Ciz?P:?. ?q#<?. ? $?,Ei?|:? %X?E2$QE,7dE4qEH0}EX*E: E2E$3E00ED~$`E/E$4E'$E/&ET5!( F(:"FH '-Fcg 6F"DDFXcPF<i]FdbjF*&yF47\F 7<F(4F 7FR2\F w1Fxy-LFgF. F1$ G45iG4 &@G`:0G b8Gc>G`4XKGX 6TG,F$$cG05qG'yG`gG|J&GH#TG|`cG$7G=iG@1G(: G/<G+!H4H_!$/H |?HԺ,MHDb7 [H 1xhHj&HX5H7H|%hH$2H'LH*<HTX*I!I64*I .;IgHIZ*aI uI8(5DI24I%I#`I83LIH( I)LI4/I<(0J&5`J"L"J6.J)@J |PJ3/8aJ$+mJ8y"~J#5J$l'J1LJ6\J(J.xJL4J *% Kt# KJ#( KP4.K, i:K?2$DKB1]Kl4'XgK$`qK\$4}KP$0KPl"$K2 K:K1K$:KgK,KH @K`W1L'/LD5+L->L`, JL.4\L,3lL :x~LL/LT$`L#L0*L$L(\#$L#TL2L(X%L2M( M'`M(:'M8#5,7M0GMx6 ]Md +fMl%oM@5M6iM $M5M-M0,dM`:MH$M|$xM6iMX:N3 N̺,N#$&NF8,NX'5?N2* XN%`NbpN,}N,N46N5N NbN: N2N:N NEi O|2 OL,O8a$+O8Q7?O5@JOD+[O$8 hOX,uO%Od:O`bO!O6OK3$O0OxbO<7OXbP.XPT:!PH)"0;PgHP7SP(1eP"4vP Y6TP,@P:P|6hP3XPbPn)P8P,P~78 Q/'<QU2(Q4!?Ql0<MQd^&YQ48qQP,Qd7QiQPhgQ8u1DQPh6QL @Q%`Q4,Q 3R&0 Rd:Rhb Rp%%0.RDo!|@R4-`LR*8VRp!hR:4vR6iRt/pRԜ,R&`R)8R(RT)lR( $R3$RD;(<RL*TS& S:S!/Su18=S(hOST#``SXc$|qSt:S% TS!)lS&S7 S4S,2Sl:S#S&T!T8"TI'-T\T2p=TDgJTc WT.pT+.xTd)1@T1Tx7PTx' Tx: T$.T: Tt)UDJ6U8*U<c7U+%KU<&[U20nU tU\)U$gU<5U=4U &UG%|U3dUt7U,Up& VgVm1"Vc$3VG8QVt$dYVT(jV3'\tV}$VZ*PViV?iVdgV`g$V "VR6VbV4 W,iW\&)Wd6&^%^0^,b*^#(2^X`&HA^_"tN^,! `^`+o^8,8^.^pg^B(^X1(^\34^:^%^<6^`6_2_7$_"4_6<C_\c4`Q_2Z_: b_0:}_8_l6_:_p&x_ȯ" _G8_pbc_`6`_2`h@&``7`x?4$#`?i .` i8B`:Q`E(4]`hhgd`x(p`'`T3H` 13`L'`$g`1(`Ei`-.`:$`(*"$`p3a&|ag#a2p/atg:aX7Ra4*caX,oa:|a2a"a 0a5a5al$a؉-ad6Ha4Lb$$bt8 %b@75bܛ1 Jbe1$Qbl1<abL#|rb4tb$`b\3b4db{)bd6b+4 bL$b3bd{4| c7cg#c l0c :9cخ:Ic$&Rcd6ec25`uc<3c7c\3ic4\*c*)cgc@2cT.dc# dxE dH+ d< *x 9dh7Idd2Yd@'cd"DrdO1Ddи74d/d#d`cdd(dB'0dl&d#@d: ebeL5d e6i4eg2?e.4Le0(\Xe#$ce2me-ve3eH#e,&xe(eD3eie5geLR de eD-eg'fx@ f,!f@<5T/fh&8f*dFf(F*Wf԰:@^f@bhfؼ'0xf& fD0f@%f$|fDZcf5(fG#fp"DfX.gh6pg,6*gn# 7gTgBgȄ1SgQ)jgԗ"wgP$8gh(gx%"Dg40g1dg/g 3Hgb\h>1h,),h;g5hx Bh Oh :Xh/XdhP1/duh/Hhgh0ih1h@-hԐ:h2Ph.hK$h<&hh i3P'il'P8iTq$\DiX6HViķ%(_i(4oi(!)di!(Hi@'hiT/@i 5iX id .i g%id4\i6i԰$j4g jxb1(j a50$j32.j@i=j60Mjv1`j,pjK"zj1$j\14j@:jt:@j$hj0:4j(gjL7jD&kx( HkW*4kxbGk:$Ukx%dk"sk44k: kb!kx:$k44lk8k/k.kȋ7l+ l0l܍70l /x>lJ*lVlpgala!ml8K+Hl<+tld'(l:l3(l3)l^#lD(lܵ8l.Lm(@6$m97,/m@i9md" Hm3[mЋ7jm~(umD1mP4hmim|*m4%m$#mx*0mcm'n,0'@n.@nC+*n)@n`:Rn/|`n3:vn4!nt nPF4nȒ.n4bcn<6@n*n(1*o,'@ o+'Togo3-oЎ#7o3Go pdo<0soo.xo,bo0B 0o*'Do^.<oȞ*|o3o}/o6Do,o_7<p̺# p\1ip:'pH6&T0p.?pd+Kptm$D[p5\ep`($qph2H|pr*tp9"pd6p54lpl1Tp5Xp2p?i p`$q2H qX0q#)qg%@3ql:Aq.|Kqn5`[q6ioq:qt0Hq\:qx^6 q8qH3q#qؓ!@qL6pq.'Trdg r,`rR7'r $|4rܟ2L?r1Yr7cr$$zr\"pr2rp)lrgr<4xr<%5r/\r)shsac sx)4D/s7Bs cQs.P_s!ssbs5sD3s"Ps5<sl:s8,spgs :PsX5( tl!`tDw' *tLC'|8t:Kt, $Zt:jt&ltttV"t.t74@t:tL4t|-tbtT=3Xts"tbtDccu0g!ub,uDb9uP &Du!Ru1_u0jud4,Tuu<% uguhe$uT+<up,!u_!ul3`u4@uU.u(D'lvtZ4vh,'vhg1v6@v4Sv >/dcv((Xov'5X}v8&v.v)v(hvA*v(v]' v3w^)w!-w̒)Cw#`Rw4cww+lw\!hluw:w%(w0:w`: wP4<w<"wt w *(w@$xe*xD0xcxc%xܘ-0x\/p?x' Mx0gTxN'L_x8J$fxdb7ux5hx& x+hxh;!@x)lxd%8x4',xd: xg"x7 y0<y1/yT)tGy'TVy7iygsy88(yl)4y4by#Ly$: y BiyhyT"\y(8y(, zLdgzh+d'z,+D#1z )Bz$$0Jz4]zlbizE)z`Y6`zlbz*zt +zL Tzܵ0 z 5Xz4z:zh&5P{+#{ 6.{hb7D{36V{$|h{$4z{*{: { T{x7{:{0@{d:{#{7{0|\L(|Ж$|l:((|t[-d1|6B|.Q|gf|p"n|-<x|4a!h|$|l:|f7|x=7@| f2||g||g|b|,'&`|D(H|8#H}$5}~6%}27}#PF}gT}ia}Dg(q},Bi@}, }4%L}Xj"@}h1}7}a5L})}H'}D'"h ~Tb~%&~P45~!0C~'|Q~6i(c~8(t~ /(~`7#~2!t~7,~ M6~<7~h#~# ~Ci \7'$L4'/$5D2R3P[(.0tc%~*@lg  75)*h D8'7 ,  t6|*&G804g> !Ms$W)(k4T$ se4<K1p W-H