ELFa( 42E4 (   xx<<((1E!e!ee / /;0&00Qd;0 2 @00Q8$/ // @ <  B00 R_`Р -LZ a!e4h)emain() returnedvh   ),@@(LQ 0/d8wh -L M0 ||!\, 40 p@M ,*0ST1  , *W8E0E@(1 0S:P`劀0S0 0 0Pv)U@ PU*00 ,*00" 4 +x0[)\ \0@D P g%p00 " P꼐<Đ<<̐<Ȑ< -4!L01 M, P@0 )00eS4 Z0p , 0 Z 1!R,00 )  "P,00  @0S0 0@` V *H0(P$ 0lP, 0 04ʕ<Đ<Ȑ<< - L 0$ 0 $ -LM  0@ 0 0T p-LMH$,$HP0`@ 0p p-QLM0@`  `NDpQP* 0 P(U:p p-QLM0@`  `aDpQP* 0PXU:p p-QLM0@`  `\DpQP* 0P\U:p p-QLM0@`  `DpQP* 0 P,U:p -QLM@/a0 *aA:A: -QLM@a aA:A: -(L  -(L  0-" _  P0L @ 00hD p-LM@ זP` 0͖00PY YR` cUpp p-LMP@`V0 pd㧖p0H@ 0S' 000K  c 0H@ 0?' p-LM@` P~?XP 0s UP(0Sp(00PS 0U 0 0 Q0P 0UPp -LM0pS 0S 00 87 +0`%`K% [)0S ) %0K ~ 0@P&PK& [)0S ) &0K g0VS UR Z   Z8,0X12hZ(1,@0X 0GP0 0000S 00  000 㺕000 0`P`PDH$ ,0K$H ,K+K*@K12h1, VU000㌓00mIꠐ< p-LM@`POM]p -2LM PR|2   Jh0S`2`h0 9E0SL200l0S 2 2  FB^h 4$` ,p@dP,` 000S2022/`VOھ21  p,@`0,K  `VOZ`@0S2`VZY#00,0K,pK!0(@ *pK+KnJV 0< ЧP2028#202" (P2$00$0h0 ``IV000P wd S 00p000 d-[`p 0 00  (000C0 B:C:HC: -LM0`10#0P8pKP@0 00 0000  0 0, 0 004 P`0 0@ 0 0 @08 @;0  @ᯎ! " # C: -LM0p ` P_㫐0ST  0 PE0 @ @00$00$0 00/A#bJib@ | i* u 0 P(0 0S  0 Ph ,000i? QGMb< -LM0` @2c1RP,p 00 P 00 0 (0000  ~dW 0 p-LM(0 @ 0P<0(0`0@000+  00    0  0 ^0 0Sph,;000000 00 00 -LMh0 80 PD1< p4 4PKR0 P8_P&0KP<@40K&l P, /K3K2K1`K.K 0 !0 0 08 0< 0 0'0 ,0S ,AgC: M-L0M H0< $$H@@ @T ##(#̠H  $Č$$LL@ "D8@KH@[P T5@K@, P[3@K <@P4K@@2e80KD 0@K @2K1K7K6`K~ 0l0` 0P4[, 0 0 0@ 0< 0' ,0 pS ,AgC: p-LMP0K`Pc @7_ "0  0'p0@- @ 0S  4000$0 0$0$@@ 0-L@㫌P(Q@ᆌT` T0f p-LM @00P ㎌$0`0$0 @R 0$ 0 00  0 Rph^\f -LM4@0S @440S -L M$X @R0  l0@ $@SX hMXC:C: - L  -LM @t- 0S@0 @ f -LM@ R000 hC 0-LP ,0@T 0U @T0f -L MPP@`x ᆋ3[- 3[@003[ 000403 [ 0  ;0[03[:80[07 [ 60[0`W`WC:C: -L M\`@ pS 1\ p0 p @夀P0S- 0*  0|0000 006000006|@@;p 08 P D L 4x 0 0?<0040 000`000X 0 T P 0 T 0 T 00ʠ0 010 0 !  0?@?<0 0@0 0X0ʸ0U0U 0?0 \A 0\ Q,000 0PQRS 020010 0?<00 00o0S, P0U20 @0>0ʠ0 010 0 !  0?<0000 000Aꀶ80@- PP @ @ P  0 0,,,,S QRP0-  00   00 ! @0T10  @1 @0Th@1 @0T X@1 @0T X?#/Z?B!P`10d!h1VO VO R0000 0 XP@$0SPX11@TPU0)(0S0>, \p0 0:(8Y 0P80 $ \NZ? 00|P@0!Y>!0@\T0  @h @T0|P".@40|!.@0|ugX8<8$8H: -LDM0P $@T P 4/000K0S@ 0 ,8TpQ# 0,0P*:P$:QW 4 , (0 L0 H 1D 000 X R X RJ0B ( 0H$Ƞ 8 $8`< /8 !;0 0# W 0 $@0 \04 $0P` P < l M88 "50 0@ W: 0P0 0 04 , 04 X X0S T ! L001PQ , 0S T0S0p0, \DH  0p0, \L MM8 W 0 # !" <JW 40 T gJP y0 $`{s wJ5 0@+& mJ0, ,0@ @c, DZJW 04! "$# (,MJoIJCJ@J=JL<@H:dH:H:;H:H:TI:I:I:I:I:I: J:\T0 Ƞ?0 T0@0EPFXG` M d0 Q R S N0PP09 T0: ; A B C 8<D\LhOl e p0f0tg|] ^ 0`_0abcdXYZ[x \ @ `Ÿ11 RP8 $ #4"( 3#8( 0<0!S !<!0>11 /!0!\ zxD0 @@0 0D0  D@ 0 0@ 0Dx 0@-<0 Q 0 Ux<DN/0@00x<  ND<D 0$<0D <8 00D `D]<0 d,D<0 T&D< D!D< 4DO:P:8<<< <&`006 &006 , &6`&`d006 &006/`P@K0 5K$KPT6P6$[  D6QW BQ/ +>4K5 05KP4[S;0;  ,'~ T`5%#K #K<KP5  [5\# P6K 00 Q0N@D%D5  0  0 ; 4 4 w4 N4  ~ r  mA;$0;0p3#,] 0x  0 s ;   0g  0a  0[ ; 0T ; 0M  0H ;  \0<  0D6 ; 0,/ ; 0(  0# ; v 0 p 0 ; 0 ; 0  0b ; M 0 G 04 ; 0 ;  0 / 0" ;& 0 ;1 1@ \`0+;Ť1\;0;Ŕ1Qt1x1 P0+;d1 P;0;D1 ,1+81@ Q01}>;1+ 2R1R;<;;0;0 Q; ;g#S:T:(T:4T:0!;0R:+ 8  D ( '; <_e"Na'(j) -+8 L#8 $ː R2 d X -+8 L#8 $ː R4 h X -LM;`0 5R˖ R2 d 0X KR4 h 2Xxrː R2 d 0X ;R0 ` (˖ 0R4 h  X2Xo_  ;R" D ( ˖R@4 h 0XH;$HT@ 0  `1˖ R4 h :X41˖ R2 d $1X1S0˖ R4 h 0X"0˖ R4 h 0X ˖R4 h 0X  ˖R4 h 0Xp -40Lː 0R (  -LLMT 0 `@6 0pR,6 R s@n7PP  !1 01$0  1 rU r@R7$r$ R 1 0 +10 ,(0 0S /S ><@0 Sx$0 P@ @<P84 R,4 R }m \SD0 0 l0KP6[5[ 0p0 qr@6PP 3 !!$ !01 >rU| Vr@,6$3r$ R 1 0+10 ,( 0jn@  DP 8 4>  D0n ot=$[Q>K  8K ~ *K z 0 0D Pl00l0 # R간[>0S6[¸ D lKY0 <0 < P l8 \=<00 0lK 5# "tZgXXgD[gHT:T: 08T:T:U:lU:05;505t0p000t0p0 p-0LM`a 0@>#5K p\qL0,0P@@3qT  phP=<#U: -LMA0P 00K  00"[80 41R; R 3[pCX#~mW`˕   20K!0˕ R8 p (K#[0 R3K#[101pW0 0 80xL@L0[a= 40   # -KL@DtpP ˗ (0  @DrtTea˗ 8R  #8X KR8  #8X 0[R8  #8X˗ 8#8 XA ˗R0 ` (0P@DzrtT8< 0z< ;R  (˗ 0R4 h  X0X  8 Y<U:U: p-0L M PR`0 PEu @0@0 0S PE'ruU;0;d `01K02K01K80 K p,<p;P#V: 0-0L PR ;+$@˕<<+0Tq˕@+0T0hq0 -2L M @RP 2R 2R 200!P 80Plr; R8 p (0 hVu ;R8 p (0 Pe`\0  R L8 p J0? SG 1 R 1R |1R 1R P P 0 00 001R 81R0ASȞ Ԟ ܞ   0P 0S0S` (PK?2K02K]< <0(PK U #*D "#(( -L8MP`? Q 3\ 3P [2P7  80Pp.؂˖ R8 p 0X KR08 p X0\  R L8 p P2 Hp0P0""K0 2K"K 2 R 10S SK[,PK1 R\1P 1P0S2K?,PK2K "Kl!@0p2PTKPK&U?G  K5K10 Pp@W 0"K0C "K Sꠢ Ģ ̢ Ԣ ܢ 0[,PK2KX0000000S>L0,PK0K2K #!( 8 #<" 6S-L@p6 8S `,P˔0S8 #8X0˔S8  #8X|Pt0˔ R (0  PEouU< : `V: p-LM@80PP`0 ( R8 p p -LMPp60 P a 0? R6 l  ˕R6 l 0X KR6 l 0X 60mP@ ;R6 l (P0 S ;R6 l ( 0 S4xV -|1LMp00  @PHQJDa˔ R0 ` (0PEUouU4 ;R" D (  ˔R4 h 0X 60Po?PPl0˔ R6 l 0XP?U< &9 #4V: -LdM⌐Kd T108K0p8K05 -BTP @ 00`W u0S PTp`@00X 8K0 5<5 d0 # p-LM 2@RP`0 Oʐ2RH +ʄ2R ? R `pd2 `P2R H2R@2@@{ .@@0 H D1R 1R 1R111R 1R{ 11 1RL !ʀ1R t1R l1Rd1>X1R P1RH1@<1 @ ,1 $1 1R" 1R 1R10 0R 0R} R0`y Q0u 28p 0}D 0w 0     -%* C 4 8\V:< 0 -LLM]p@\ k` ;h l  0` \0P`kx=T (l=Td=T*\=T IP=T H=T h\ lQ `kP \ hP\1S p @hh h ?0\ hP5 (=  0<T> (<T 2 = S! =@S <  8C8;;  d< R ; 2KK"Kp<0K ; < R `;2K03KK@ G 505\ 0S ;  x;  \M]ohrPi \| r \i4P^5@Y \d:T )X:T P:T;hKPB  h 7\0*hP' h7 "\ 9. @RA\0S\$9T2 $9T P: R,\;!  d)000?K2K 9"K 0K$9TP \ hP@ | Cth \0d)hPh \ 8P* Y8PP  P  P I 0hP hP5 0 h0 "w7P7 Q7 P! 7R 7R 7R 7R 7R\; } ; y ;u ;@q ;m h7f7P 7P 66P h7Pp7 RR\7 R T7  h!87 @&0<hKPB6 R> 52: 6 R8  h +h6)00 0 6  hP5zM`4@U` 0% ?A1c バბ 0z 2c00x%`%08% @5Te85T]*05TV $$5T 5T \ h \;Th h4,0@5  hP\0h 14T& 4Th h \$hP5@ 4 R hG P\ hd$k. \0 \ \  3T 3Te *3Tr3 R{\; u h jh <03 hPTh2 R \ 101K2TG5 2 R(  h Bh2,02  hP,h0 S( !!l *hl  \ l! \{ ! .|*h P !s\0l l! Pl  Q10Sl{/@% {].P  @X`K@&@@d1@5KEK A%K RKK 5 0 l{/@ Pl0  0T C0T&gi2i 1i iii i i i i i i i 4i8-%C\0 d  h00iZ@\0|S<:Vp h  pPf @|90 p0  p0@R0S@00  %05<0 S0 S0 7S 0 nS00t0B20S 02 BB0 C 02 R0x0p /Px00x0\d | MP\ 000hd0 |0 iZd0  |0R*V  |1`Bh0 a 4 /0h20k \}h ,4h \0D#hPh0 Sh3 RL  R 3R 3  hh 3 ᳠ᴠh ~ T h0+4R$  4R P hDt} hD `4R`4 RxDh a4 0h04h 峠0㴠0h0$0h0S00h h Ch4,05  hPh0\0* (f 0-M0LM PcR  0 R ;AKA A 8z 00  00 2|0|@x0 Kp ̠0KPT0K z R4<0< Ca0V:#K{  @`f 04@K3K0O U0K Q 4K44 R 5 ll4( K-K00QK3 ;Fg>PCP 0nK0  P+`!0+  P;`! +0d9e5 @05%l3+%a$8H1,D1$$3( K S0BSKR/K00"2(K UK >K 0 2}-#00} 2P 0S P W_KVoK h2 0`0\2(K!0q828"Q1"W_K(KVoK01( KOKN/K00 0KPK&@@,1@K@ =KMKKq 0\10K8KKK 0,1,!8K 0(K8K 0K;}00/K7K'K 0|K;m #   : K 8K 18"0C#K "K4K1p0C8#8#$0$#K@QBK* 5[9<0K 5Ke I=L0 B8@_$[I4[Q04KD 0  0000 <  L8@ B0^ DPp 0 P0 0C0 0 c0 R 0 R 5[000` 5e=5# 0-@LP,- 0 t00t00W:# -LM8@@ ; #< Rhtꔭ< -L\M4@KP 03K2K [ R 0 S  R R2  2  | pb0S  \23K@2K 2[[3K2[K3K 2qK3K0"[2[b1!1[!12āP/ 1Q# 1!1nnDF`d N`<p1Qc[S[s[ϠNP!l H 0@&-["[2[- ! 1QQd@K&Q0 6K06KP`0[@S^0[.S[0[-SX0[S_[]0[\ [ac 1Z[1!!21Y [00:C5>C  0#,8X: QhX:0!; X:hX:v'N$ -LM;`P(0Bp S?P  $  $ $ $ $ $ , 0H S$   000NP@+P l0l 㳀pT0 R    p-LM@!0! 1P` 1 R x1  , RT BRP1   R p41 00S  ( ( ( ( 0 8 0 \ 0 Ydp0 ^0 V0 t0 h0 \0  R  R40  R; 0 0 # 0-MLM@P800000|1 R;  & 0`!00SSS @1/K 4!0K(1AKA APA>K0C R00000000 K 0 K, 0AKA APA.K B00C S񟗽 | | | | | | | 000000000 #D -ML M;BKI0 I{ 000CSt}D '0T p0S^XPpڴ8! #  1  P`C P`=04H8( K81BNK0!@@D(0K 1  P`# cP`8 0(K 0$!  0  P`   JP` 8L0  @ T /P`@ # p-LM;@}̀( 0 P `  0000 0S`V@PpR 0 SsP ppp0<g -<0(,0L0  #0 0   p-QLMPC  R;`:; ;!:;`000 0P@ V p 0S`+s է 00b=C4`#hx0  1> 0P@8p, 0, ^*; `p"#8X: 0-0LM P0 0> @P`0˔ R  ( P, 0B=C01; 0000# R-L  0 0C SE<       \ h t      0 00 0 0 0 0 00 0 0 00 00 x0 0d 0\ 00 P00@ 00 40"""""""""""""" 0-LM0@PSh 0 0 0 0 , 4 < D L 0 t   0 0 8 h1 \1! 00,1 @ 1111 @P !1@P0 @ @0 000 000 000 000 | 00t0d0`0 @ T 0@P@0@ @P"#""""""""""""" p-LMP\` 0@S0\0S p  d B 0000 0-P@0@@L 00000 0-LMP0!0 }0@ 0K@{0 K0 K@t00@i00@0 0S 0gX: 0-8LPJp0 R 0s/0000@0p  R0Z,x0 20hr ( X: -8LIm(P኏L8@`p"`0  *  & "밠 .o(8X: -8LIm(P኏L8@`p"`0     밠 @(8X: -LM8{s/000#\, ,`V( '8c@0S91!@P\@dDFA 02 Sp&h1b1 R0``00`[Y `0;,o[@ S ~2]@TZ @ @dP[DFA@04 Spʄ1d|A R@0 @000@0 @[@,'  '~< g@ g(gT<Y: Y: -LMj[ R @$ 1 ! 00p , W00$ 0 !0*0!00 @@X00W00S@ 1  R 1  oN[C 00 1+ 8P   1R010000 0 !0*0!00 0@@"  P<' 8P  101! R009P~ '<@Y:pY: p-LM0@Z[ `R0000 0 !*!0S00@@@P2 phZ0 Ca  `K 2PPVP@ !+K3;K#+K3 ;K:00KP UP6PP@K PPUP@ 1  b .1 PPĀK PPUP@P !P3R Pô0+[03!"@ r3Qk a:3QsPU@Tp 0|S:?0 K| K/ K+ 2&K0 6K34K3U K#4V0K3f K4K:00 f0Ke K:0 f0[h K0  f0K:0 f0[h K0  f0K:0 f0[h K0  f0KK| PPL0|p00@TE  |0R*@s?K PsPP K FPPs =[ 0 K 7PP10 U@Tp! 0S:`K 3@ 00@ @  0,PpT5<^%2 4PpB%"<]. 0p0  0 Pp'5<%2 PpPO%<@ B<<5  PPp @?U<>@000@ @ ,,Pp<;0(  ;4Pp+<;p0  0 Pp<(; PpP<!,00  0P PpM?U  xP`3P@5#3 0#3 0/0S3 0@0 1 p zh3h#\2d3`"d2P#P3DB 01LRU   " 0"{P1PQ<?U<0$<0<0+8<0( 0O?P QPUZ<0$<0%<0"8<0% 0<0<0 / * |% l ` P @ 0   .0[Sr-0[So,0[Sl+0[Si耟pW  +0[ 0+0K\804 ,@ 804,00)?p^:|/!)!1!|+!%!X!!t!@/!L/!^:^:^:^:_:,_:X_:|_:_:_:_:ff -LMR$0P0; ; 00 qLG<1  P`$ 0S, 0 ,0?Z@0 08@ "! "<V(0S $0  (Y [J kO @P 0 !!$ !0 PPP1P8OY PO@p$-O$ PR 1 0 +10 ,(<81 !J7tZgXXgD[g 0-0sN  0 0 000R:0N0 0-LM%P"@??  R @Z<(0S5E5EE0 $0  ( 0-LMP+ ,@ .7P@ ?T<(0S088 80 $0 ( -LM<P(0PSh(2S((0$(ASv $'2 0(R1x01 (p x ?#=?0`c(2S<<(0Sh $0 (? R㨀  Zl00l0P _I  7S P l00l0P KI ((0/"-Q? `b0J0 0 T!#54c1JS 041 0 Q-1 A0 1 (px 0J ((0h00h0   00 02:S 9S <P <  00 0 ( 000C 0H $0 ( (p H$ T-00S 00S    S`e`B`j`5@ 1S84> 0X{@ -L M5pS, 0<01൯1 , P@l5( 0CR@V<(0SYeP0` 0E2 R:, 0 ,0U@0 05Œ0CV(0PU@ `20,( 50b5"00!"S0%212` ` ?#=?0 c UePEUE7@<0$ $0  ( `: -LM5P p`>5 0 Q! 001BT KWP8 PQ 0S010C1<pP  65;5W 0<5( R8@4D(@0T804H \05 $0 (%5RQ 0S0A@10C1Gt00t0 -L M`p LP8+04 X(K 84P 0T8@4$0 \84(0 \8@40P T8 047 T(8S ? R88424x2@ @ \84D <\804D ,58PPP4D 0\P(8S884< 04< 1X84L 0\(8P,0@04 \8(,04 \%8,0@04$ \%8@,04 \84 0T? R88X ;T ;44\? R (8S ,84R `0T%@ %5;55KT0 (84 00X840@ c{ 0XP$@?P2SPU @Z@?P6SPU@Zp<0$/E06<0$%E02!EX X Q-L@0 ?-#@I?Zc?!NP  ARNk`PO_P`` ??CS0cS@  p-LM@ 0PT 0T` $8  `$VpVp p-LM0 00 PU`00S PU@ 0@ 08P<Tl8pI>Xd$6!d -LP@ITp` T sI0@`(R 8S h - LMş0 0 P)((, @4 \0qWX fI8PPM CIp@5@% 0 lZ   0 QNI00 p0 00 'Ih 4 I, 0S 0Sp) `px$x4s=P@ p  0Sp0 p0 HQ3Q u%p 0p00 0 H0S H:00 lK H :@TP0 @TT000 T0Hp0Hg̒<`: -LM@Dp0  0p0D p-L M@D0pPt`x0p0t0D880V @U 0@@p;0!;T`: -PLM@D 0R@ 8pDP堀`U UJ +<W0  p0 oD0 0& |DU*嬠`0 x p0 0RTp0x 00 h `P"U:@0aP0400 T<<< -L M`84@P㈠ $8 ,    $W  $P\  p %0  ,p9P+0  , 0  , p0 0p0| R,0H&, h0"2  $ h0!20, h0!,2P0 000 Tlp PC0 0SA 0C  $ 0@.0U:x t0 0Rt0x  $P|0Ta0U, 0 0 000 TD0 R J000 0pp0 C<<< -LP `Cp $  $ @$_C@ -LMP`poC}N $0 @T YE0 T00 0 }N $0 @T =Ei%C -LMP `p@7C 0T@0DD @T0 T 0T 0T 0T0 T $iB p-L M0 K `0  PP p@ T \0\@PU HPH0 0Q S00 4 0fXdfd$6! p-LMt`t0lP P0P@HH D0 0S0b$0@pb ffff !I!`:`:`:a:0a:La:ha:f'a:a: -LM0`4P@ 0T 0T 0T 0T 0T 0T0S0'0 Tpp0 T}N $0 ,@T sBdpBp}N $0 @T bB0S\ j pT  $0PPpT Wa: -`LM /  ; ,O 4 Z>+⿎0+ ' 0 +P0pN @ "P^P Pɞ  P3 NP092 9) > Rc   P&Nj PN>U0@t2t"5p2 0h"h2 0 ( `R<29424"102)$"1 c 5  X0@0==1Π11P=!0FP P      <$PO P=@U0@dPO P=U0@ڕPKNP=U0@r g  MJGD V  R  N  J l!l!p^:a:48D8h!!ȗ!!l!!Pl!(m!x)`l! N < !P!b:@b:$8pb:b:b:b:b: 0-PL$/ 0@ /e P=hS 30 ꔭ< -0MLP 0(0$000,0 ːp b0 0 P@\˘,0K00 *,P@\J˘00 ,  04P@$;˘ 0 P@. T0!g,a =P$  ET`0˘0 0 0 P@`Z<y _q  @c:@c:dc:c:c:c: -LM0Y, ( 0 4 p00 `0S40@0040  ,0 [(0S'00$&900000 0Y,0˓(0S0,0 0(0$000 $0 (00$0 (,0[ -LM0pS [(0SI$ ˙ " 8; 0@T3 0Z o`0S [ (0S$80Q00Z@@;$0 ([ $0 ([ -0L4M0  $0 0(0ː0P B0P  0 P`˙,0Kp00pP P *,P`|˙00P,  04P`D˙ 0! P` 0A,   P  04` VH` ,H0D 1˙p@0 0@p 0 <  `PH<8 *=@4P $ !101 `0`$00 010` `<0Sg =P@d$< $0S 0 1 01;00 (`,`0<0 8  1@ ˙@D0 `0;P`)<8```D04@ 4 ,00#,P## 0H  H v˙(0S $0 (\ D@ `0,c:@c:dc:c:c:tZgXXgD[gc:d: ˖  0P}H=SQ01p0@0 ))0 0PS<<81 0  4,8!˖(0SL,H ?#>0 c˖HL,` 0\81 ,0S (, $0  (˖(0S L,0 ("0 00(N P9 FK"4 0 9 "4 00   1,K:)01BKK 6͖1H 0KK $A 1 ,q D tV.g(e:< e: -LM(`"p[3@PU $ 011010  1 '3Ut0  @K00岀 @  00 0t;0t;.tZgXXg8e: -LMMǟp04 0ɐ,0 0! @ |<  4!70S2OO@ 04 P 0<1 000W@@I1; ,"z2 1 t#)D n`"Z -D"d@2 1 ^#@ "W2 aC0I D@Mܑ HZ  -B!>1` 8 4Z  , d!*h1 1 $#)D  18!Z (1 A0 a!P   0@ #)D 0U0 00 0 S  2 SB  #@  t888T8888848 -LM> @R <)<@ h p-LMː@0`8 0\9[#20 \˔4 0\9˔S;=8.\9[SM0 08 \p 0-LːPO/00@\-0˕\KQ/x0\˕d0R/\0˕-D0\KQ/,0\˕0p8 8  9 S;0; -0L0)pk@P PW,  ˞ 0 ˞\ _ -8L8ːF<0 \ p-LM 0@k4P8 < \ ˕04 \p p-LM 0@k4P8 < \ ˕04 \p 0-L;ː@P ,  4 ( 0; , 400 0-;PL ,0@5 ˕0 \0 p-LM`PDV@ V@@> L\R@ ;W/,˕8 (00W/\p 0-L@PT T.00CS  0hPꀨ!!!!!!!!!!!!!!!!!840,($ e:e:e:e:e:e:e:e: -Lp H -  ʠ  @ \>4-08͇<@M` Po` < HV0@P`P#`` 0 ,  HV@P -L`@0@}.cTdTDP@p  @dTP y48f: -`L;0+R0;˖#0h \KU0@|2|"5x2 0p"p20 ( `7ᔳ D29<2<"182),"1( X09@0 >X>2Ÿ10>!0P\ TP` QM $POP=@U0@dPOP=U0@ڕPKNP=U0@rLPU J02N@CPU0@DZ  !!p^: Hf:88!!L!0!!!8!P!x)H! X<""b:@b:8pb:df:f:f: p-LM`/ 0@`P\QN@PPU0@Zp vꔭ< -0MLP 0,0(0$0 ː!bap0 0  0 P@]˗,0K00 *,P@`K˗00 ,  04P@(<˗ 0 P@/  00 ,a P%   T`˗0 0  0 P@` X<0]( @c:@c:dc:c:c:c: -LM0 R0 , '4 40q00` 000 0R4 A 4 ,0 [(0S#$#00 R,0˓(0S0$0 0,0(0 $0 ($0 (, [ -LM0pS [(0SI$ ˙!b! 8; 0@T3 0Z oϵ`0S [ (0S$w#0Q00Z@@;$0 ([ $0 ([ -0L,M0  $0 0ː0PC0P  0 P`˚,0Kp00pP P *,P`x˚00P,  04P`@˚ 0! P` η00, A  ᷴP  4` 強4`0 V40=D0 p0˚0@ p,0  <  `P4<8 '@(@P  !101 `0`$00 010` `'0Sd 'P@$' $0S 0 1 01;00 (`,`0<0 8  1= ˚@D0 `0;P`&<8```D04@ 4 ,00#,P## 0x˚(0S $0 (\p <@h `0,c:@c:dc:c:c:tZgXXgD[gc:d: -4Pp9SL00S@0T  ᱱ4Pp Ii i i ϖ1i -L@`pP˔d ,0 PcUdU ˔048 \ h0le: p-LM@`P˔ ,0 PcUdU ˔49p \P;T ,0P cU(pp p0e: -LPp`@˕t ,0S@tcTdT $˕&014 \1@} hn0e: -;[LH!,`p ,$HGHT0!, ˖\K0 \ -L@nM`j;P-,˔p8`-\P . M*˔0-\ 0-;PLL ,0@ l0˕  0\0P0 -LM;@8 ,9˔0 \P0 -`L0P P0 < l> ˞  0 ˞\ T0_ -LM0HP,@p ,`P XP(8`` =SR =S 0 P`1  ` h  =S  =S K V X # a} by;-,0(˔((0-\0   - -LMp0<2P00P  R22P@ R`  0@ Sa0>0\E,0BBPCJR0CT; Q  V@A  | XHa u0 %o i e   _0 %Y S O  J0 %Dh 0SS Y  ^0 o 88 p-LM 0@k4P8 <0 \ 0˕48 \p00 p-LM 0@k4P8 <0 \ 0˕48 \p0 0 0-;PL-,0@5 ˕0-\09 S;0; 0-L9ː@0 P P,˔00 \0$0@PL!\!d!l! g:e:g:$g:,g: p-LM`20@ ~/1!  1 /1 ɠ -    -͆ : 0 =M 0S<C<=N 0S<C<==S=/0C==PS=@0C= ,R0   0S0#P0.  U@NP@pPP < 0U@p Q -L`@ 00R00Sd@wcTdTxP@p  @TP^P@Q@TPZ o f|8f: -LM`;@0+R,0; O;+4RD ʤ4RD4K8 K`P 48 P4_;0;˖8@03 < LL0\ 0004 @0=0 彵hR `lp2 ` h—l 0XhRlp2 ` h—l 0Xop,P< ""< Q- L Q  =S  p-LM@ `P PQ ^P 0:#:S0 000S008 @T20T298 T20CT2o "<0S<<   <0CS,<00-,000 p-LM0P` L0S @0S0 0 <SLp00-,000 p-LM0P` L0S @0S0 0 t<SLp00l@-,00@0@ p-LMP`0 L0S @0S0 0 E<SLp00=$0 R0 R  = -LMhPplp2 p h2l ( H?` L10S<````.'  A0S 00VhB lp2  h•8l #8XX20X2Z5x`h`XhBlp2 p h•l0 X h:,h:Ph:hh: 0-T20QLPT2 @T0 0ST20CT2000箾 -LM@0SS#  R 0 R  0!  0:0::Q:\PhA-`4PU%@P 0 0;#;-R@ Pv@ Q0 00A8P09040Q@Dp 0 \+0"+^ @L00eL00@p@-P @P0` R p@w 000 0p@1 " 0-L@Pb0h -LM`0Vp0P"?hB p2l  h•l (0?`VZ P 0S P 0Sh_0S  0-LMhR@ lp2  h”l (0?00h~ p-LMhBP lp2  h•l 0X`hB p2l  h•l (0 `>cVphcVph: -LMPpxh• lp2  h2l (pWp hWhB` hlp2 `&h h•0l X`hB p2l  h•l (08:0#0W` ]> VW   2  h:h:h: p-L Ml@V PK 0,<P ,0"  000,^ `0< 㱞pp<0 p-L Ml@V PK 0;P ,0"  000,^ `0< ゞpp<0 p-QLM`P @Tp -L$M@, 0 40 t`@ D q 0@¡ H  0ᣡPZ0 4PP%0%40 `1`R< J< `Z8 2,Q8 @T007 0<0 V0 8 " D0B B * ':@474$ \9i000 `V P%,000 0gZ 0MP HP  ,  l4h:040 -LM@Z6P 0h -LM@!0P`h0SX0 Dp0H 3L0<(K,@K @AP , 040(,0P 0 (0  l<S0,x00> 0⼌0 R 0 R @@ p0 RP@ʿ 8呿40 ,0 ,!፿  =d" 0| 0@   $0S0$0 -LM0D`pP @T @;TLgiϙL0@TL0@T -L 0⼬0 R 0 R 00 P@ ݽ0 0 ,!ٽH<Y040<,K<L T00@K @4P00, p00 yi=d"4  QL 00S87"7"8"$8"4100BPD PP  PT H0 ;6P0DTP"T0DIPDD0000h0p000PD, P0r00 0hJQ,0 Q$0000霓<<̓<T9R H9RD9 RR ,9 R 9RV 9R 9R\ \^񟗿="p>"?"="?"="="="="="="="="="="=" @"@"="A"A"h—@lp2 @ h2l (h— lp2@N  @h—IIlI= Xh—@lp2 @ h2l (h— lp2@N  @h—IIl?h—@lp2 @ h2l (h— lp2@N  @h—I7Il0h—@lp2 @ h2l (h— lp2@N  @h—IIl0h—@lp2 @ h2l (h— lp2@N  @h—IIl0vh—@lp2 @ h2l (h— lp2@N  @h—IIl;U `5 T5R  RU00$5RU4 N4S, S < ğU1# =C4  0%SU 0R0 Rx$yR\$. U1 #Pj U@1 @# $  PdU010# \ \s^o="C"4D"="D"="="="L="="="="="="="="="="="="="h—@lp2 @ h2l (h— lp2@N  @h—IIl0h—@lp2 @ h2l (h— lp2@N  @h—IIl:  Rw L2R R U005U R+ 2R U1 # B1R\ \Uh— lp2  h2l (0@\ \Uh— lp2  h2l ( H0     RN4JĠ,K +0K)K,K*KU        # #D 0P`*@G S : R#: , Jc0 @`p`B0 Xp0C$ 0P8 R <0 ,4 0 ؖP@ 0P0NPP`  0 0B@$B -LMxPW$`K 00P@)p$ ,0#  0@0(0(?^ HlH 0p85040 0Z p-LMP@j`8 0HphD -LMp, ah— lp2  h2l ,* B: @P0  GTU  @0\20\2 0``V $0Z0``V &0Z>❟ ($8 040P@ t2 |,ǒ[03iP @ 090_P @ 090UP@ 0`90K0F?0P!M 0V90"$`0>V 0<`2|"`Vh—`lp2 ` h2l ,h—Plp2 ` h2l4 ,0 h—lp2 ` h2lH ,4 h—lp2 ` h2lL , \8 ,P  T81S h—lp2 ` h2l ,h—lp2@ ` hR@l0 \`1h—lp2  h2l ,`cV\\hBlp2  h—l 1\UhBPlp2 P h— ,0l\dV1hBlp2 P h—l 0\` h—lp2  h2l ,` V @`1`>V| b/h—lp2  t2hB ,0 0l \h—lp2  hB$0l \h—lp2  hB$0l( \hRlp2  h—l 4\hBlp2  h2l ,PhB, _Plp2 P h—0l \hBlp2  h20l8 I,$I00#N>C 0ChR0l lp20 0, Ȅ 0   h—l004 \@3hbAlp2  h—Q0l@ \hBlp2  h—4 :lH \hBlp2  h—P 8l\K0hBlp2  h—lH 40\hBlp2  h—l80L \40#(0` P"0h—lp2 P h2lH ,` V P x1@Tp!0040`THPH倢0L8 ᨲh—lp2 P hR3l1 \hBlp2  h—l ,0\d/hhBlp2 ` h—l 1\`VJA`V@DZ@,j:0j:0!;i:i:dC 0ChR0l lp2, ` H h—0l4 \hBlp2 ` X(!h—l36@ \hBlp2 ` h2lH ,hBlp2 ` h—l:H \hBlp2 ` h—P 8l\9.hBlp2 ` h—0H l\2'. 0P(0C0X(T(h—lp2` h2l ,Ah—lp2 ` T(hB$00l \+=%I$P 40 R(0 R0 Rd= -PLMP |"RpW 0``00VhB lp2  h•a0l \3` T2X"0 T2X"YPJ4@T2V0CT2hB lp2  h•l 0\303 h(N@gax (p1@`(XPhB lp2  h•l 0\ <}"`\80\8r'P`\('0\8h lp2  h2 l,|"`ah lp2   h2l ,`Q |"pLDj:e"<`j:j:j: 0- LMQP hB@lp2 h•l @0\0#hB@ # lp2  h•l 0-@L(PM0h -QpL@P`08S 0 R`,8S  0$ $Rp0S`@` TP$p@p?j: -LMT2p0T2q0H0,08,8OT $PU 0SSoX@Y 4P$U  R00R\ Y "0ST20CT200F3 `4 @0 0b@0 L @0 倠0 `#> 00Z 3Z 0L0`$0S R000R0 A60S!0\@P R 00c0C20000#2w`$$0S` 4 00hB lp2  h—0l \Z0 00`o$J@s$0S  -LM`@(0 S4p8P!P 0$01l00<@ ,0 00 00C 00$@202LP0080004 -LMlhBP p2`   h2lP ,V5 <0 @ ȕ10C S1 !@ T 0 0 m#Tph• lp2  h2 l,?> 0D <@0 Tp -LM`0Vp0P4+0 QhBlp2 h2 l,3 `VZ00h#/0S  -LMh@ lp2  h2 l,3 h -L$MP%% 0 0 < pD8`EP, @ ?P@ $4D@08 8 <2 00 $0880, T4  ,K4 <0i,0P @, k4040<0<@   0140<0,  0 0 4 0 22$p<P!,\H10L`0,0,0, ,0 , 02,0, $pL08 08hBlp2`  h˜0l \0S 0 R P@5` X0 P0 ,! ,(0=q" ,00P Ro PH Y4[ P0 ; 80 0$,S03( 00 0*   0S0000Y @s"s"s"s"0!<00  H'P ,@ 00S  X 000o{000, 0r00  o+ RP 80(S"ˠ ʠ0S80 S0000 Д<<<<<< -LM04p@P`(0 0004iP -LM@P0p14 RP80 TrWL1 R@p`PⳫ090 (0 ` 0 p儦pL0$ `Rp 090>!o_0 #>WS @ $0S Z002e`Pmgk:(k: p-QLM@`PpᜍT 00 @DRT0  0 @DRTʃ0p -LM@i!P 0h -8L9R 8R8 RR 88R" 8R 8R 8RU 8U!0IPPS񟗳y"lz"Lx"Lx"Lx"Lx"Lx"z"Lx"Lx"Lx"Lx"Lx"Lx"Lx"z" {"\{"{"{"hB lp2  h—l 0\0ISh— lp2  h2l , }hB lp2  h—l 0hB lp2  h—l 08 0 S`0V@ C00BK 0( <25(  `40@ ^000P@@0 <D0*Q@8p0!@ 0WP`$ @ 0A,(0"A 0 P `4@  D 00p(04 0,08`090o0  otk:0 0P  -LMP@00pSS 004`090LP40S "pi0( 90 i P40S i頿k: - 0p`L<0@@pP4zh 0-0L@P80h0 0 U00#1300"#"0aS -LMh2pl $h2tl ,h2l , h—0\2t"0l\c"h—lt"0\@X"h2lt",@ cT) h—`02lt", P""$"";2o*0 PP  0hB02,0t" 0l \2H 004 70@6P P@ TP@0T!"1P0 0D@0@:D 0!@0T  0L"@TPh:@TP\ P :@0` @00 `HD``L@h—P0t"0l \o  kq fm0`!@O|h2lt",hR 08lt"10\h—t"l@ 0\!h2t"l ,Z@ cT R\0 Rhh2t"l ,?0h”t"l \= p-PLMP+ t"h2l ,?@p6`ph•t"0 l\T2X"0 T2X"71+T2V0CT2p6h•0t"6l \ нoN4 @ɣT ᐣL0`㐣4帽` ⯟ `Dj:ܕ"<`j: -Q6600Lt"h66l \ -QLMP`, <0 @Ɩ1p0C S1 !@.T 0 0 i.t"h2!@ l,?>*0D <@0T 0-T20QLPT2 |@&Tx2 6S d 0ST20CT20 00<qN@< 0"< -LM @R 0 R  "888@S4QP0hhhk:0@-SS0 04@ Q 0 #88R8 ,40S,(4((40bQ,5@   ,20#0Q00S0 00@S@ p-LMP0U`0@s> Rh”t"l ,&00?PUZ00ph[0S p -LMh2t"@ l,6 hw 0-,7PS@Lq₢o P 2<SK01~PPꔭ< Q0- L@P Q 0,7Ss>@ꏩ -`LP@Vm MVK&0@0T0Fh2lt",h•00`lt"0\@h•t"l ,0 @ <cT\h•`lt"0\@h•t"l ,0 @ cT"00C0 mt"h2q @ l,"@ R0 6Tڥt"h• l@ \Th•0t"00l 0\2•hB,0t" 0l \&hBP0t"l 0\h•t"6l \6@Tp&h•lt"2\hBt"l@ 0\@h•t"l ,0 @ cT养2t"h2 @ l,-R`@@0' 6TW 26@Tt"h2q @ l,-R`@@0 6Tڪt"h• l@ \t"h• l@ p\=i:l: 0-Lh@lt"0\hRt"l0\00 5 -LMFTe m H0S6T  ~$0 p0 t@x {@ȸ"6H SH0&4 010 -L MP `s> pR,  R000 00 2 ,0Ru 0S kS 凹W00Y00SYP@@ 0, 04$W 6Y8Q70!"#;81;W0   0?04@W"X"h"t"<0 P0 00P6^0000, x0r00 o&XfS R80 R0000 l:<,<<<4l:<̕ pR@ m x]␠ Ph2lt",h”0lt"@0\0`?D 0`Pp W  ow R '%@ 0d<0t @0% $R >9R ,R& R 00s@0R8 ,0S ,唡\000 R 8RRWd8pWX8R D8R <848R ,8(8R 8R8R 8RVڸ6V1h•t"@@l ,0G*pS񟗩""@"0"@"@"@"$"@"@"@"@"@"@"@"@"@"@"@"@""@"h•t"l 0\h•t"l 0; S / h•t"A R  0-P L$0S0$000@0h0 & p-L MFPT `K?*0P ,0 00P0&@)TD `@D06D ez0H0D0pp6D0 -L MV`U(pK?*0P@'P(,0 0@080&P)U4 `F`zF404 6)z0<040Q 0-PL@b640F0hA -LM<@,P@ P<   BZS.2=6=8  P40 , 0 @  8?}P@ <P4 ,!4 0P`W >00 0c S @1::#:Jc8"}@`@ d=:#:0P*pP 6. \ p:4 <8040P<0D 8 @  }TP4.4 Z@P @ P ` ) 0`,(P8 p-QLM`P 4@QTp -LM04p@` Pn0 ?04i -L M@P0`ps> 4R80 TQx2 RlG0 V 0`0 `@0,"`h0k000P`ph  CH , !@  0P47O1   @ x!0@7 L4 0Y`8P8Lp P 08 0Q@ S00 S4p4P 0P 40T0 80Q@P4T Y , 00 o0000 0`Phs gl:l:m:@-0s>h@ R @;@E  0-L@P-0h 0-LP@+ 0h -LM@P 0h 0-0L s>@P R )P$0 R0=-0 R0S |Q00  -L$Mp%% 0 P D4 < P@ P`@ 0D@4 8 08 44"8  80T ,` X<0<@  |10< ,0 0 0, 14 <  R, 800004 4 0V0@[l0 RP@v8 =00 (0 ,!9 =" 0V0@l0 RP@8 መ00 (0 ,!ᄘ ="40 < 8dpp 88#0 pHm:Tm:WEV " 0-@0P @L P 0000P0H< -LM0s@S* 00 0000 -LMq`PU @ 0@OP6PU $00<0$0@T0 P:00 C@"004;0000 `\ @1@!0 H TlP@00d@0 H l<`m: -LMp0PU  @ {P  0 S X ,0`K 0nPPJPgBhm: -LMpt`P0S@0 0 T@  p0S00@@ ko@ g< 0-T0L PR 0U@ T 0T000@o< 0-D0L@PT {sP @T00<(00S S0S< -0L  0 0  +e)e+e+e 0-L MHP0 @(K00  ,@ x0K# 0S 僖0gtm: 0-L MHP0 @(K00  ,@ hx0K 0S i0gm: -pL0S' P`@V 0PPRPt0   p@h[t ;aD 0S000,0 R  +e+e)e+e+e)em: -`P0LS X@X0p0 0S 0 0C0 +e+e)e 88#4  R00)e 0-L MDP00@K0 P 0 S0 ٕ0g)em: -L Mp0`S  @8PK0S``   0#倎P 0 S ( 尕 zg)em:m:Pკ -LMA@ 0  R @ +e+e 0-1Ls8P@  0 080M00@- +e< -LM@>H 0S00  Q0 0 0S00h+e 0 0P +e p-LMPK@` ~10C T#J0QZ0V0T00S p -0LMSK"*K 0SB$: g -T LM@HT00  (0R Ь<<fm: 00< -Lp`P7@T@ h鷬 R(( `@ pp00 n:n:< -l`L@PTp P 0S `@T$h鎬0T0 h<,n: p-T0LM@PT` P 0S @Tpp< -LM@h 0-pPL0S`0@T P@T00020#J<< 0-XPL0S H0@T P@T000 .<< p-LMP60@`TL  (`0#ppn: -LM@ h- -LMx@0Slhd@T BLP0 @@ ޫ0 ,ث@T<8n:Ln::+;hn:%'; -LM@$h 0-rL@P@ 0hP P0 ,  0PQ 0QH<0H< -L[ P00@-SP@  0P PR  0S0P 0P 0 -LM@Qj  0Sxn: -LM$0p@$0  P`y Pq P O $0S $倓T` PK PW PS  @T P 0@ \  0K0  D1D! <1 R41(1 !P! @KKP00  00`` P 00 0ZKPPKdx tp 0,0 `K gx:n:ff f <ffn:n:n:n: fQ-% fQ%嶪n: fQ% fQ% fQ% fQ7%0 R 呪Rg:n: q%Q0 pg%|%0 И<И< -0LP4M 0X 0T@K@Gt0 Rh@ P`00TVLL00 R 0X  Iff fffl<';$p:<И< P-L 60G;f p-LLMHKP@2 H` P TDK01@ T400 0 ,0( 0 $0 0 DK|pDKP@@PK P  T@P P0p$ P ,p:P@0T,1pP, a00/TU# 9T0pD UA DA Da0DSR `TWpD@T7pD0s" @00DR Sa0D_TS7ToPOPP tPTP P xPXPP@(0PffHf(r:TP@`2S@PT P Wp << -0L Mt`, p0 @–R\ ,0K@T00 ,0 S1051P5f< -PLPM`\p 0K@  0SV 000f -L1L`MD0 PP(0 `pl KpKt KpP 1l R*t0S@hK 0@@ (0S (6l RW xK| K0P x| P@hK0@@ <g<;t:t:(t: 0-LM(P@ 0@?0f-00 Cf -L\ f - 0L0S f -L\   f -L\f -LM$@Tf -L\ f -0L0Sf -L@PMK!P 0Q0SCH 0 U0 RX7PT0P.H+@(<<0 4"Hvhf,t:0>0Up1 @TW 0@H<<< -LM0PhS` /S+ bS` `$pK 0S /@x $ h=$ @PX @ @0f0P,`lSu:%u:f fv: p-L MQP@D00CS '#'#'#(# (#(#(#0 sp-p0 R 0rp`0K0,0 rPU 0S0pD0 R< 0(`$p逛<| 0@@K04 <0 DP`PV8 $0PS U V L1 ,0S <,s40s@0  D  0P | @KD  0@ `004 @K<0 DP`8PH P@$0  4|@KD  0@  fPH00H0 PU@H^@0lD -¢gxw: -L@40P`pDP 00  00040DP 000 -L,MlŸp~, H T0 D G 0@ SO 0@@K04 <0 DP`P0U<0 8 $0PS! U D0HS0T  00 QT01 ,0S x,r0QT@`40s@0  D KH0KP | @ @KD KH0K< y004 @K<0 DP`0P<0 H D P@$8P @KL KP0K 4|@ VPDL0H P0` D H U@Z DQ 0HD0 QH gw: p-LMPa0R0 P0S 0s+ 00 \) 0B0$ S0,0 @0S PT 0 S SrpA$004 0K(0 @@0\,0 ( 0$0P( R (0S@ 0400K@gw: 0-LMP@0q0 00S004 , (0 ,KDP 0 S r0 0S 0P$ $0\ R0P$ $00 Rgw: -LtM4 ȟ 0R `p,0 8 g 00 XKB/ @pKP0|P s | X0 80 sp0  0sT0  0sl0 0sP0 0sh0 0sL0 0sd0 XZX@Z | R 0|0 0H0 D @0s | R 0| =0=  0=0=  ,1S0=0 R- 00\ TpKXK T = pK0 X0KPP RTs Th pKX@K ᨀlQ r |0SG ]PP|  r |0S5 PP| 0s ]Ox Kq0K q0[9PP0s Nx Kq0K q0[(PP30S ]Ox Kq0K30x PP30S Nx Kq0K30x PPop0s 1s p04 @0 04K<0 8 @K@PPZ00S 000S0S=000S 000S0S=0t@t | R 0T|0 0Sl|  0s = vq0Sf| R+xq 0 Q01S00| r 00CR01 x0s 0 0bQ02 ,0S ,dp|0s .@pPP0S( =00\00S 0S U =0 00R00S 0S U PPl0 S0PP= 0u|@qst@` ׻@PᵻUO ̻@P᪻U7Y U |yX0T p0 l L0P d0 h p0l X0 T d0h L0 P XKpKi1D.30|0 )|`@ \ @$XKPPHpK{PPBgw: -LM 40 S`p( 8r 0N0!8 ]_10  10 1 0b^@1H 0k0U30 P1s 04 <0 080 4 <KDP00[ 0p00@0  00b(00  c( 1,0,@000 0 00S010 2@ R 1 2@<00060<  6 070 7 0 0h 0t0+Nx'N|=00(0 S ($ogw:\0S\ 0S 0 S00H -LM\@T X@T - L< -LP@Q< Pp4`D $1P 1P @0S@ IG\0\08@0P 0P0@00H 0@P@0ST0@ 0D<MA0@}fMM, 0-h0@ qL! qPP<0 080< Q00@1 0DP<<ԝ< 0-P0S0P0  Q0 0 0S000h<=0 $!0S 0S 0- @40L000  p:#04 0qcp=@0 DP0 ?R#p 㹭0p0U :00SCP @奭< 00 S090 㛭0 R@R R pfR pfgR -0 `R 0P0pLWt    HnCPl0U =j@8PS(00P B  -LdM 0l  h PD0 Fx@ `@ p` ht 00 0l@8 `0<` @@ YD@P H X T   8@T0$  lP00CSM8hl P@l@`lX1` Sd \  0=S/ p0@@S@<P@ lP<04p<@P`40\ 0L 000K0P@ L\ ` d (g g< g@ g(g -LMPp` @)? (K0vP@ X( H0 (00([00 -00L9$0 .L0 F@ -LM 0 -LM8 < @0 8  ԑp<@T8,0K @1ğ XPU& 0@S`0: 0 A1 0@d$*,0`, p }PP , U 0S0   @0 S@0tp0@0 0tp:3@0P00K P00PH00d0 /0  0P 48<@lP0O, 8X1Sl 0 0 R[040 4 4 4PL0PG9#6!,8 R X##X###X#X#H#X#`2, 4P1d @_R ,0<00S, <00<0,18 ,04,WP@ ,0 ,0!,04,i,x,@ @ 0a4K/Z u,2BҿX0:AT40 p !PU( A 0K0ʾPP0 H@00S(,0P0 lF馿,0塿xk ,dk,P,`< @ g`gXy:dP?< p-<1LM@\`0=S`L RB?   BR R3 P0S&0S V0/0000 ?2΄ !B002p?` `! P2 BP-P  -LDM4 0 0 0480 H  pD 9lVH0@L0 PP0 00 <64&460s4@0S@3 0#2A TL0 bTX TS%T80BPP  `RP 00@ PP@SL`Dcp`0^ l0 4 Po ^PU \d*!lD2!X0  @00@04   00U \F*!l1!e@X0P @00@04 000  , 0 0 0>.0 N^@PT \*l,1 @e00  0000  \*!l0!X0  @00@04 00,00S0c,00,i0C$$$ p-L$M@P0`   K0`VP0Sp -LsM , `Dܡ  ! 1 儀 |` Kp[PPȁ ́ @80S P10*4 ,0S p,HL0 09PPT0$ 0 0PP`@K 40PPoP  KPPC[B $D 0@xPP#[@P2S@ Tw С 0J0C p Dq@!TpAkK1 0 jK! . . R l>K! \33 5 Ƞ P!>Km kK1.0Q@ pb 00Cpp!@Dq1T#[@T; 20CS0p######ȑY: 01 bpnKoK  m?KPH\5 :0\*  b 0 0b$10#[1 @T%0 0;X c$ܡ  }P PfpH0!>0kK1 ̑  c. . j?K!#[ ̑ -g4z: -L,M 0 D 0 ) K3S`@  gP1D RBB#p  0@tP@01 1PP"0PS@ U3 410  h3@ 0 @/P HP) [R0 0S2 @ TD 00KP00T00ST)0[002PU52 0C4 < 8 @S%$$$$$$8K 40K0>01! 1s8 40 !1 4!Q80%000 0a00b 155 1%D R [A#Z@@@ )K@\0 S*d\ZD   D0P@( ) K P 0 ?!0 001H P(`? X,ABLz:< g0_g< g@ g(gPz: p-LM@P0c0? h Ad`A i( 0P? `p p-LMPU`% *@0 PR@ U: @0\0 ? 00@p -LM0PUp*` @0 0000 P00X0#02SP` -LM PR@0:#:S(0:#:S#j&jV Pp  @ Ȍ qΌP00 ``冖P@0  -L$M`. .\@0  @,  @VPp@0P 0  00Pp ,0R   . . p -LM@. .\ 0P p`@@ ȌqΌ  p-1!LM1! @00> 0>0Q`P 1.*!a!00`G/ 0B!0b0!P PPP0Q*!a!00` 10G?  B0 P P0Pp$ -d5dLDM*DH^LLg^tFM+<9뺕4e"#*x# ş0 0S 0 0D 0 `8 R08 P<0 < D0娔0S0 0$@`D0x4 ,0l4 1 1`4 l`X ` &D C< CP@l( 0P,4 $0- 0:N0`V000#3@p@A Q-@Q0@0P K3PK@cFF_Pp00 00"PP@`0*`144,`屠(3 >0L! C"hG^Պ 0S P0S㥑@HPK3F?႑ "@11@T|ExŸ0 @@ @P@H-@0S P0 $"@m>0SH320SPa $09$00 PP 00!A@0q0@00 P 0 @00@0 0X! P Z 0000ZƷ1 jP_0 bPW0 Z>g gd8:%gxg%g<(glgggD<2\z:l%8%g < gPh gg$g -@ LHM0, X 00 TK0P0 T ( 忾P0 S$ \\DD{:T{:|{: -L,0, @j0h` g, g(,e,,e p-LM0!0S`B 00CS0pp1 R!V 0P@ @! 00 041V x0 !0x00S !000phD00S V 000  0@ 000,0 p00CS0l0@0 P8 4 000000H[_g,,ef4 g(,eh g$,e2 p-\0LM`P0P PL0H @^ ,0K (P $@ ,` 4p<<, g( g < -LM@ 㓍 0hrL g -L M@KL0"c11  -L M@K0"c11  -L M@K0"c11  -L M@K0"c11  -L M@K40 0 a0`=R C0 pg -LM@ 7 0hX g 0-@MLLPLLX 0PP400J P@P0@0d<0|:< g8|:x g g@-A"@J1S RJ1S R2PP1S@P1S 0Q *0P (0   -L Mp @(`T& ,00,0F, K3PU, ,0( 0C,0 UWT: ,0P  -L M`0  P@C  0S<0S90 V5*Y/ ,0(p0,00V, K PP ,0( 0C,0 U b ,l:,0V0  0P00` W <@|: -L,M@ @PpL PP`f ,00,0 RIp+$,$,$,$-$-$-$.$/$0$0 S70S4,5 X0*(0P0 D K P P  ,0( 0C,0P, :P   D0*P,0( 0C,0 ,9,0( 0C,0,9 0000  00000 8C80C (0B8 H@K 0 0 00H0  0P0x@0H0  0P 0 00H 0  0S$0<   0H KH00c0S P0`0rP D1    0 $< 0 @ 0 Dz0S u@K $Pm2[S 2[8SS C8S S_@  @0K!PV@K @ K 0S40S00@0K@K 8Ks @K0S@0S@pK $?P(2[S "[R R0 ,0 0,0L 0 R0 0@@ K 0S40S00 8Ks 0S@PL  <~f}fwt@vt -L pq@P? 0aV,00,00000 ,0( 0C ,0'V 0V@ 00T   1 2 1 1s 0T@1 21,8,0( 0C,0 ,8 -LM0 ! @ Q 1Psbp 1 81 U J0!'! -LM@!pPW. ,00,0 b 0Q 1s 1 01 U 00Uiq   1 0 1  -PpL(`0S @ @ -LtM`p됀KP@  0 ,00,0,0( 0CP,0,U 0) 0S@P p zP7 -LMp`PP* ,0 0R,0 R0S<``0,0( 0C,0,7-`$@ 0* j `4  -L M, p0 , 0! P!4  Y !Z PP0 b Vg0EEW  c03PP JB@Dx8 X0  R@0SB4  c03P- 2B@ Dr0 R U  1 2 1 1s 0U 0PZ P00P1 2104 S@ Tp@ T @02020Tp@T < -L Mp 1Qぐ2 A' 0a f8`   f/ RH02 0"2 SA' S~', y0 00202a ,v,0@f00202c0 g00Pf00202S,00000''' -LM@`p PK 0S Szpp1 Q300TLXP0(0 0 R 0S00PP 0 0Q 0V  000PW 00,00,0 0S00PP@  0^ R1s 1 11 ^ PR1 11 g << g gd: 0-LPzLJ@[U(   @00@0 R @00@002P0020@ 00 00 0x gP|:8< 202 -Lp<@LP@  R@00@0 R@00@00\2f@0 `P0 20BT0Ҩ 0 ' `3' ZB `@ZB U!CP L00s @` V 0S 0S ` V 0008 4 < ` V@ R 0s  ` V@`cVڌ Vڦ?`cVV'  0 x g -pL2`0C(2P@U R ,00,0 ~PU@Z000Sl0202S_PZ PU4Q,<Q|hLp1p!@P@dDFA@04 S`ʄ1d8A R<0 <000<0 <ۆ<&0 @P@dDFA@04 S`ʄ1dA R40 400040 4ᵆ4'''0x g< g@ g(g -PLMP`= Q ,0 0SW ( M 00CS 0,00C,0,0 S( p,@0L!p3,0Sʸ0  0S 0S@ R000  00C0K@p0K$8K @㲂Kp@ 0 㴂K4,0,0C,0X4p0K$8K@@㲂Kp@ 0 㴂KX|: g< g p-LM0@AP3 R.`P(0K$``0KaK`P`01K!K 090 0 p 0 0pp`aK0 90 0-p p (("\ -LMŸ@,p \`P 3 R \0R Pl U. U  00S# 0s 0P  00 0101 1s 0Wp1 21   P1 1  0Q P 10 1 1s 0 W 0pV ` 1s 1 2 1 Ve1 211 21 g p-LMP@` T0 @ Tp -PL(p`@0T 0@T  0-@MLDPD 0<PH, (@0P@H0d<`|: gh|: g -4 L014 s$ 08000L<40$ 0S00 Q0 0 0S0040$ Q  p-LMPP` 0@ 0\ P 14` 01! 0 00 10Q p,0  g(04 1S01 Q0 0 0S00 p-LM,P"@000R R 0Spd,Kf 1:0$2K1,` 2K$P  P000(0!0 (0p0 0 -LM Kp$ K`PU0  0 00 0H@P@ 0$@$  00S0P` (00(0 ,00C,0 (0,0,2 g0< -L$M`8 )P 0S ,00,0P^P$< B @ P !!@4 " PP?4p P" @0 :0GPUp  0<S< ' 90 P   0 0 B 0 4@ W 0l !S <Q8 P 0 4K 408P0,0( 0C,0,10@K PP@ -LM0pS,p @`PsJ ,3Y 0S8P < !4!0QU 8C(0Q PU 0v v UB 0,0 0 0$0 e80` P (00(0* :  (0  (0W  , B(0` R0(0  3(00(0 GPP( W`4p8 ,0( 0C,00p,0 0 p p00gP,   ,1 0,0  80  0Vq1RnU rmPp ,0 0 ,0 00R]*40QUY 0V PUR!0S |< g -LlM Q$P  S& 4 P,/A#bl p p@K \0 0  % 3Pjp X4R P$002c2c30 xKP t0p $x0P 0p 0 =9@ =C  0p yp\`YQ# 0#00F0]/HYAp0Sl0S x@Kxp0\0 p KK| 0cPl=9 A = | |0 2R"002c2c30  Z0  h0  !!  l t0Sy #Y ` 0X\0  h0K0`0K0 @hK R 0 0 00  0T m (   ( 00C0X` R\0\0 00` \0 с1G 0`01 ' 0 (0 0(0 00C0ZH᳁ " q  ǁYp ` 00 0 @(  ( 00C0咁800 F 㣁p80 P(00(0  B v X, Z ⌐ p l MbQK/K KT1 l < dQ 0P 8P XQ HP Pp*S|H0P `: D@P R   R? 0`SDd:d*@P@d~DFA@04 Sp0 1d1 R D0D0D00D  ~H00H0 D2PUp H0#KPP@f7  42 Pp?KP 0"RX 4" P42p` ?WpWKH0C0Q=8QL" 0pw  D8P'zl? ,06,08(@P@dr~DFA@04 S`ʐ1d1 R 808 08  008  <~8 8C0@ H0 D"0PT2 U 7  42 gPp?KP0"R T" T" 4" P42p`P2@f G0 `R T< 0 P"0100b0P 0S42 pw !P0 2h0 P 0d0K>0#60`00\ 0. "&0 P0>0#60X  T00`Pp;42OKcT2( 2 K P2<$P, = P& q |1S0# 42 y42  0> Pp fp@00@0, p0) 1, V  RD ,07,02 ,0<,00  0  ,0bD%P'y@CL"p 0{Gz G<,0S KP:< H2 K( <P.,0 '?l 1S H R < S <H0 3  @0S@0[30@0S,06,0K < fl?s  ,06,0 5}@>/0 00000 0  0\|~ Pl ,0@7<,0L2` 0" 2 0 " 082 0S/KK 82 3XVPpH:/F K⿯PpD 0s@ Pp#H@"D00D082帀8"82<@"82$ 8(00(08",00C,08(0,`VŻ*<; 8@հ!0Q68Q )BL"p 0T'PxT@1@!@P@d|DFA@04 S` 1d1 R 808 08  008  [|8 A< 80R 0R0R,070H,0^*zD00C +?D} hgD1@H0S!000haC(, P |0S P0000DqخxPhP Y j >H,0(FG:!$ XEx'g%gggPh|: 0-HP@L@<08 S800$< @P+  R 0 0 0 LPP0P0P 0/  00CS0 PH>D 00C0m0>*qx'g%g<#g -LM,0@ h8!N -LM8@ $0 @@@98w$ -LM 0 ' -LM  l  \ \  @@    0 0\$  -LM`wP@UD ^P, ^ \\)*P#HzC00 U  t0S: p0S*} 0#0C06 uP <@P000X(1@II( ;  ]*x Y*0,0,1 1P6, ,0  0 , ,0;0,0 <  0@ 000 !R !@00@0, [, U e0000GD1 Q ,0,00,0,0040 ,00,0@0@0S@ @0D0,@0@D0,0H`6,0T0@PSL0T L0P00TPl0T0,t T0 P0t `P 1D0S10S1 ,0L @P#T@  0P@p,  8 D0 0000  t 0S 67cAP@,0  4 H H40RX088QwC00S 0 0P 040 !R8  00 8 < 0 0 Q40 0!<  w)  r) w@2  1 pw1Gv0C1 4G"40,S000000000QP4 R ,0 @0 <"@[$,000S ,0 P4 00 s *!140!0400v/ 67c@Y,0 @0 0000  =, 0 0000  / 0 0 000  $,0Kp$?y,x0 G<<4,e!1S0110C1!R0S0S00C00W 0S  0 z0Sw 0St  0  0S 0S R s R s090 `0  P090 0@ P  0 0S 0SXM0S 0S0S sgpp@ ,}:@H}:l}:}:}:}:}:8~:p~: -LM0@S0  !p(B(~?0XTw?0 0S 4hm?(j? e?~:~:~:~:~:~: -1LMP`R P_PS PMPppAsQAgA, 0@S1 V0>0nÃ0g`ƃ. Bl!l00 0L oPP nPU`V 00B- P"ʀP P P80B`PK8 @8  0`@ \@ Y @P Pʄ  P|  P P Pd  P\  PPL PD P-0Ь< gX:@ g g !g!g"gp"g"gP#g P>0à PP PP @P@ P P   P   P  P P   P  PPP -LM0@ ;Ph? -<0LM   @)0Sh,g -LM0@ CPhY -LM @ PhI0S00 00 -0SL M00` @ p(P|0 P  0S 0 @ 0 P  #g$8 p-LM@P`@V0D  Ppph -L$M00 `0 P43Q&Q8 , 0 p< 00 @005000"@0000<000p0D`40,p0 40 S} 04 a Rq 0007 0@ D0 D000$;T0 H 0S8<01 0L | @ t2Lx p@000P<9L8u;::21:Ԃ::Q:L: -LM0Sn0Hb0 R 0R  R RmPPw 2nP@g ^aPT T 10HPS 14 T *N90nS& aS @0(T00S1@TL1 h 49wS0S! P$$D1 1U4pP,0p0 R 0S΄ 0 9 09wP 0d 08|8x8t8pi8p:%ggx:%g:0!;l::::::::$:,:<:H:P:X:`:h:l::Ā:::`400H400D00 0-LQ@P 40Q P DD1 R 000D 0-LQ@P 40Q P DD1  Q 0 0P 40000D000,0700 000 0-L0\0P   0@\!:P@0 p-LMD14@ Q ` APU  p4K400p p-LMP`U6P1 40P. P@ PpDD1  Q p,0  0 R U4P 40U phP D1  Q pD@p -0P` QL@p pT  {`X  tWV  -LMPup@`S 0UP u 0U 0 U 0U P>v 0V 0 V 0V P-w 0W 0 W 0W Pu U SPPv 0V `w 0Wp,0<,0v 0 Vw 0W -0P`QL  @p pT  `X  WV  -LMPup@`D 0UA u 0U 0 U 0U fP/v 0V 0 V 0V UPw 0W 0 W 0W DP u Pv i`wp,0<,0v 0 Vw 0W -L M|   0\   Kq@ T00 0 T -L M|   0\   Kq@ T00 0 T p-LMP`@0S ( T 0T 0T P0T P T DA@@@,0<,0p R0Sp p-LMP@ `0S 0T 0T P @,0<,0p p-LMP`@0S ! T 0T 0T oP0T fP @@@,0<,0p R0Sp p-LMP@ `0S 0T 0T <P d@,0<,0p -Lp`@'PPUK!P P,0<,00 R*0SR:0 0S 000 ZP -LM-P@00&g 00CS0 /&g 0-0LSP P @,000 0-L@P P000 0R0 D1  0-LP@P0 0D 1?P,0  0"R   0-L0QP)@1 Q 0P P0@ )T 0D000Q^0 0P |0 Q P 0T@PD P ( 0@T@PP2%g -LM0SP`p5 S P@ T  <@S0S0 0@T 0 0 S @TW pPD @T   @@TpP%g 0-LP0@^ \ 0 0^ \0 0\0T@ T@@ TP 0$0 @ih@mHh02 p-LM0(@KP `~P0  p0 -QLMp@G P0 S  0R`0S  0RwP,` Rڐ0V 0GSHԻ$Լ$ܼ$ܼ$ܼ$$$L10S0S0P 0R W   Q0 PQ0ba>0>0  0q0ab0PP0<@0 /000B0 PԬ<ܬ<< <0S  W -L$M@ , 0 40 g0 @@0Kg@K@0 0 @0@0 ,@4 00R000 001@K\1  0OH PKL 0S@#-Q QPn`3% . p0@R/ "M2 0S @##mSPU`!q p0奎 @K3'  ,@  4X 8< @K@KP à ]C@TPa`~ pà &@K( 4@@K @B, g< 0-LP| 0\@ IH 0h00H@0@- @P0P=9@ =C 0 0P=9@ =C0 0 S  0 \00Z0?B p-L Mp`@PT 0X L+@ \0 0 pP*00,e@(g:d< 00CS0,@(g 0-PL@ f0S  L000@000afp0h \0^ L L0L0lS RL0L0@<<: -LM@ Wf` `00CQ000 0 S0  0S00%fh<<:,0 P L0SP< -LMP`p P@@ 0R,0 j<$$(0 R0S R< - L0 >P0d$:: -LM0S7 䀟` PRp@ f  P` RU@ 0PSU00000  \U@0S S6 $0D! 1 S S   -1 0140S  D1 RHV?,  `P(+`V `PH`,  P 0@$!101<؃:, H*010,  -T1LMP@0!q$@ !$1!S0, 00 ,!(4 01, 40 00 R`5 `101$1$  $!1 ,1V 0,1 0!(10(101Y`0<  < $Q001$1(1,1400 ,0  0 og< 0-LX, 0*00D0, !@P 0h$0$PPZ< -<#LIM0,  ,0 Pp  006:D R @0S Ÿ,0 S ,D0  00 D@K |"01pL,0dK- 0 @ P P` d@JK 0P`80S ` {0 Ȯ@IV Y, $16d JK}CK 0+JK 0T!L000Y/bL70 pK|` $t` $1|K\0 (!T` X 06P0 &L  Ơ0H P` 0vP`, 7[` pP`P`S, @ (0 RK:g::_gZ< - L~N -LM@P`pT0EP@S`$h$h$h$`$h$`$`$h$h$h$h$h$h$h$h$h$h$h$h$h$h$p $ 1 01410g4 1S01 Q0 0 0S00 0S 00 0 P -QLp`0S @PU 0 0C W0SUP!P P 0 e00 0@epe0 SP 0 0S ]  0-LM0PS- 0SC)@ 0R0 0S S 0 B0 0@0@ 00 K` "P 00 P0-LP@T*@T:P 0S* !0S:0D00): -L@`p PP0 Vp P  00 00S0@ R0000 0 [ p-LMP @T @Tpp@T ` R0000 0 V@T0 0- L@PP( 0 S600餭< $0R0000 0 ꤭< -PL ]Up ``@T @Th](`@T @T꤭< -@ML0(( I@p 0I@j,g :*g: -LDM0`SP\` p} 0B Sw!XKP@BX00C Se<$$$$$$$$$$T0圡 S PC\ | fP@`!X)\`0 \KA0TK 0 @Q X HT  Q  @ V\ 0UP@  *\K SP@`\XTP-D@aP@{$,g.@'$A&$$1x'#5' -LGM<\, P`p @ 0B9S9d$@$d$@$@$@$@$@$@$@$@$@$@$@$@$@$@$@$@$@$@$@$@$@$@$d$@$@$@$@$d$@$@$@$@$d$@$d$@$@$@$d$@$@$@$@$@$d$d$d$d$d$d$@$d$@$@$d$,0 S ,0BES񟗳$$$$$$$$$$$$$4$$H$D$X$$8$8$`$$$$D$D$$$$$$0$8$L$L$L$`$$$$$,$D$T$p$x$$$$$D$D$D$@$H$d$l$t$|$D$D$D$$$$$$($D$L$5 s55 5ş 0Xşş 7h0 0K DPPW 0S0\40Ssp0|jğ0 L@P00W00SP4 D0MK 4 41P0G@C ᠒>m:04,4 G0ğ0 L@P00W00SP 3 0u 0p3cßqßoßm3 ̠|ße 0[ 0V0 S<0U KOKᩩ HPP3Q 2R  04L 0@82 2 (2 "0L 0PX"T"P"(2^ 2R  0kL 0T%ANK 08 QPP8!0BSR L 0@wx!t!p!l1 Ϡ7L 0eL 0^L 0W  0R 0 PPUL 0?-= Ag$:@:@:l@:<< <*g+g*g0,ga pg)g,,g@:0<4< @0.10S1t 00K z_!08 K0 2, 84001! 0nO 0rϊO 0vO 0~oO Ί 0O  $0冏O !(0O ,0O 00O 40O 80O <0O @0O D0O HP00 TL0@!0S,0 =9C =C0 ,0 , 00 2$"0 10C1,0 N 0$P!01 !0@ L1@1  00 00!!00  Q0V/@1 j0023Z6?B1 -QLTMQ0DSP Y 100CS,0   V 0 00  80K`0 \ H D T P0K =p`KX @P <  XK9OP`T   40 T T4,0p p0 8 0px x t 1p  0APd l 0xSv*dKt zP`sxP K0@@ h0K `0 `0KH \ X0 T D <  XKNP`[h0SS  PK:#:Zc0 `KX `p \P T HP D @ <0 XKNP`@P@*0S @T:0l00S0*d 1P`* d0 T h0d 0h0   `P` pd0A0 d0 p x0t0Qx0 t lR:0l S: ` c0dKt d0 `,0  TT070- -LM@ +Py0S| b PU ,pPUPhPa2x"@`@  @L2  P@U`@ p ,0"S0f": <,0 @ ` 4 8  @ 0H $ P ,0X 4 ` <0h D p0L PTpUV00PC 00   T 0PU ` ,0 @4 8 0@ 0H$0P ,0X40` <0hD0p0L PT`U*gQgQg<꼭< 0-L  01 0P Q Q0!01 P01   N`1`"0 0R  0!01 P 0 0 0@420&0K 0R  0!01 P0 0 0@8 <1 0R  0!01 P01   @@T@0鼭@1  D00D00hJ}g1: p-L1 M PK`Xl 0PR 0  cR=9a  =  A 0  0!Q=9A =C 0P0 R0S @0S0S 000  dp 0R 0R 0@ 0Sgg?BPh( 11 R00 PgxPg -LM10@S`3%h3%`3%3%3%`3%`3%`3%,0 1 0S,0  >0Sx x000hh`,0  V?Q1A 11,:Pgfd gD t0< 0 0S0#0(0 R0 21Pgfd 0-t0P0$S$0#t0L I@I01S0 Շ Ň01@-@@@@@@0 00 00@ܭ0S,0S00S7  0PS0U 0S PPp0Si0h ~0Ty0S <s4pp0"<\:x:l::: -QLMp0 4 ( ,  0  Q0$ ` V P0S 0 S 0B8S$P0S`V0 R ,Q $0S PP0',`#@08JC8 1!Q4K 08SVQg<:Ѕ: Q-Lp 0  Q0`V @0S 0 S 0B8S$@0S`VP08JC8 1 !Q 08SZ00Qg -LM|P04 H0( 0 `00 ,0 $0 JPp0CHAA0P4K 08S,@0V|D 2S00S \0 !R Q:(:`:h::::: -LM0`<K  ,0 x @0Sj 0S-aP g,0 S ,nA0S S: $@0S R 0X10  0P 8 0Q 1 U1S RR 0 R <Kd90000 0S Q0 0Q B 0 R00'P g:x: P< Q$  @0@0  c  Ba  @0BSH05 :P @ B Q0 : QHS0#03 LR0S4 L0d0f s  *<R0#03^0S< 8@ 0P L<0 0Q\8@0P  000 0zP& ,#,0 m0@4 L , h: -L @`PBpF PI \*PB R?T+ 0T! T U *0DQ 00 pp00010D 0W d U*00 U R000 SPp    p:: -LM0@`p& PPpU 0W PP  P @R000 ?WP$(@?T00h:Qg p-LM P@* 00  00 R 0  @000ph?`h |?0 p0 0S0 0  @?` phd?Qg -PL M@ L 0@e @T  ^ @T % 븉:܉::: Q0-L@0PA 0R x0 0 PR0 R P P0000 0S0SS RRRga0RgRg-0x0 R0  0^0\\00 0RP00Rga0 R00Rg0 RgRg -L1LM P@p> 0R`) >000\ 0 AQ 0 `\ @1@!T P` 0Q 0Q`0S@0Tddd @P` 0R > >#RgRg4: - L@P>A@`p 00( Sp j>RgRg 0-1LsDP@   0,0, 800<0n>00@N> RgH 0S00  Q0 0 0S00h.>Rg<0 A P 0-0@ LRPD0y0u 0hR00,000 0RgRgRg p-0LMQ@, 0Q 0Q p0 p` =0 $PB=U0 PPx0Q p0Q T 0  0 0S$  00000}ff@wt@RgRg~fvt00  -LM0@ S#Le%e%Xe%`e%he%pe%xe%e%e%e%e%e%e%@e% =00 b<:0 S {= 0-0LS@P00 > 0R03:00S 00 0 0P000 0 0 p-LM0PS`  0R:0S00p@00@0@-,M@ 0P000^03:0S#\ 0^ *00  0S   @00 00 00 0000,Ѝ0\ 0^ : 00  0S   P0@-0(M @00 Q \ 00  0S  0000 00 0000(Ѝ \ 00  0S@0 p-LM0PS0`0C0D0< 0bD0 R000Q  0S00``80 0C 80 ph h0p( <@ t<@-e -LM `@tV`Pp0S:000 0`0R0@0 0WpUP@} 0  40 Ph 0 `0L 8,0d$pT`DH000P0 RS 0 /">CXh05|%03h05 5P%(PB2|P5p% 7`(2`=0<0`7PlP t0RxPPPPPPPPPP 0PP00 X@@XP0\0 @X (0 Pe<<L 0 P] d p0S000 Q0-LP, <@@D ,0R0:0 Q0-PL <@@40 p-LMPH`Q`3:Qq 0L`` <@@4p -LM@0T`80  r@T,K PU 8 00R8 K @,0 d@4 $0pLc^=9 =4p 0 00 40S"PX8P P R000 h0p 8PU 39@09D0<,0lS:\<@-e -LP`p9@ h8 0-LM@PT $ 0@T0Ȋ: -LM0SPp` cSlSpS0`S(h@ $0`@T,L<D H0V 0Sh 0SL 0S00S7X h0( Z% X"  0,`V  @P PU@Z`VXXH:(:4:h:::: : :8:';L:p:::Č:Ќ: -L* 0S pgu;(: -p-LM P4 0@``x4,0 \0 Kp`Rg -<1`@P,1Pp  U00SL 10S@Pp00U00S&$10V00S VV 0 RW 0V0Q00Sh_T0n(PW  0U00Rgpꈮ< pX00Y00S & h  Brh T0 \ @fT@Dp PX0W0  X0  p X00Y00SP  T@Dʭ:X ,0S ,=\@fT@Dp 0PX0W00  X0  p X00Y00SP  T@Dm``  [cT ` X0p 0W@0X0  p X00Y00S  XTX p X00Y00SL009L  .,D@K(0`xD0[Sx  p X0W0  @X0 pX00Y00S v 0S  x0@| Tx0  @T@D o0@0` |X Qp <, W@X Q p X00Y00S F x !0B^SX00T  X0 4 pX00Y00S + x0 x0 !0B^S| x@Tx |Q X  >X p X00Y00S    x !0B^Sx0 x0 !0B^SwD@K%RD@K%OTT@ 0 P`'0 0 P`!`\H 0  H0 `0 HT T 0 0 SH\0 ܥ0c\0 H0T T H+0 H*QH L  L@00L S H L1H 0 L0 RL 0@C0Tppx0 @0Tpp000 hHT0 0T0 b@HL 10L 0 B0@C RH \@ YTT T  m 0`00 Vb WT0dp 0ãT0 d00Q0S-0KP0  R0 :R x3P0 h l% >P &B`PbP P(K 0a0Ch0 1!`PP0aP T  00S000aP V0 P00cP0 0 `PV PP000lP  U- Pu`` TT @ 0 Po0  PoTT T  0` ` wT00   T@0 00  0 P`P`T00T0 T  0`  T T@ 0 P`0 0 P`l T   0`00 T 0 00S T TT @ 0 P`0  P`0DK P 0 h0 ` D Kg0:8:@:H:P:l:<::H0T @H lR H  TT0 0%T  0X0/ T 0X 0 T@ 0X 0 0 X0 00Px0L0  PuoL 0  T0P` l 0x T0 L 8H  V t0S# T   0`00 V0 S -Pu`` TT@ 0 Po0 0 PoR, T"x0 l L0  0` T000S T Vn-0Pu``0 iTT@ 0 Po0 0 PoL R D0KD KP0 h ` t0Y00S00P0 P 03R W P  KP PaPh hp ` Ph l  S -L: -@LM\q: -LM @pT0T)0P w. @ 0` 0  00M.00@- 0P^c: 2#80S$H*,0 9,00 0f -LM,0P20#0R0Sp` 0Qc : <"K#80S $H:@@P0S 2[02KķP şE-Ƞ@0Sp0 p `P@ 0@s  0R0 s$0@S$P10 R$0 @$0@S 00C0x<<000:SgĮ<Ȯ<(Sg000 Q 00Į<Ȯ<(Sg< 0 S-L< 800( S $S dh`u;<:: -t0@LMA \O0S$%@%L%$%L%,hB$@h<x<;u; :,:: -LMA0@Q!ڀ!0Qx @ ^d!00^G@HTHi0S" hPK᧓h`0\b 3` KpKl 0pcPl=9 A =p p l p l0 T2RHL"002c2cs , P@ 0S @0,0"F0@ T t@,0#T@@0T,0QQ QL@0KPɭP| 8P@T| 2P@X| ,@ϑp\ d0S`K 㡩P@`KP@hK/\ d0` h0P=9@ =C` \ ` \0 \D| 儩P@Q H| }P@G L| vP@= @K㋰<0K8 KH0 40KD X0 0 K,0K@KT P0 L )TWgQ<ܖ:PWg?B -L$M, ,@ p8 0 4 < H H 040ZD 6D2a0S0CP8c% U#P@,  ,<0,0 R,  1@ 1 @ 1,0( 0C,0  Z<0H0S<0 H 0@  l8E 0-04PLS@ SP0鸰P 0R0000PWg 0-@LP 00PP0  x0@R ,0@@0,00h10S BS0(0  PWgTWg -LpMW,0 P`*0 S0!P@  ,00,0 ,0( 0C,,0 0Sp`VP:,0p[p 00 -LLM0d $@0dS0!ph WH0Kp0  Pl dl p[PP *p0 R0:z 2 PKBa2a11J"c11L0 P &P_XKёL T0PX04"PP L =9@ =CP L0 ,0@0`,0 h0poh 0S>z" XPK᭑XP0\Z 4PK`K\ 0`cPl=9 A =` ` \ ` \0 d1R@\!002c2c , P@ $0S @0,0 !F0Y ,0#Y@0,0 y Y pHKP֫ d0l pCd pl <PݏL T0S0L0 P0  +p H W0SD00CSD0@0 (0+Q @0$Q0S WpW Q @@  81Pt N@0@0c@(⌎0@0<@0e p@ < @0^ <@0Y*0#p@@ 80Pt @00@0|| 0Pp@0 p@0@0@0@0<@0XWg::0Q$ 0Q |0Q 8000T0Q L0Q0800S@0@000@0}ff@ s@~fs -LM$@pA`p0 -t LM0@S006>|0 Q>x  0,0CS0 p||];p05  R @? 0SU 0S 2 )U}P ^U~P\U; A0ES P  @ P P  PUpU p 0UZm0 "0p" NU WZ x ϴU WK 0xU U U|Uu 05 00  (0r05^ UZ   ^;8p09` (0S.@H 20U0S 6 =   y0PD 0@$  $ 4Xg 0; `0HS(&,&,&,&,&,&,&,&,&,&,&,&,&,&,&,&,&,&,&,&,&,&,&,&,&,&,&l&t&|&&'A0H\XS X X"@0`HP``d0\0d0 P "30 X00S =S  0@d 0 d H P!0?0SD&8&0&L&`&8&X&QA0 0(!)^  so 0@d 0 d  0=`H T PPT JO  L-0c Z0 =PH @ 0`0Od  d -,Xgx8x; -PLlMUp` e9U9^9U95Z:D| 0S , x0\ (1$1F0S 3TT)T9@ P@ ,9U+ 9U b8UY 9U 8U Ip0;p0)Ap0;8U 8U6p   5,0p  D 0S 0S||^ ^^ 00CS0 D 000D! 0|0D!x D1 ,00,0|P@ 7U; 7U 7Uh00X7U! L7UD1| R  PxP,06Ur  qu<nH0pm0&0p" yt6U7 ch6UU -6U P6UF0Sp0p000p0`0 R ` 0 R D1| R,0 h 52&@5U' 5U5P lU*h0U [deh02 P@hP" h0  (Q4U 4U 4U4D1| Q_,0\ P 0SxPx4U :l40SX40Sn0S_p 0   P (0$0( R|P P?3U ,<R R 20 0 0;; 0 0 2  |`(p@ PKK020 ϱ 0<p0 P@WP@Px2U@  PC  :x H:~t08t0 @8t0  t07t00@t08t00 t07t0 P. q0S S p0(0(S" @0H0 1P pKl p0 LP D` yAP@X `c0 `0Yf@ `g``GT  0X , ݧU0U 0U 000St{t rtzt ^t PgЯ<t,@ot t t at nt T$gst@f@t@[t@wt@ht@dbt~f}f<t0S00  Q0 0 0S000hd -LM= 40 @2< H >Pd -LM0@  (0 P0SM0 p-LM@P`H0Spp% 0  0S H0Spp 0  0S p, ,0HPP p< 0-L@PP 0 p-LM@P` (Q,Q&p0 >;-p0.(phxp0m h< p0ŒHQHP኿HP(d "꬯< 0-0(  SL@P* Up0@0  (0Sژ0  P HP 0 0S0Pp0@0p0p0@0p0p0@0p0 0-@L0p0P0p00h  -0LS0 -L _N -LMp@  0 Q   m0 ̌0p"V0p 0qH RRVHX  L0^ p040p0H0Sg :< -LMp08r `4 ,0 0" p P(0 %  0"<#<3;8 8Q  8002 ,0S , #082 "|0D R  XR 0U00H0 S.Xf X!ڜ0PJH =P`00Ÿ=p0Od P d eʤ0H0 SXj XRH0CaH0P S0"p!p1H8 X8"RT040S#Lg4!?0PX]P0pHH0 S R1#K GP8  ^, x x0Pu 0r p(1m$1Vj0S  L( H0PvP8 < 0Jgȯ<:g,Xg%p(Km =UP@ ( P@0p 5*0p -=`b0V``V=J`VZ0@   p0  X:p0\x8 : Q0-L@PA  UPE0 -LMPP2 l (`$pKP@ $! P@`P@ $ P@p0:p0' 0>0= 0-p0@ 0L50 "20#0 P0S @P 0P0PU00S P ^U?@0hU0 -LM@Mp0 t h%x忪0s S0s-t0 A!`?̠0 S S \h\ !h3 3#2 11>gfffON -LM`{P,"0$"111;/"b111A|0St xQo @TPi zPP@@T10S4 S1 1R0 0lm$K0, KΤ HAN=0S 0 $00!0 $0 q?B6c$ R(N=0S(0 ,0 0 ,0 ( (0?B6c, >|01c1 @R  1P2;P 0 <0/0"bT# uDThQH:X:t:::::?BHhė:З:ܗ::P0@-0 1@1P0 SR0C BSRP 2P# 0DS00 ER  R R 0R0S,  ,00 4 40R0,0 R4 40R0Pt t0RS p-LMP@ p0`(0(S U  & p p 0-LMP  0NᗸP>T00  DXg(Xg p-LM `P0> S@0B0" d B› ( H P00 D @000 0@8p@ !gDXg(XgD& - `0L0C0 R 000  0 (H0 @P: @dDFA 02b Sp>L 0 S0``00`h R(XgDXg< g@ g(g -0  Lḗ0 Q l00  (00H >1>1=1p00|  x0S0 0h0$0(Q(XgDXgLXg -LMQP`/00CS 0&0&0&1& 1&000 Pie-p0l0h0PpT0T@ 0  p+Ě0E/>1 `W>p 0 0P0  嫚 -LM0@S0S000A?┚>厚>y p-LM@> 0`SC 0^P` a/.!0AS1l0PU00\  p -LP` Vp&0S 0\@l0% @l T@ ᳞00S 00`d d0Vp 0SS 0 0 h0 -L@P `\p U/ 0 ` \L ?>1A 0S>0`Q \L0 Q` \L0 0H`F V0`b 0-@LP  U000 0 UR 0 S cc Q0S00 aPa 0U  RR  0hY  p-LMP@m  `R8 R0S* 0 0 0P 0 @\    ?>1 @  0 0Q00  0' p?>1 @ ,? P0  p:Rp@-@) 0/.PaCPL  10C00&0b 0R000 Rp0a # B0!00p?>1 A! p -QLM`PpF R- R0S1 0 0V$ R! 0 @cR@cT@ }`dPp  00S 00 0V  R 0 A( P0 :@-0@S 0 00\S Ch0P 0\Q 0 0c/.!1CQ<0 0e@- `0R   00\ La/.!0AS1@ 0e p-LM@P`PP 0 S0 0 0  l?>@1^!BP 0S2\0S0 0p -L Mp#0S# 0S 0R p @@`KP@K  -`,0pD1P LP@U @ qX 0Z @z\ -LM`,0pD1P HP@U PX 0 [ @Y\ -LM`,0pD1P HP@U /X 0Z @8\ 0-LM@,PD1 P \0Q T0Q  0PZ0D1 Q 0,0000at qt @-,0@D1 00S   @Z@ 0-1!LPS 0 0S-@ T* 04@S!T:PU R0 0Ո0@0@d@ ll LP0h PXg<̱<< d@[g<[g0eTXgC&8[g0exB&,0 P 0SPPXg -LM@P  P*0S S 4P: p-PLMP@` P P* R T 4P:p0SRV`0Sp -LMQP@!P P P U \*0S 4\:*00S E 00*Am鵊 -h0LPpU` @ T*0S4@  T:PUPXg p-t0LMP`U @ T*(04@S T:PU(0ph( PXg< p-|0LMP`U @ T*$04@S T:PU00(0aph PXg 0S 5`1P1l0:嘡 00c|0 S01W01R@1@!  00 0 d dR0 0pd0 UX XP 000PX%@P` 1 1 101V 1@  @ :)01@1 0$ 1 TXg\gtZgXXg Q-Lp`1; 0+0S6* R3 0S 5P1`1pl0: 0S@1@!  00 0 pd dR0 00 VW W`cP!000Z` W@PP 1!1 101vU @$k$ R 1 0 +10 ,(@$g$ R 1 01+00 (0,0 40#s:0U00SL( 0S% 00#0X00S 3S0 @P`PU7077807xƥUi  Z00R00SxU^ @04 p< 4p4 5 L 0P0P00S 40  70778s0x7ᑥP 0RS04 0070778[ 0x7xLWU @0 0S 40X`hd 0Sh4p<  R< V14  4 40pPD @T L0,B0aT L01000cT00P P0P P`P0pU XhP%X`dh T & 10C1) 8Q<0<0< 8 0 10 0`0凼T`P (0S $0, $4!$\p8D0 ڗP P8 \ H R WX`dh T L0,B0aT L01000cT0\ @0 Q 0 R  P0`0 `P>@ 0Q 0 R9 $@ 10C1( 8Q<0<0< 8 0 10 0`0_ (0S $0, $4垃$Pe T L0,B0aT L01000cT0,\ P0`0L`PE"@ 10C1( 8Q<0<0< 8 0 10 0\`0᯻  (0S $0, $4J$噻L4S  UiU 1S, 1)PU 0 9p0 SRk  407077L$8Z 0x7ڣ#PP4L$  0@P4 0   @Pp Q! ᨖRpZ00W00SP PU XXgtZgD[g p-LMQ@P ` Q p T  0pQ -L0ML@2 p@022P021d`2022!LPK0㔅2[02(0$0+0 00S80,2< -LMX`p,0 P \ 0 S*U ,0K0 0R ,R "R RU 0S0 R00000 \ 0S ,0K0 0 P R R@R1R8 R R  R RU 0S :G@0CT@S&L&h&|&P| 7sPPPL0T@0P0T\@\00RU 0S@000 00廇04  ` ⴇQ!k401#8S#00Sd0W  H0WS 0S 0S S d<< -LM^P@p \ 0S*p 0{0 T` 0 &T T T 0 00`T@T  TT  T 0 0000T8 0T  T0T 0T 0 P 0T 0T 0T0xP 0@T0 3 003\ << -LM@@ D0<7l@h 0-!40r@L$ r 00LP<0<080$  2$@02 0|P<< < 0-40@$PLp0S0p0  Q0 0 0S00p0S7070hc40$ L 0  191# 3S,000\0Q 0-40@$PL\0S00  Q0 0 0S000S:0:0h(40$0  C0LS 0 Ŷ  191# 3S 0 ,0 0 0S 0R40$# P0 00   0-0P; 00  UL@  0S 6Ld0S |0h[LS0S 60h閠 -LM0@00 68 Ǡ|6L30S  -LM0@00 6. ᪠|L0S  -L ML0H 2cC0Q0^, 00 m3#0 SfʤضPD 㷂0 @P@0@ <`0 3 @pDP@P0A3 <` @pD#PP`P@P@ @ 0 0 @ 0P, R L 0S6-0,@00  0 # ᛷD[gQ\gLeP@0K (0 ( 00(0 :@T0 (0$ ((00(0( ,00C,0((0,,00P|鵛,1c(fꐯ< 0-LM@ KSPUK0 0PP  ,00C,0(0, 0$RPk 0-LMP K+P@ 00$S @,00C,0(0, h -L$M0`Sp  ,K{vP@0K P@ 08 A00< $P @T   3S#@M 3S0@3G 4 PD 00 ( @ { 4 KdP@V40pu0 p:l@ 00 0 00! 00$6PP@ Q% ,  0R,0  vP@ 4pb0/f({<8,0( 0C,0 ,ޚ,K yv@T0 (00(00,00C,00(0 ,ȚPD 3 0R3( D (00(0,006 , o3Sr3Sp \ 6F 0 呙P@3Sa3S ]5 50#YM됯0c0Q P0SX0   X RX zsPP)X0X0 XK osPPQ `V T0S*``UL 00@L H /L0,  B, L(0 PPTP,◗ @ V05@1 0305 ,s0 S@`V00PU0SX0 `cPP 0-LMP KP@ 00$ @,00C,0(0, Y -LM` KPPp*0 SP 0S p0pS$W  ZrPP 0 0 0 $0pPW  0,  B, (0,7P@Pm$$ R 1 0+10 ,P(P0C& 0S0 0000@00x!xQ 0 0SdP D1T!0Q 00ph005000@ 0崍00 000:00 .0 B600 h08 . XB000000 @@08 . 0]g]g^g\g ]g ^g]g$]g]g\g^g\g-l0 `0!X0 P P0 S P\0S00 5H4^g]g - `LMP 4 0 x!xt!10AT P0S& @T, K P@,0sS400S04@TPPPIp'0K\0S900p00  000000 T 00L 500 0@@0,0 ,0S 5H4^g]gؚ: 0-LP yP@ 000:00 R0@0^g> 0-~pWL`V80S/ ,*L RPP 00(:00 R 0P8 80H@bHT@!d k800808 <0 dS< 8 e80S:S<0@PU |00000H8 H gE8000g 80< 8p0?wS^g]g: -LMp`1!0PQWl1l!0Q \1\!0Q L1 Q7@1@T# 800\ 0R00C0\h0P0T0X040@0<0d0`0l00 000 D  0@2pVpl\ 0 @@ p V0*^g\g^g]ggbg(]g\g ]g: ^g^g -1LM 1qa 0K@K 0Re P@PT 0000000 Pp0S 00d1\ @P{ 0R8KP 408b00Pc=9 = A@ @ 0@0SP@T0030080> 0C& 80 >0C&   0P@00000  I00 , 0厊g(]g^g\g]g\g]g]g^gz: p-LM@00`< P0X Pq00  Z00 00  40Sp00;00p: -LM00@ +00p <R00 00S00 00@ 00 h00500hH00@000X00\400]g$: -|4L Mph4PQ` 0SP A2q 4 $00 AT 0S @T#000 P0R(0)Q IsPT    YF0S l#000\ 0P0 00 @#000\00000 R000 R 0S  0 0S0 20 0 @$, P0QT" 00 0Y@00@0 *0 b  '10 60 P@0!0 R? Z8P0, R {! 00 00Z0Y0S0!0 R  ,P060 r07 SRX 00S*0S$R"*r X00St0 0 0SRr %sus0suu0sXR0S0 uq000 0scgꌜ: -LM 0R ) 0 `R 0 4 Pfp`0@  ( P0S@ 0R 0@ 0 R@0  0-L @\ P( ^,0,0,00(, 00 \0 -L,M,0$ 000 `P 0S 0+]P@ R@@T 7000 0pCW :0S/S W0g 0c #0% %0 0 R2  0 /R @00@0T0S P@s f 020("S\ 0S0 0U0SpLP0K P@KH0 @00HK00 4 ,P Pp L D 8 %P@380[c  R?@# *\0× 000N0/Se @0 e弖pR 嵖R300媖 p>@ % ;0 p咖d厖P劖pGWc:0/S Y0+\6 S)0_g(_g -LM$P$ 0 0#40 @ Rp8  Q R 4 00  ( @0 < Q!, 0 /S K  , 5R  /R  2R0 /R, KR, ,0 lR ?Ó00b0 /R07 00S09940S009900900S 0:00  0T 4 T <0 0  0@ T0@v@00@0T 00@060 #P R R0 j7ã000b0 0 j00 0 R090@8 Rd RR R  00Tk00CS<< R;T0$ 780S2 T0$  3#0S 8@0S00- $P  @00@08Q   $`20S 0 0 j 0 ( |`V   0S  8 R|`V   [$00K #X0@@ @ p<QT0$   @00@0<@@@00@0W 0.S0.S0:, 0/S  0b0j007, 0/S 0 b0b080SV0S8 0Q0R00SH@090%(_g @ -LM80@0 p,0   `0SdV 0 R !PP p 000ZT0$  P0  @00@00`0CS ZT0$ ,0S T0$ 0 @00@0,0S 0  #0@ < RP   }# 塙:: -@ MLdd 0\P>P0P @L@HHH0H @@@@h3 d<Ԝ:8ag$agbg(agagag1e0ag p-LM 0PS`@<P @ @@@T]PpK]ܜ:] -0LM`@Vp b_P $`VV v@P^P ` 0$0 P0 00$0$(0$0p 8^/Y 0&Z@< -|0LM0Sh0@T 0S$@TP0 $ 7|!e<:H- P L0S PP 0Rag p-L M 0@004L0P0 S000t ` 044 P 0  PK P 0 0 0 0L0pTd1eag0S  0"S  L00 \ @0D0<0804000,0(0H0$0000 00 -L MaqQ1@0\00 .00,  0@S Pq R#Dq R 0S q P] 000@8@널4,80P@0@@PR # P XPUK#PU X R\0\0\00X \0 H  H 680S 00|0<0bg<1egag(ag8ag\o:T0S ` Rd0d0d0 QT0` S`00d d  -PL`Mu 0Kp d \ P0@0  P8p 0P 0 P Pbg -LM800CS1!p2?0P`b@T | 0V0 @Tdp R| 00 |0p `| |00| p|0p| ]TP < +< <0;<0 ]Y|8 80S@0S  %PT Y80S  5!  ^40 840 Lg bg@ g -LM@<0PX `   <<00!_yH @p00Q00S0@0 PP @ 0W0 BR00S@ @L0S X R\ L0 \0\0\0 H00H0@ X X R\ 0:(agag -LM@LH8t t0P\HX 0X0 \ 0@h0XSX00X \ @\ag(ag -LM@0T 0CS@@0  h S @0SH0 hg 0-h0@ P BR@ L@L 0T0S3 @0SH00hg-H0 L R@0SXP^\0\ D0\0 X\ 0X0 X\ 0L 0L0(agag -`LPp @T T0S`@P T -LM 0P@  <0 D0S 80S @0S 000 800CS0 4 gbg -L M@0 K  0 @ P(.' -L M@P@U0@0<0`p48<,<0`<U5 V-P#U @00CS@0L0S0t 4  @&J<0, 0< <<0ix\尕 0  0C::bg4: -L@\ 0g -LM<0`LP <<0"0w yT0S800CS_|\ [ 0S00 S | 0S S8X0Q0 <@ | |p0Qp | 0Sm QWf Q<0;<0<@;<0@T  P0Q |1!@P @deDFA@04 Sp=ʄ1dXA R|0 |000|0 |/0|0@0 S8 H0>L0S0S X R\0\0\00\0X  RX 0X0X \0 `\ht|OW X P}8 80RWpZH:P:< g@ g(gag`:t:@-2@H?0\ | 0T \80Q bg -QLMp@`P$K40 P@T$| -LM@<0  | 0P |0  R Q8 80R@ 0P0R00S @ -LMQpp5^ 0\ 0S $\-\ Ap0,0S SQ|0\ 0S $\\  0( hp- 0 ho<< -PL M0 `L 0 0@!X P@ 1T0 0j04` \,  T0S ,KP! U`pRP@ ` ,RP@W,p @}0 0j0v <0 R4`( 012=0agԳ<:bg-|0S<0  0 R | 0 S  R8 80R0S -LM\0PS@p$0  0`004P q] 4 $0<$0Sld RiSgRe0@ 1OU`ᄠXX\ QP@( \0R\0ń0d R>@!T@0\ 0   0V0P@@T@ 0004P +]0401U0 R 0S  R0\7@ \ $ \` xQP@d0 Rd0 0DzPXg -LM@0  01fU p-LMP!`@4T  TU00`VPZp;' p-LM0`@P  0p20P$0<$0$0<$00 0-$0L @P R  01 R P 0\ 0$0  0-LP@P P 0S  ^P @  0S 0@ 0S 0 @  -LM`@pT P R0 U@W L哓X @叓0 KP  pんag:ȝ:gԝ: -Le@u<0< R  0S hh:Rg g :: -81LM (1R ,  q q !0`!c1QtPEU:0 00S00`0tPEU*V , R'Y@|&@00000W`pG,0S g g'fd  :$:0@-QMP0 @-PT \ ,P^Ѝ0Ѝ0@l*gг< -LMA\-P   -LM@pPp `pPH00H0 0sPp0S P- L p00Csp0 H Sp Hht[0: -LMPp@`g`hP : V P0SSR3 @R VP P0S00A000000  X00:00 U@ Ai00500H!0FsP@ /lQ  V P0S RVQP  R P0S R P0S"0p Nl0S 0 P@ p0Sl0S  tH:T:l: -L`pl@PT 00  @RW 0| l0S h00 00000\0WS b劐넞:: 0-\0LSP@\@800CS|00 D0D h0h S0h0 hP 0j먞: -L\\8  R R 0 0 0 H  l0St0QH0x0x0x00\0L H0 BL  R@0SXPP\0\ D0\0 X\ 0X0 X\ 0 (!Ceag(ag: p-LM\`@VP0 P00S  R 0 0 0   pp00p0!Ce 0- @RL\ R 0 0 0 00H hP l0St0QH0x0x0x00S0 0 0@ P0H0lP80SP 0? S 40|0 R 0 C!CeP - L8鸣: -5LKM⤕ R, `p lX P@PKZ 0MP@ ,0 S <,9vD0 QK A 1 @! DQ q *P@ 4 <0 TP$  T0 S 6XP@0 R   0000#P@  e0$ 8 $ 0$00$0$4$03#0$0 0$0 Q?KpP3@ $0` h $0$07T8$0$$0 0S @P00|PT-H!00000 R0PPP $0 , 0 P@ u0|`xNrJ.F-*B&0K 0ZP@] 0R uWP@Q0 R  00T $000 0sP@680SB14P  0P@Dg_g<4: -LMԀ0p$0 `QP@ $0 S $o@PK DP@WPF 08K K P@PK 2 @sTp Eg@: -LsMp0`$0 PQP $0 S $|ozOK pDPP@F 0K{/K PsKT@<0 P$048j/1 DgL: -LMP`hQP@0 RK 0K@ 0 夀 ` 2P@pW@ K]P Wd KO 20:#: Q0 <   Q @T0 0BK K0K @00  Q㄀ 0_g p-LM0P@0  0K 0  @ P0|`KSd ]O 0|0 00:#:x0 0K K0x pK 0R p_g -LHMd@Kp `@0<0 ` d @ 8` PU%T@80Q0 `P @ <0 d 8` PPT R0P 0 0 @ KP+Pl@KPP T0R CTP][ -LMP`~p0+ F@TK&0 @  ` 0 BP@0@KSd N 20;;|0 0m 0K Kp"@L}KQ 0R @ 0_g_g p-LLM@ 0 `K`80 \ ` <` 4@ PPP<K<0Y0 L00 0 0* LP< K pLL0S p -LhM`0@,PPQ 0SL$8 RH 0RppS3 S W0S@0P@ SK 0 PWlKlK0@T0@W0@T  -LLM0 `pP/00  0pK0 D0H0 l p L Dp WP@`Q `l`@` P@0 * @ -LM` PD0K0  P %pKP@ 0 @T07O0S<@ p B0 -LM` P0K0  P pKP@ 0 @T0 O0S<@ p \B0 p-LLMD0``K@80 \ ` 4 < PP  pPf PP -LtM`0Kh0  l d` PP pHK80SP 08 0b00K @@KH0 D 0 4P 0P ,` 8 P -LM` P@0K0  P wP@ p0 0  T0$ @0s# NP㄀K|d L0@0 0\ @(0儀K 0@ P@00CS@_g -LlMP` K6P@  0$p 0b  {T0S $0@0s/ 4NP㄀Kd L0@0 0 @ m 0,  B, (0 ,e0儀K 0 P@00CS@_g -LM0P#Q` K  @00   ` P@0  p  p T0儀K$@Pd   5L0:#:0 0 @_g -LhM0`#88SP; KP@  0$p 0  T0S $0@@Kd K0:#:|0 0v @  0,  B, (0,3e_g -LM` P@0K0  P AP@ p0 0w  T0$ @)0s, KMP0 R 0儀K 0 P@0KT@hd K 0x0 @ t 0 @@㄀K0sг<_g -LM 0PK`0 0 0 P P@ p0 0  5T0$ @)0s, LP0 R 0儀K 0 P@0KT@hd >K 0x0 @ t 0 @@㄀K0sг<_g -LlMP` KP@ 0$p 0  T0$ @)0s8 LP0 R, 0儀K 0e P@0KT@d J 0x0 @ t 0` @  0,  B, (0 ,d@㄀K0sг<_g -LMpKP`Td JP@,@K· 0K40040  @0K0  ` P@ P0 0L  eT0$ @ (0 "c1, ah $ 1d0 \ ` 0@,K >P@,0s0,0 $0s0$0 _g -LxMpK`Ptd WJPH,@Kb 0K40040  KP@  0$` 0 T0S $0@(0 "c1, ah $ 1d0 \ ` 0@  0,  B, (0 ,^c,K |>P@,0s0,0 $0s0$0 _g -LMpP @0K0  P _P@0 `  80@S @T0 匀K )@T@d I p0K 0:@_g -LlM`P K&P@,0  X "00  @$P0 0H a80S@ P@  g ,00C,0(0,b@K4d nIh0K0 0@_g -LM` KPPx p  0$@! 0 R P) ,00C,0 (0, b -LM0"P`D0 hK0@ d0 h <` P@AX18!Q K0@ 0 ` P@]PpU 80SQ 80S@ X@X@T$ KW KUHDKTT`^\ |y`P4ytNK0 0TP 0 0U 0 0y@KTXD K0@@80S@DKTYT,,0_g p-LM0 `P0 K0 0  P P@@T|@Kd H0|0   ++x 30K KP@ pKP p_g -LHM0`@0 0dK< `0 d 8` P@ TP8pWP@ @KPP PP@ <0@@T0 00 0PT@ K@ -L 0  PK d $F pKP@ 00PP   0tPP $0P Y 00Pl|m 0D0$ (0kPPpo_g -T0L$  80 Sꘗ'''''''''<0 P <00<0 -`@p D0L0CD0P(0 @ -L,MpP`@3 @0K0D0 0P KUH P` 8@ 40 L@ 0P , HK 0! @R800 Y   e8 P00R00S@HK 0 = -LM$Pp@`0  (08 R 0,    ,  l P` `, -LM$`@8 RpP. PT0S $0 P0    0 p,   ,000c P$ -LtM0 K@XP@x0t 0 800C S6꬛'t'''''' ) @ K@$;DL  p@K8P|`DphHd K \0K(T K0@ P@`pHL P  090 @J@   *09@J -LpM$@P8`ApQ''''L'L''1U 1U 00S 0 p&0 K0P l00b0 0 p T0PU D! 0P @@00@0D!f@zfat $ -LM@`@@p< H 0X <pV\H P\:-$ 0 8$ -`0@`XL pPU0@  IP g -@ ML̠ 0@P -LM0 @ S` @  K0 0, P@0P <0 0P 0 2 K0 P P P P@j0`S` _ 0 Sp| ᔐ;`P@0K` 040 D0 0 K,0 ؠ p H 8p 0 ܀ 0KHK @0KRP@` `P 0S @ 0 0;P80 cQ ڴ Rb@0 S Q 0P PbU"@9C @P @ PP}0; -LM`p`P@P p dPPP Pt P0@0P0Y L0<0 P@ ^00g -LMP Q8 , 4 <0 0 @ 0@ @0,0@0, @00@0,P@a<0,S8 040 \k 80S@:0W<0  R0 T0, ,P @& @00@0,uP@9, <0,`K0pK4K <0mp@" T 4IQ0A/ 40  A000@ SY,0 80S408 00P,P <0@,, 0 @ 0P@-,@ 4Q0A/ 40  A PU0Pq(_g0 P 0 S 0 WS00 -LM@ TpJT"" :P$ K0E0"`E0p'P@(0`0 6@: -$ LM  40K< -L(M    40 K0< -L,M   0 40 K\< -L,M   0 40 K鈵< -L,M   0 40 K鴵< -L,M   0 40 K< -L,M   0 40 K < -L,M   0 40 K8< -L,M   0 40 Kd< -L,M   0 40 K鐶< -L,M   0 40 K鼶< -L,M   0 40 K< -L M8 0  0 $  0 ( 40 (K< -L(M    40 K@< -L$M   40 Kl< -L$M   40 K阷< -L,M   0 40 Kķ< -L(M    40 K< -L(M    40 K$< -L M8 0  0 $  0 ( 40 (K\< -L,M   0 40 K鈸< -L(M    40 K鸸< -LM00 0  0 $ 40 $K< -L M8 0  0 $  0 ( 40 (K< -L(M    40 K<< -L$M   40 Kh< -L$M   40 K锹< -L$M   40 K< -L(M    40 K< -L(M    40 K< -LM00 0  0 $ 40 $KD< -$ LM  40Kp< -L(M    40 K霺< -LM00 0  0 $ 40 $KȺ< -L$M   40 K< -LM \  40K< -LM \  40KD< 00 -LM@P0< u<: -LrPuL: -LM@dP 0 04 0< 0- P\0LS KP  00;00啪@,t00h 0-0@(P0 L 0)0S 04 0< -LM@P  - Ldv`:  -Lux: p-LM<0@ ` P`<<00 P4W<0 p錦: -0 L bg 00 -L Mp`|@Td  00S0R  00 0 0SP" 0S8   PU  PU  0("F PV PrU 0  x0!FPVP ZU0 QW0  Q W㷩DP0S@00A ᑩ|@,K 0PP 60|0,000K0 PP ,­6|0000,PP  00, ,0 00X0娭,妭6| 6@꘦:: g -LMP@0| S`p 0 0<0  0Q PL 0 0#U<0 00| R#PP -LM 0| `P0<p0    0; @  00<0 -L\M0@^ 0 0| hKD P0 |0hKD P0~f p-L\M@P A|0pK0 `|0 RL |0 `A 0pK| \L p P P - L<  Q00Q00 -LMp|`@VI 0 00CS0> 0 00CS 03 0S 0S X埬圬0 p@Pb@dDFA 02 St1b1 R0``00` /0|0x5tl< g@ g(g -LMp|`V$ b`0 @P'@dDFA 02b SP0 S0``00`0|0<5< g@ g(g -LM@t t騦:';|0 s괦:0S S  (00S 0 < - -Lrܦ:@-| q  qL@H0 800@< $  2 02$ 0|\1EP!010 P?U@U  |L1 "  40 $,o|  40 KoP@   *| 0 @|  0@* @T ?|>1 1E  00  | D`<0;<0 | !88#`og:d: 0-PL|0  Œ*P@0| 0| "8|8 #$ 0|40  !Ƞ40 Ƞ!$, *o0d:gG-p堑`aN`M\0[ xx1&V1d1后ETX1""ᓆ L"b l A N AD%X$1U`; P ! 10UPc "*0P  00U: QPc0 20\00{.L B40Zx000\ | 0Q0Sd00@a00Ѝ8< cgųE.(cg,cgnm88$cgk_k P-LPp>;T!52c~HaȀ2ca10 0\რ+ <@4TP *[O[O @@R: 0``( AP*0 P@:00@C "b"b0#l00X d2111H"c#b1 `130$EnQ4cg0cg88<0:@-0PSpU0 0 000@ S  p`U 0 0R0@0 Sb0 S .000@ S  LpL`U 0 0R0@0 S0088E-` M@p 0 0 \0 0.\T.0V0 Ѝ.\ D\ 0 S.S\Z\RP J0 S .S RP \ZUv R0`@e@c\ 0  0S Wpp0S 00Np ^\\pPEP*0  0S Wpp0S 00Np^00P0#02SPp3^_000S00W V @V^P 6!10F000nR^`VL 0 S 0n0 lS0d~0^ 0*0^ 0:bP0u S .S PR y0.STWVM80@-P| U@B .U@ 01 c0 C  0 R0Z  0  01 PJ0 R0Z PJ0 R0Z P J0 R0ZP0@0000  0@000|@ S .S A-@pP@  0Xx= ?0 1 C@nT0 7#30 T00SP-@T`,J 0P$0S!^Z@TJ 0P0S^Z@TJ 0P0S^Z0S0S 8p@-@?\00\0AS`P?@01 P0 0RPu2 0?0 1#0C0 R0; /R0 0S"QZ0 R0( /R" ^ 0SQZ@0 R0 /R 0SQZpp@Np00a0C0p00Np00a0C00a 0C 03  QZQ p R .RAQQ 0Ғ?AcON -,0L;0 nA0<4K,0 0P140PH@ `0T*^ 0p ^ #0S 0P4 H0 @0T `: ἲ#P40P 4峲᯲4嫲P<:H: -L M$ ( h0 pe h0b t t0RpF R` 0`t0sY h0S t@\ T0D0bD` $K0儱Pp,$H0 P >  @#P7t0 qD0 4Ht0T$p T q! (0$S (0K$p (Pp( $\ W (0SD^ 7<0T$p<0RH:T: -LMQ@p``#T\P 0@30e^X05< 070 0`PP X 0X H 00\T D a0N 0-LM P0@0  @0 -LM,0$P0C0`p,0 P(K,KT PE5 0P@40K(, 0ΰP@-0X0H0 R $0U  P 0 PE AX0 0S 0P@ 0X 00U00S铱0吱 -LM00<0 8 @ 80 @0PG 0K , K0uPp9<04K,0 0sPp*40H@ `0T*PU  0 @ H0 `0T: MW@ "P 404p<48P@\ -LM0p`P(K,K 0 P@(0K(, 0P00,H 0R *@T T 0S H0 0R:P  -LM⤐Kp  | PbP@$  ԁ0S   @T8$0@-@T2PQ @0(0$ ,8P@|`80S|0" 0Q}0 Q $0 LM}0  0P@  $0U 0V@ Tԁ40 08  0,0000 05t0s/ KP@  0@*P000@KY 0Za 0Y Za  M| @%00 03@ K\Z 0 Q10R`\ 0  0xP@  o Td -LDM|` p< PPPH rP8 V2 0@ 0@@P U $00D0  0 PPx04 8 5 40 K0pPP0 ,0(H  P 0崠 OP|0@@4PD 0R 80S P8;A<ꈯ ZS4K,0刮PP4 00;00040H@o8  8 P0 $@ ! 041   042 0 $" 04400 $" 042 $ x01QS 2?S8 "QL  0488<,0 0$(,0 8Q8P 020%L Rc840S_0 4SZ82 t0  048<840 048 00020x08 t \ 6 8tp\ 5 @QB 0A?8 H0P:0@70\T 3 HV"@T,0X P)@8,0!4@  8L0HX,024 80\p8 84 0@` $QP08<@@"8@D@@8 @D00c "`08 p0HL x0 3P Z Z 83 \0 8 t0h3\@Q8 808h0h08h!8 l$8@ 1@\0BX0` $8@` 0RT4]08 40 xQ 4K+0\PP40H@ P2 80x04A040 8 <L 680<`8PP$08010DQ8 80010d08 0<L P |0y P P P{/l0h!d 4 88<|020C8Sa81 \0 t0a\0S^1R80 \0 t0R80  t0\0 I8" 4!0` 4` #,$ 88<<0D& %0Q4x0P0 840,0ghd|::800 -@L pP`0 A|`PQ`<;$0 :$0! -LM0K"@CP0   p-LM@`0P0` ` H0 0P T P0Z 0,0T` K"Z G"MB| C" D np p-LM80@SP0 0<l0S 0\S `V p 0+0S0  -LMQ`0(  $0 ,` d0@Sph, K 0STL  0P$  $W%(: -LM0@ 0KP0 00  0000   0-@P L@P00 4 0 0 -LM䑟0 ,0 @`t0 pS$ x0RP#N*K .\ KPPC00 K0 !P0 PK  DP @P N0  < 0 0/&00  K0`PP0  0  ,0 S ,@%Rp!RLKN KO0KtJK0n0FKH KgP0[ 0P0Kg:0_g -LM 0@Q{0_g p-L M@0@SpPP `K0 000 0  0 00lj i0&00n 00rp h0 0h0 -LM 0hh0`0  0 $  10 !   09m -L M00PKp00 000 0 00000h t` Pt0s<h0($200 h0 0 !1@00#!  "  000 ` 000 0PH` x0 @000 (8 Dh0@ 8D000L` $ 0x0X 00@ 800(0 i 80x0S1\T \D<0L aP` 1 E,$P`! lj i0I0r0nC0j0rp  ܤP.\ K P'@ PK K 0@ PKD @ P VP0  孹0  0 ,0S ,9K K咹;[0 [ 740w 5 <0QLKN KO0KX0O0 JKQ0F0FKH KJP0[ 0P0K6g `0Kq:070A4 p0.0 c+0\ 0@$0  g\ 000S 08< 4 Ud Kd0S 0 0\0S0 āUh K \P*U 0 P: cR 0P*0 | 0\*W \*0 RUil K>l000} 0 RUUp Klp0w x0P:UD 0 P: cR 0P:0 ~ | `0Kx `0Kqt0àqǠo0<àl<ǠjhpfldbP07*0q[U 0 P: cR 0P* 00A S@-@**\ *!00S x(x(`y(`y(xy(y(y(y(00@S S ST!0S * R:!0R0SS `S0SS 0@S S S 0SP`S PSpS S0  P P P00S*00S:00*S:0P @P(< - @LM <*h 1e( -LM( Q0`0  0 R1S 1 R j 0R0!R0q50S 0S 0R+d\ 000R00R00 A  PXP11 0AP PIP0P0@0@0a!R0 0! Ro>     0\0 BP 5 P  PQ hQ0% %01z w$t0@T 0 R 01DQ@T#=phv< R@0@ <0@0 < @0 (l(t(|(P PgU; 0S8 U0S6 0@T  0S  @T PT UP\ x 1`?Bc00L` S g0 U R0PC\XP0S @ P7U t,0 S ,'ttPp 6%Ux u C6Uq 6U| h6U. 6U \ p  0 x 0,tt5 r@Dr-Pt0 `  Pt( t1  %q< 00\5   tr@Srtjr@Irt1 50SPm0S  P^$5ATO @TL t0 SG0DX0S 9S SDr t g r5t@K0 P55 05q @TM 0S 0S @TAd#S SSL3UO 5@3U 83U!0Pt0lPKp0K@ P@@ @ \@P0S  \0S vp2Ul2 UQP P P %1U1U0*1U 1U# 1Ut0!1U1t0D X` t0 p1U d1U \1Ul@K@ t0@ p0KV\ 1U 1U0U 0UdV0U^"PMPG/D#@gi$ii$zi :FixIi i i i qϖL; TK0P/SE0P9Scg p-LM@`TP P @TpT  R0000 0 P 0S P00CS00$ R( (0l0(0  $(0pP R000 0 0 cg -LMȀ 0R$0 0@T 00@T$0 S |$#@`TP 4pKV`F  PP@Tg: -1LM@ T$ P 7P $@T$0 S $v#T  R0 @T 00@T@`TP 4pKV`Fn (I PP@Tcgg̫: 0-P0L@PT P $@T0T 000cg 0-`0L@PT P $@T0T  0P"0cg -LM0@S SL OPT(  GP h0S_9 0-T1L0MLQ@ T  8P< $@T(@K0 (0K'K/P@ <P$%P@D@K A /P@ <P %P@0 S X"0 T @T @zTcgg:\`9: -L$M@0Q0  %2 800S80 0 S hv"<55P2K4 K 800CS80ʴ5<55 g:i -QM 0P P -Ѝ0 ЍKP0  Ѝ -L$MPA`AVDP HP @ p2P Z h@S 40 40 \0S @40  TQ 3 R*TAP@P@0 R񟗿ꄧ(ܧ(\(ܧ(ܧ(ܧ(ܧ(ܧ(ܧ(ܧ(ܧ(ܧ(ܧ(ܧ(ܧ(ܧ(ܧ(ܧ(ܧ(ܧ(ܧ(ܧ(ܧ(ܧ((ܧ(ܧ(ܧ(ܧ(ܧ(ܧ((4PK  @0P#]P 1  5 sH0S02K H@ 0 1^  80S $00cN  hZE 1000@*K  , (D0 S<Kr Q@km!1`R001S00 000!005  !P 2m  2h 10 1%m77PF S 0 B0 0   0h0h$0C0C!0hH @0@4PK @BK@04PK  PP02Ky (9/P@0<K0D0 @0 @(@0 /(\@PAP 40 @%(P80@0Cp80Pp gʚ; : p-LM@`Pj ph -LM`p@ 0$   R \ 0S  R\  -Pq  'P11<<1000 |000|0 "48<#X 5 3U  UO 3U00SF0SA0S> X3R: R1 00C B 0 !  80S$00c  g@T 1000  S0 0C 0 0d0d$0C0Cbzi i$gX2  ̺@2 P`,l0pS!  lR#l 0`R 000S@0@0@0ik000f0S$000 0PP0 lp1U! h1UlL1 $ 剺41 P`k0pS kQ000 0PP0 k5i^50 ' a0 P`k0pS k|P000 0PP0 kr (P kiOfT<(h$hpjg5݆xuhP<@-@@:@0\#" 00  @Z0081e\< 0-r/0L@P0S0 Y 0X \ZP@Y 0r01<0 0h-00@0  8000E  /s?Y0( -LM!@R \0700i!R\@-@ *,  0!\ "0! ":8@-^p`*#!^ ",!1 #: T8D8 0-0LSP@/ S /0  0S0S 0S0S0S 3000  00 00l }d0ST uL 0^ 0 000  0 y< 0 0 P 1   B0^ 0 0 0b 0 0Sڃ=LHPG-@TpPpP1^`ᶀ&^@\ ^ !000 \ \ !000000T p \pP QpP ^  Ų000t G-M 0Q  ZP C 1Z00\1 ZAl~dep@0dQ.ڰ010   !0 0c^ B Z^  Q  00 S 0Ѝ 4 010\~ \" 1. HD0nPk40($000 "$ 0 0c\à3 B J3c@0d^@ڰ3 3. 0 "$ 0 0c\à B DQ8ßJ0 10 #0#40 0bP B2 yŸ J010q2 2. Ÿ0   ZKl2Tb@0d^:@P2 02. 0 "$ 0 0c\à B  QJ0 10 !0#40 0bP Bl J01Td1 D1. D1$a@0d^:(1 1. 0 "$ 0 0c\à B  Qژ J0 10 p 0#40 0bP BV< J01Z$<0 0. t -LM@+, +&(uD01>0 R@P 00008 -LMR@ \`pڈ,A0 B<0(0#40"(0aR# A  R PtF000 0#40 0bP B Q \PڤG0<0 0#40 !0bQ B PU"<0a0 P$0 1>0 0 0"$ 0`\à @PU I& o0 1>0 ` G0<0@0F   00 "$ 0 0c\à B 3 0S:3s`P0fU\ß+050 0 "$ 0 0c^ B  3 #Ѝ+0 50 0 . 2嬢` 1+ 0nPڰ0000 "$ 0 0c\à B <2^ ,2  nPPaoڸ0000 "$ 0  0cP B pGW113<`ӗ`Ӆ!0tQ0nP?ڱ0000 "$ 0 0c\à B  1^V P1 nPpaڸ0000 "$ 0  0cP B 60 0 000   0 0 00   vD8e8D9eD6e89e- 8Q Z y8Q ,8Q .\000 0A Q 0@-@0SP Sp 0 0"$0C0 00 0"$ PP0x00t S00 "$0 04 4000S 0 0 -L@`Pp0 T  0 &Ġ`00  0"$ `Fv 0 `Fv00 -PLM0 @\ K @@@ 0S0000 0-PLM@ \ $PU 0 KS(  000$P P-LP`+ (  P pp0V p 0`f 00FS0 `@P 0&SP !) P-L@p 0S `P 0SH((\(((L(((|(Q 0 0A ^ 0` 2 0P0 #20S 200Q  0A  00` t2l"c0#22cP` D200  9Ws |k \_   0 S00000SL  0C00< 0 00Q: 0 A0 0 80 PQ) 0 A0 0 40 00Q 0 A0 0 00 R ` 0h00W  00000` 0000S0S 0: : :B8:P: 0S p-PLM`  Rp0S00 00\/ @Q Q0#S Ra\00Q00S0 d0Q0 @PW 0@P0ppSp 0-80@S<0L0 P0BSR 8P0(U 00 0$040<  (! $ -LMPp(@  P@  ( `P0@ <(` ,0080 ($ -LDM`4T 00L PP ,0%T%0`0$p PC2a \ q(()()))d)8)t)$)U XU 0uPUP H@0 0R8(\(((PE@0qPd7t00K4 K80K,KL,04 80~P   0qPE0 $p PL0 0c P  T 4 LP j07sPE) 0qPE0L $p P$p PL 0 0c L0 T4$p PL L0 0c 0P0  T4LP 8U X& 0uPUP H 8"(#8RR00Pp 00L( $p P0 0c 0P0  $p PL0 0c  T4XO Y, TP> Y @ T@! T @! Tz0 0dP 0ST00dT0 d0S00CT 4 P LP 40T0 0TS, %T%, 50c0C2l P Yh(0Q ST0 T%0c0C2a 00(S QT T%0a0C2a $p PL0 0c  T41 U X 0uP UP HI $IR@2P0L@TL0@(  P x 0 @0 'wPE#50Y*U XO 0uPUP H  !0#50\qPE: Y p0 S000L0  ,P0@0(" 00<0YX@ '*@U *X 0uPUP H:ğ 10!@P 0 Pd7t  @" 00<0QX@ :L@0@K0 HK@  LDK<0K < P@tL<@D H0P@W L (!L0 $D0H  @0 $p PL0 0c  T4P LPP O LLL4 T 00P R,0%T%0b0C2a 0LS$p P U0PEJ0T 4 P LP 40T0 00T S500$p PLLHjLDg$p PL0 0c P  p $p PL0 0c P@ dL (! L0$P@ P U *X8 0uPUP H:7tPd\!X@ " 00< 0RPl7| Y00PQ P  1 ^  00 L0 $p PL$p PL0 0c  pP L (L0 !$ 00$p PL L0 0c 0P0 0 h:|:<8:: 0-P@L,0  C(($(@ $0 -L M0 40`Rp<0S7,0b$0,0 0XP00  80Y @1@!S   E0P00,00PU(Pde0PX,0$000 00 0c  4P<<0 S00  -WMLMh , h d ` \ X T P L H D @ < 8 4 0 l% p5 =K hUp h@K1hK0PU1h0hS0@5 B hK1S@T|E Q1 Ph K1SPU5xU S0!5 004T5 *hK1@^ JT:hK1% R% JEUK0LhK1 L@PU `E dpK 0PU@@QKA ApP @T! E0Q00hPU:|x%PPdU P ubU |Eh0K10Cst5 E| ^\t x%| j% 0@j$ P !R  t|0a CTh0K  *@T*0 R c@T:`(  0 P ` 0 0Y0K !   <$%  `5B%05 Q=K  E| ^ʘ%|hE1hW <$?0#0#% 5 % *l%QL*QE` 0 %  p5H0T *K1@T:|%0BC P%@8P%0C !0S %EbI80C !0StN~t P|xP| Cx%E0R0T00S lE0np!P  % 15 Y PP 0-LM@P 0 P @xp p 000000ܭ:: -LM`P 0pD SP@ p0 p 0@0 x0 8P@ pD0 p 0@08`8(:L:8X8 00a0<0:e -MMLQM $ P 4  0S0ʀ!QxxxaxqGt1t!JNK4 $  @D01Qڐ 01Q4!Q01Q!Q01Q܀0ԐMK00J  01Qڌ`p0 0 p`L 0000C04 4 0$0 4 < 0T0T P*00P:4P 0 PXgcgȯ:Je:JeJecg:hQ0 0 R00 -LM@P@ 0-LP@P U 00\  P@0PT0 -p @L` PP 0   0R PPV5 0 Z 0ZX U 0 00\  PPP S cP0 Q0SQ0SPV -PLPp <0S 40iP 40 0 R 0S 0 R 0S `M@;0tH9$HVT @`Q  0RQT`V `80080<\d p-LML@0`SP P0  hpѕP Jep@-2\ \ p"Q`@0  n `&"`b.bn  n ` &"`b.bn  n `!"`bP. b0n  n `&"`b.bn  n ` &"`b.bn  n `!"`b.b0n   n `&"`b.bn  n ` &"`b.bn  n `!"`b.bn 0   n `&"`b.bn  n ` &"`b.bn  n `!"`b.bn p0 Q| 0 n `&"`b.bn  n ` &"`b.bn  n `!"`b.bn pJey7 p-LM@PT7` \\0 UPL P 0 a!0S00@@ p0<, @0S 0S0C 0 @` 0<0 0 S  l0   @080Y0S 6P@ 80@ 0CR80 U:Y3A":PP @ T7鐰: 0-LM`P@\ T 0L@B@@0 <@40$000 @<dg:Jecgxa)<: 0-0L PR  WP@0 H 0QP  00@0@$1pPU0 @T* 0 0S% R 0 0 0 R000 0 0 \  0S0C0 @T 0 0SPUL>L0i?<i 0  0tl gcgdg<`: -LM0`SPp@T !P: @T0S `2S& 0W0 P@ 0i E,0V0r,0  ` 0@@`00 @@`08V#x 2S ,00,08 x1R!   T:)@!@0Sd00d01c.0Q v?1`!h U 0 (P00?>1e  1E# = S000 0S000 0S000 "=" S000 >S0 00`)  <: -LM@V !R1 11 h 0P 0P>@0C !p @#2  N=@0C40P ,0P(0PN=@ 0C! ̇ -?0LMe.S@ 0`?C0CQCD0T T(0(0 0 :: P P111< 1N P PP1N  -LLMß0囎P@ `,0 0 h bdKh hP.0S5UPUd0[pWTK8~h R2b3c13d0<3 ,0S ,,GdK0  @T@p0d0[W.ɖ 0  0 0  B0 ɖɖ ɖ@2 1l0 0ɖ|rh _U 0pWp p00  t0 P@pp0Wl @ 0ɖ5,# d[t0Qd K0 R QQd K00 Ðh0 d K S 0h0 B0 0ɖ 0ɖ 0ɖl B0l0 0ɖl 0ɖl0 0|ɖzg0:H8 Q00S Q -LMĩP8S ySp S p  Wp.0S7 B `<` ` ``VW > @R4p@TP1 R P49 S9䙅4S iV 금)))))))))9<949<P` W@>\Ġ @Tyrpp iS Sppp 0-0 0 9PS009L@Sꀊ)) )) ) )) )) 0 0XK000 00CS8)L)X)d)p)080000808070:00;0<0<0: -LM(:@SC \ (ʀ 0 S05(:A-_─pP0@T`t0 2 Q 0 0R<<0 Q@TpWP`8 -.0LS1P` QY2/A Vy00S\ \u,pVT?>1 u.Q L00E\Q0?>1 u. 1LQ 1?09\Q $1u> 0@T@t0` 1u> 0@T@00 0u.S L0100SH:8\: 0-9L P|000 RΠ0S 000S20S@D0@0 d0 `0Q00R0S>S "=" S  Rꌏ)X))))X)T 1S1 RP 9S 80 1 SR80 0000  p@-1 @^PT * ^0 0S0:W0 0CR  000 ^00S0 00p00d0bT00 R 0S00 000S00C0 ̫ -LM:@S0: -L4MH \ 0P,0 L P T  L2@PP`L 8&L 101c2 VT c LT 1:)01T00LT5TP$0P0T 0000C000I S %L0P  P^ Ip 0H@0Z0H P 5P50 S H 0: 00S3 p0@@K H`: 0P =K\ YX  0 PSiYX P QX pPpC D 0 S %: \ DK0 L,T3 ,0S ,! p1@KP 1#1 1010 1P0` 0pHD;0D;L,T, 0Pg0jUP!D KU \p0 žWD0XPH8;08; 00gUPS  U P  \0᩾P P XXpX ew1@P " 101P0  QPU1P! 0Y` 0pSe1@$B1$ R 1 0+10 ,P(P<`8`100 0P RH4;04;y H D;0D;t00@00L0 0#S21@$1$ R 1 0 +10 ,(<`8`100 0P0SH4;04;E @L 㵽PH\ \;0\;9 \0H :dgtZgXXgt:D[g440 0 0 RZ1QJe  Q-$00 0! Q ":Je -LMRP@` 1S9Sm  Rp:0:`0R0,0 9S 1#29  9S:0:K 00)RF !R; 0 t0S50t0!R- 0000 )t0S& 00t01S50S x R 0Sx0|00000C000|9S 9x)09|)0SXG QX l00l0V Po?+ #,0S:0:)R<;0<; 0Q' 5 @X X 0L((!D5 P 1 0 QRXPX:0: X9Sꤞ) )x))x)x))x)x),0S :0:9S #  HP5  0|0@ 9 :0:  /P:`0:w PbP:`0:k h0)0Rh0p Vq <W00P00So ㄲ90- 0$#+Pt010<pt01W !1R001Sp1p0V10q00000n* 1t 0 1t RPP 9S p` @~ P:0:y:0:,0S^9Sn P# Pf  P` ,0SI9S # P9U 9SK 0:0:  PP 0  sP :)0R:0X5 0Q j(  c( u0 l V( PT:0: ,191< :ʚ;T 0 R!;0;9 P 9S ;0; / @X  00 P Pu 9SH 0 0S 6Q6  #¿,@ @@)⻿DX0H ? 0#l0T0 7L@r@P@s804 @ 9S PU00X00S 1S   7@60 ጺ00 ⅿ9S0Ss0P@S ,4 R 969P9sH30#  3 R   96P P 4@ >9S 90 1"0L P BT +9S\:0:P :0:8@ U$ UM0dS5(;)0RA(; R 9Z@ 5 o ⼾ p(0Y  0dSڸ1S ;)0R;0 8  ,@ 0@z0dS,;)0RA,; R 9Z 5 ⁾  9S 9ST8 4 0 *0S4@  BS0@ 00@T:4 R 4@0S0P 0 RR 60R007<P 9 0@0S 9Z , 4 80 P 0 P2S8@ < g@ g(g(_<0!;: :: -L M1PS@ pP`^  "KV"[9 S 5 2[ (T9R 5 [ 9(xX. 0Sx0|000  B @R0 001S5 00|9S9x0|9( h^5 ᱽ 4(O5 ᧽ :<:p::ܴ: -LM%@: 0S$ 00P H8 -LM`4@Kp)0 , 80 ½`XW@#0# <0 VPa T P ,0 S , 8KP79 09  DW@T 8K P<:( H8K P00  4 #$( <<(@ 0 ` 8K ^P t t0T (@P@TP0PPpWP@@yg: :@:s:X:d:::0!;е:Ե: -`LMPp @# 60 07ll0X0C4W B  0R )TS  353576r0b0s c t0 d0969696l0p0t:70x0墸Px00x09Wx00x0 0-@PL ż #0760 㷼B0 W0CXⱼ535367b0r0c s d0t0696969l00p t00' 0 -:LM:, \@P` :\ :\ j:\: :\ `: ,0S ,x:P`@\ P9;99S 9S 9  # P 4`9;9 F9۽P`1p ȠTʅ \9u> 0  R! 1?09T:9S9S9 l R09TQ99\ 9\ 0N`8塽P`9@ 108%S84`|z8厽P`t8 R 9j 9 ;g4`9d9 a ;<8\ B08\ (8\T7hP`N9!S F94`207UP`;9S8 52`4 ) 09 9 S)  X'02cH'047\4 #(7\6$P` 9S Pp x0  kPp`6\9S9l9ST $6P`wPp 9P` 0S S Sq 00 0x5ȼP`90SKP #㜐Kp 0HS   0S僯P`ZpV0CZ) 11C R# r P9<9<9#500#0053\ 3\.9 S >1(.  0k3\ &t3\ l3\ はPpK! ㋵9S > P KP [OK~! lk607P0KP [2\U *2\9妎 00`:p00P0SZPp2`V`:0`*:P` ,2\ `Pp 0|S:GK | `V0|00Pp| 0S*<Pp  0妻P`PK! yP`P0[ SN@ P [0*OK9S)R~ 9  c ޹`#gii iii:gP8i i   i8i i <:i|i|ii !i ii5i i 6i(i i i|i8i| 0-!:1)9!1L): t1) QP*\1 X1Q0 0@T@ 9 0  9l UhAN @0)00lP  -5L`@YG909l@( ~OW/#p * &9S9 #00#0!> 6 6 7) p003039  039Sr007 (E l: p-LM`lP1u> 0l@T@T*0@@R l0S@9S,#9@ # @ s 0:@S 6 R @9 p# SP @7LP  # -LAM\5 `$  9@#<3( 403 L @R90929PSs PpA 0@S \ S WTPW/  lT2 00)R   9W R ) 09 $0S $9S9  0:SP )0S !00009n$PWp 0 RpPP IKllA 0  PPIK?> u. 0!LS2 0S2 \\ p?>1 u. 1LQ @p \g\:d:: :9)sX 9S0 p-LM!T`P0S@0 0 !T 㘱p釮@ g -`LQ0 @P@d!DFA 02p Sb` 0 S0 0 000 !00߮< g@ g(g -L`0 @P!@dDFA 02b SpD 0 S0``00`hg!굮< g@ g(g 0-P@L )000 00-P@L 00a!9 S ) :S0,:X 0h5! p-LM`@PU;0 ;p p-LM`@PU; 0;  ##9l l p 0-LMHP@0 L K@0 εKB 0S >0g: p-LM9@SP 0 I 000 p  ` V  000 p9SSP` WW ㊵1S  p p-LM K@P3P9   ` P U  000 p9S" ePP 0Q #QWW L1S 000r p I 000c pNe -LMpL@PT` l  l0S 0S`3`#0S60S`V P>  p-LM9`QP0 )I)"B0  :0C : R xQ 0 Sx0|0 00C01S:S,:p 뼶: p-LMP` @@D@T0S p   ph 0-P LL@ Y0S Q00h -iP0L90 9:P@  *:pR 0S 0`S W@ h9S _X;0X;  0  -PLp`0 9P@ P@ hl0@-\PW@W Q 00S  Q Q @T00n8 0-3LP@0  Q  P000X)0R009693 979009 y $ " -LM9PS@`&10S7ip9"Ƞ2C3 ,^0 R%))9ɔ9!2C#0! `R 1S0 00  0i+ 0-3L  P@ 00C09 9S0D  00C09)6 90 $ " p-LM9@SP)9RbC ɐ 16109(0 R 00pa ж: p@-@^P 0S 0 0p`0^; S 0S1 0S  0 `\ 00S0  0Q   ^ 0S 0S0\@ 0^@@ @@@ ` ` 0 R 0S 0S 0\ ` 00 S0  0Q  0S0\@ 0^@@ @@p@-@`PR 0SN0RK \ ` RG R 0S 0S 0S  PP 0S 0R `S00 PS0  0^   0R 00 S00S0  0Q R0 0p0 `S00 S0  0Q  R@ R 0S7 R 0S R 0S0\ `S00 PS0  0^  0R 00 S00S0  0Q 0 `S00 S0  0Q -LM @Rp` 0S`V^ ` 0S``X  P0S P0S@@V^ ` 0S`` \RP 0SPP 0RPP^ 00S p-LM0@S`P @OP00S T0 0P PPP>pp 0-@LTP ,P@@T000S 0S0SQ  0PR 0P  R 0P P0 Q0P p-LMP9ɐP@ S`` 0SF S p 0PQ Q 9S # PP 㹲PS00S))$)$) 9SS# PPP00)R# 00)RPPV 0SpT< -LM@PAAP`p Q2  0P 0iSS  0i !1`R1SP1P0Q10  1 0005   10 1(7: -QLM`pPx 001k  80S $00c[  PUR 1000@ `  921)  ) [~ W #S1!S(5 9S PX l@0(!(000d9SPh9`Y0h90dY50S)!0@00 S 0 B0 0  0e0e$0C0C< :0: -LM`Pp ^P? 0iSS;0@S)0&00S!\))\))P` 00`I!000`T( H;0H;UV 00 0 SPPy 4K ᫯P` @@'0U  @@@"[ 1g  80S $00cW  PUL 1@0000000921) )9S)X))))))))0#0 `.K  \ X9 0@00u00 K.K  G#00 =#  9.KD;0D;jS 0 B0 0  0e0e$0C0C<: -LpPB00ʠj`hP 0`/">C20`0E*S=)))))))))))))))))))))))))))))))))))))))))))PX`@ A@=@P -L4M, PPi `p p@ 0 T40 8 0  P< @< S@TPPR"0`0 0`S`4  00^p T<800 oQ84 o,0<(0 0` pl:x8 0-0@0PLUPP M@0 0-0LPCS  @0200P9@ 0-0@0 LP-@0*00 40 ɑ R  R    " -`LM Vp9WX"@0PU $ q1010  1 !UV6X"@\$$0S !0 ;00,(PUꐹ:Lv;:\q: -PL`@pP**** ⃪"~y0 . Q( 0@!T\WLHV@T,h  @T #2 =81,\ %x , TD꘹:::::Ĺ:';+;Lv;̹:Թ:1P P .  b@t$$ R 1 0 +10 ,( T 0@ T@d @T 00 0 "4 40i8#8#$ 0$  0!0i 00 0i0  BD壎1 <1.X0 ,0S ,0  00 0.P  0 0@w, T00T0Tz`gigL:ig -L M 0@p@A`0d` 0p0#!dP60 0d0  0ppB  -LMKWX? B8c0@ 2c2c@2`ϠAl  8 #, E.Mb -L MQ@`*0S S 0`鴟*xp0 pa``P PUẹP᳹Pڇ<<< 0-LM PiP@ 40P00 KPPA0SL LĴ@808 P0鸴0鵴0< y* 0- L"48<P#HP1 T P"48<#HTQ00ADT@Q<0\@| 00 T@ RL 0h邴JT:<0\ T0L0P0SSP@0<4< -L$MȀp0P4`K$0 * 4P0S L00P0 $0S $ڬ 0@P  0pp庵D0<0. 10 S Og\:hg @, T  "48<#0!$(,"P:,@ @T, R3 0 "48 <,$#8(!8 ,"hCV ڲ "48<#V   "4 408#8#$0$  "4 40f8#8#$0$ TA 0P $(,.4,8 <"(!(#8R`c-ڲ0#$04V `# R0@00@ 峹,$00C00f8#8#$0$  "4 408#8#$0$ N,0S , 0S00,00 @ T,  ,@ "48<#Z @"48<T#, `V}0@00 001Sm pP``_0V0C0@  P`T00C0V@ 8#8#$0$00 0 0 000  R000 @"@2@P @dDFA 02 S`(1b1 R000y0 0 0! 0 0 0!B W P 0P U  㪀`! h00h0V 0S0 0 0 0\!000I 00C0Q Q00LP@P00 &Y 00S0<0 0 0 0 0 0  00 00 jg<< g@ g(gig@ gxkg - @LTp ` P R000@ 劸0U0C0 R000 0@P@dDFA 02 S`T1b1 R0pp00ph 0S 8 咢 00Phh`g: --)L4M0 ,0 X 0 QL X`H0 P p D KD `H @001H0 @ 0S* \ @*\ 0  WP . P 40  0R 80S0C8000P0 0 00 0S r P P T Ժ*Ļ***x*T 0S p@T 3R ,0 S ,l5lu@0 R  3Q H0S <Q H0SQ P U 5SP1pP-pT 0S0  T 0S0 R ƕT 0S00S R; 2Q5 H0S <Q/ H0SQ P) U 5S@ T  0S @T T0pT;p  1P7pw 000s 0RP@ 0 <0K; K0@K80 Ң@Q |@0P0l01 _]! 0?0 ː PU  0R? @1 0c0cS00062 Q V10 R ,*000  6x!06 8CR 6S 1'0 1 0 GP!qP$1`岐0Q0'0 !\@0< <e $!0, 0cS ` 000|T"0\"?08Tt0`0`S rt07t0Q0K 3ft07t0F00C0#3# #R?60  000cS0H#LL10T1p3@_0yD 00 0 R000 0 0 00 0:80O$HT!0l0bSL|040/P$B R 00cS10cS 0 0  1 01 Q @  00cS10cS  Œ0S \  0 0bS ď00[;6t S7 10T01t 0c 0 0bS^ڰ0 00 &%0&?08kt0`0`S? t07t0h 0KJ}t07t0]0!R$ 1'0 10000S00C0 `af0O&0 0 ,7b~P7P'X'R? R =Q 70 S\ L!p00bS P0Q0R00S 0S P@0S\ X10cS(0T1p L!Հ`Vw 00cS0nS 1S:6SDt 0R00 l R8 0!R 410cSb l 8 X  |P h0  HP2|@st 0h!0bS5t0`1 S`500 1R 40 :|0S m )0?0 v⣎ Z 0RpQ lLP a0lS0VG,:d 8  0000|  @_hX| 0 |P h0  HP40 ' LL@ 0St; R  0t00D+t0t   0L@p* Z+0 ?08HPKd`Kbl_l R R0 0 D0@ @KGKH@Kp0 \K4Kd@KcKpK0 &Q Qw ! 0 S- 00 %0 S   0P p  DX Pf 101  f R \=@T2 0R #3R ʌ tK 0P P P  lP1010 S1010P 0 `( )pl %p0} p0H0KGK D d0KKcK0`0 &K]> P   0R00 R P1010 80  X00 x0  0{ `|0t0 0<4(<"4!*s000  R 0S0s 0S0S 0s R  0S0S0S 0S 0( "P000  0S P0 @ !0 00!0 J`P000 d 101x0K P p x 0R0%p *  r 0 Q1 !0n@P\0 t@ z Zt| S2\ Z h hXZ00^1!X\ t P0  CX@0D P3S0XP@x0  X3 pQtp P:0 ( r0S%@1X:S 0!0bSx R4=!,=0x aS0b0bS T tp0 0bSt1Sd  S( h tp tp00 0S J? dh `Xt ɃXh  r X00R00S,,h00h0 0!0bSHD0ODh@ ŔPp 2 02$0  1 4W' |Kh0 0SW \0 h  h 00c<  80S Xڐ\ 0P \| 0Sy h0| 0x0S dx 0 0 @C t0 1R0B0X401 0,$,!$#, 0d,$,!$#,P 4 P0x #R7R9ɟ 2Z`ZZ"("("4 40@0NS0ՠ0 S 0!8#8 #$0$ ! t1S S r0S 40 00 0St0 0t0 1 0cS 01!S8H 40!0000@ 0R t(0?0 ^400t1SV uSS `P.d1l@ǟTdA@00@0tp 00 0tpZ1 0cS0Xt0 t^<p,0 S ,y0t0Q7P `(Q ` 2RAR6S87ó t0`7|7 1!"4 40| l t00| m0&00 |@S;0 0H @` S!@( B"40 0l 0|| 00H 90 Xa FZ 1 0cS!S 0d0 0 8#8#$(,"8St07t0`V(Hh8h44 0\0!0000 SQJ -LMD@@6S S6St0 R`06xL0S|h{ 3QAQ @QF -L,M0@S`P(r 0S R 0S0S0S R 0S0s VV 0FSqgV Vc 1 R UY @ \H @ 0R:`PKdK(0D@XK0808( }gp6h:$<<<:Fr<:+(Hh -@Lyt0`0p hS, N? , O?Ɍ LQUP1 Q 0r0*0r0P0,H0l <^*40  ^:00000Yp6h: < HhX< p-L M@4t0`V140040P,|0@ . P,ʼ0^ڰ0 ,0`0Q*80 080x0LP` `0 ?08wph<00<<0 p6hHh <$Hh<Hh 0-@Lt0P6 S \0P\ L0,  a R 8 80 ?0w0hHh <<HhMЍ -LM Q`Ppn \ 0Sd, @0V0T00SNTD0@ 0 VfF+ I+F+F+ G+J+ I+I+HI+`I+pI+TK+I+I+J+tJ+J+J+T8 Y 0,a00A 0@P0 0Sx000Dh0    _Qh0< PM0SK S. DPx% 0:0t P  #08000#60 ?0vA Px7P 0S PQPx Pro0 S0S0S 0S 0S 0SQ0s QPN  0S 0S ԿP E;08 [P50- *| 50,H0H0S0@ 0 QϠ 0# 0 01  00# 0 B 0CS0 sfg|o| 0 0 0r @0r0h0    "h0    *-5U V V 4 1U 0 Q  0o鋻 0op6h<@ TU5 0Q0  h 70S%V h0L@⁾HK0 P 0SQ  M 00 0DK 0K 0'0004#0R R ,0S00S40S80S 0, QPPc 0S 0S$0S(0S  nQP#0RU+ d%0[P # 0S00  h (50S2V h0' L0HK  #P尻P  00 000 @P0Z\ꢻ+0S  K 0 K 0X'( R 0R8 R 0Rh0 0n Rn 0  0P@. 0P0  h 30SV h0ᨽ@HKL0 P1 @L@0Sx $K 0 K0 '$00P$0'  0P@000! Q  0 [KxK0000 0@< 80(  0 n@HPKRPH@KGK0K dPK EPd@KcK0K  }@HK7PH@KGK dK$K 0D0 .Pd@KcK06K0`0 i0S 00 0^    (0 0(0 0 wE000E (00(0>000 R U00 dRP0dU|0K Pp | 0R0% *0` G0KUDHhg,:xHh? ʚ;`: -LM@0@@L@0 \|h @0 -LdM̂0Q@,0 p`P㰢 0S ,0S ,s0SP0@ShP P T2 R Vy Pp 0t0 x U 0SYdK \KdK0e PYA p0t 0R:l@KeO0 pt叻@HK@PK[O0 G0KHKSp HK00 : PW [&[xdKH0K [\K&[0Px0dK  dK!O0 c0Kd K\KpL  dK0\KdK Pp` x` Z|`g]+8:(Y*dxHh\`9 0-QLMP 0S0S 00S P0@ SAPP T \ 0 0HP @0S  0j]+`<(Y*xHh --LMP 0 p`Y (@#*X (08 S, 8@Z0 OP@1w  80S $00cg  uPU7@R 1@0 00|N08#8#$0$0 08 (00310#1t1!0S1 00 0! !48< (#( (!(!8#8!QA"A" 8#8tm#$0$ ,0H 0,0@0C>`@X , 8 N0ɽZ θS 0 B0 0  0e0e$0C0C0岽Ḹ(0S9@s㖻 0pR)000SPP0!0P0060 t1 @Pz0`S XV000 @@ t000N 00 0 0R X 0S KP$00$0`*K PkøPP+ ['000᷸PP + [ Hh?0@0c80 !<\ P!TP 8PtU"\@P P<?@1p@d Zp: T@P U \:,0 l oB ,{@0 SP,0 B,0@k -L4M0!> ?P@Pe`!8P 'pmvmz0fk00 0#000c= h 0 "   b-p 0i0D  0#000c9` j 0 "   b* 0g{0| 0#0009  fk 0 "   - 0h0` 0#000c9p i 0 "   )`0j0  0#0009  g{ X0 "   , 0fk0 0#000=h 0 0| 0008pi 00 000=`j 00X 000c< g{ 00000: fk 0 0 000c9h 0 0 000c9pi 00, 000c=`j 00 000c9 g{ 000 00c= fk 0 0 000;h 0 0` 000c:pi 00 000;`j 00D 000c: g{ 00 000= fk 0 0 0008h 0 00 000c<pi 0' 0#00c<`j0&,  0#00= g{0(0#00c: fk0)X 0#00;h 0*0#00c:pi 0' 0#0 0=`j0&|P 0#00c9 g{0(0#0 0c= fk0)0#00c<h 0*` 0#009pi 0'P 0#00c=`j0&0 0#0 0= g{0(0#008 fk0) 0#009h 0*DP0#00:pt 4i 0'P 0#0 0 lPnpP  xlP : `j    -LM@ , -<, p `b b$,0  O 4 P'e eTP hP!?!0@?PP@ ei5@Pn 5t?0S:@Pk?0S: -Lp M0`,0 @4K  b!1@T  ~0 S@( `P 0  RS  Z @$1  b!1@T(,0 S ,TTg: 9: -@LMT $ A5@(0 0 9G-(M$$ $0 ```( 5j# "< "0  0#   D 0AiP i;,  0 0  ^   `00` 0 0Q%j3 0# Ƞa,0# ,e). @ @$ 0Q." p  aƠi! " 0 @ iˠ "! 00`@P?Q  ` $0 ` `@`P@` P0` 0$` 0  @P(Ѝ9 -RLMp+ >?A @` R,: (, `4,!P`(` pl?W `\ @pG0@?W@W( ?40@(540@ -PLM, pX 0 @0K- M >}. Np >.~~΍.1@QS@@`aq  ␀!N01`$P~`Pa.(LQxh ,00)&$a9%G%ᨀ.,Qq匀円(nx%Th0vP.#^PLl G )ጫ7᎛ '(P!`"p`p`P , 0 0Ll\$1l(C|@厏 ='pp*C(`~P%`&`P`Pa0#@$^.T= }` 0`lppPCq(,ΠHD@l| 0q<`^ 0@N0lQpCpa`3` P``` P%00`&! "= p P `.M.  .0@~>. N~ ~0@TO^t^0@10  a0@N~ Q0@^  0@00 ^ߍ09 -RLM`pG @>0A! c RX:P 0!0@ R: @0S*H0P@ P p`i VHP  0@ `FRp @0 S*@0 VVP 0!0@ R:@0S*H0P@ Ph0!0@ R:@0S*H0P@  -@LM, 0 0@K 408@_`pP`4%$\'&dts?s_`  0 @ #Ƞ8!(0p$HP``,4H[0@UP` !4%lT"$ K?K_`@8`p0!#^8'$Hxa ) ,0 p\P0\,@PPP~z+,p00@ ,oA,0l Pi+ Ppld+, PP,`pPP\+0P0 -PL M0 , / ^0,40 P`0p  @ 0 !ĠP`#L"$40@ 0@#Ƞ8!(P40$H`0S40 `00`00 Z,o+ -@LMT@ , l/P*H0@ 9 -PL M0 , / 0,40 P`0p  @ 0 !ĠP`#L"$40@ 0@#Ƞ8!(P40$H`0S40 `00`00 Z,o*A-0PpP%%Ǡ% %,1d H!̒00# 0@0#@$$Ǡ$ $,1t h!̒0 0# 00#P%%Ǡ% %,1t h!̒0 0# 00#@$$Ǡ$ $,1t h!̒0 0# 00#P%%Ǡ% %,1t h!̒0 0# 00#@$$Ǡ$ $,1t h!̒0 0# 00#P%%Ǡ% %,1t h!̒0 0# 00#@$$Ǡ$ $,1t h!̒0 0# 00#P%%Ǡ% %,1t h!̒0$ 0# 00#@$$Ǡ$ $,1t h!̒0( 0# 00#P%%Ǡ% %,1t h!̒0, 0# 00#@$$Ǡ$ $,1t h!̒00 0# 00#P%%Ǡ% %,1t h!̒04 0# 00#@$$Ǡ$ $,1t h!̒08 0# 00#P%%Ǡ% %,1t h!̒0< 0# 00#@$$Ǡ$ $,1d Ȟ0 0#@D 00#@$P%0A-D0P@pP%%Ǡ% %,1d H!̒00# 0@0#@$$Ǡ$ $,1t h!̒0< 0# 00#P%%Ǡ% %,1t h!̒08 0# 00#@$$Ǡ$ $,1t h!̒04 0# 00#P%%Ǡ% %,1t h!̒00 0# 00#@$$Ǡ$ $,1t h!̒0, 0# 00#P%%Ǡ% %,1t h!̒0( 0# 00#@$$Ǡ$ $,1t h!̒0$ 0# 00#P%%Ǡ% %,1t h!̒0 0# 00#@$$Ǡ$ $,1t h!̒0 0# 00#P%%Ǡ% %,1t h!̒0 0# 00#@$$Ǡ$ $,1t h!̒0 0# 00#P%%Ǡ% %,1t h!̒0 0# 00#@$$Ǡ$ $,1t h!̒0 0# 00#P%%Ǡ% %,1t h!̒0 0# 00#@$$Ǡ$ $,1d Ȟ0 0# 00#@$P%0 ,09H0@-@P!0\#0 0(S"Ƞ0 -L0 M( @KP"h0dp 0 8#x "W 0@2K,0 (0 p,KL,0 0("x(0W0p@d;08 (#H,0T108#xW -LM((KpPj@"h8  8 08 #8 "S80 02K40 00 80 4pK z400# 40 s0 0#080 40(0"(8 R00  8 80@ U400# 40 N0 0#008 0#H40T18 08#8S80  p-LMH`P&$H ph; (-"xPUL`@:08#XU@: (-"xPUL`@:08#XU@: -pL MW@)*0K0 8(<, 4$P`  0P `b0P,`p%<%(%& &Ƞ&W0 P`@: -pL MW@)*0K0 8(<, 4$P`  0P `g0P,`p%<%(%& &Ƞ&W0 P`@: -pL MW@2*0K0 0#0P0 8(<, 4$P`  0P `0P,`p%%<%(& &Ƞ&W0 P`@: -CL0 MX4 @CpC0K20K0 8(<, 4$P`0P ` 0P,`%%<%(& &Ƞ&0 P`0 0#0QHXpG@D0 8(<, 4$P`0P ` 0P,`%%<%(& &Ƞ&0 P`40 0#0QG-08@ <4@ `|Pe%L%ȠE q%0E吕aP@8 < 4f `D0`&! 0cqS%,,E%̠ 1%E0n 00#H*j apQ% 1%Ƞ % 0 0#0a L`& apQD% 1%ȠxxD % 0#0l0P* apQ,% 1%Ƞ  % 0n 00#T`&f apQC% 1%ȠC % 0 0#0aX* apQ% 1%Ƞt % 0#0l0\`& apQ,C% 1%Ƞ  C % 0n 00# `*j apQ% 1%Ƞ % 0 0#0a$d`& apQB% 1%ȠttB % 0#0l0(h* apQ(% 1%Ƞ % 0n 00#,l`&f apQA% %Ƞ %40A1!c \p*R0 p0 0crSl% 1%``A%$ ! 0#0`04t `&! bqR%1% %$ !0l00#8x *j bqR%@%%$1  0!0#0b|< `& arQ%1%h%$  0#!0`0**<*(*& &Ƞ&`0 x*9x.9x29x69G-0@P`p8 Ƞ<̌ W4ČP`pሕՈU< |0 0crCpş$ 1$(dT $L!0#0l08x P%e bqBş$1$$$  0!0#0b4t `&! bqBğ$1$$$ 0l!00#0p P% bqBlğ$1$`$$  0#!0`0`&, l0 f 0crCğ$ 1$ $$ ! 00#0b(h P%! bqBß$1$$$ !0l00#$d `& bqBpß$1$d$$ ! 0#0`0 ` P%e bqBß$1$$$ ! 00#0b\ `&! bqBŸ$1$$$ !0l00#X P% bqBtŸ$1$h$$ ! 0#0`0T `&f bqB Ÿ$1$$$ ! 00#0bP P%! bqB$1$$$ !0l00# L `& bqBx$1$l$$ ! 0#0`0H P%e bqB$$1$$$ ! 00#0bD `&! bqB$1$$$ !0l00#@ P% arA|$1$p$$ ! 0#0`0`&&,&8&% %Ƞ% P0`x29x69x*9x.9G- R8M0 00 1 S`@Pp0 q 1ѷ< 1 R Ե@ 18 1 P յP 14 1 ^ ֵ` 10 1Z0 S$ Y N,,,,,,,,,,,,,000PTGTg#Ġ#, #<,!q 1,A.-Q0#Ga. "  "P0# "0# A !04 f"Ȇ",(1&)V0# !0#0#05 41*+|f !0#0#0# 0 Y ',|,|,|,,|,|,|,`,|,|,|,,  F 10# 1Pe  0腟0#0" 1ş " '0 !! Z ` 1 !0 1 00 0Zj( 0 1 1 1Z8Ѝ   10#% 1  0E0#0 1  " 0T!" `弄 1'0# 1  0D0#0 1  " 0 `` 1 0#P 1  0@D0#0 1  " 0( (4)@S#,8,̠ a!ßC04p!A!9xB9xF9 -LMLPp`l @T0!  Q` VxJ9G-0xMt0`P0P%p `&l0 P%hp `&d0'@p#0$`@,00'\p $X@ 0p' 0(T0,$ P  . "P0p0(t0  .)(0*l# ,h ` 00*d0  ) %* 0&\`# P,X P00&`T0  %P$`&0'tp# @,p h00'pl0  $@.p'0(d\# ,D` X00(\0  .)(0*T#t0 0,P<0 0t0* l )p P% 0h* &`"0)0%LP * &`d 0D P%`0X0P%@$ `&`&TH`p'0P@$ <0p@$p'.0p'@pl( d0h .0` . ) ( (\08*T `&0)0%XP)4PP P0**t0&0` lP%p p'0 `&0&0#`hd0 $%@ P `P% 'p 0`&\ @$0XP% (p' 0'0#`&p\0'T p 0$@0$@# .X PT (0 tP0'p. 0(0$p @ *0 (4p'"0( .l0#0.t .hp) 0 ld*( 0 h`.) 0 *(0*\ # X )" 0T0*  )P % * 0&`#t0l P,p00&`  %Ph $`&0'p#d0\ @,`00'p  $@X .tp'0(#T0 $P,0p0(t0  .)(0*l#d0 0,h0 0d0* \ )` P% 0X* &`"0)0%,P * &`T  0$ P%P0p0P%@$ `&`&l(`p'0h@$ 0`@$p'.0p' p\( T0X .0P . ) ( (t0*l `&0)0%pP)hPP 0*d0&*` \p'0P%0$@%@`@X0( 0 '`&`&pT `t @$0P0.$p0, 0 (p'p'pl d0  .h0 . )`( \ (* 0 ,)X0 `&'*`xЍG-0hMH0@p0`Lp`&P @$0T `&PXp @$P%0' p#0 '\0p 0`0%Pd p'$0@P%.0*# * D 0H0. L* 0P.(0 )"T0) d (X @0)\0 0&(``@$ `# &`0L0$@ `&D '0p @$H0P% P 'p0X0%P \p'T 0 *P%.0"0*`0 0 .80`0d* ).@ (0 0)D0H H (00T)L0 0&(P`@$ `# &)`0(0$@X0 ,`&&<\8 0d`p' @@$@$P%0D`p' '004 *0LpP P%P%.0X`* p* ,pT\ 0) ..(` @`P GPe h<UUUUA <   $ (P @0  3 p8"g| -LM0`A$0S㼑G<0S @Pq@dDFA@04 Spx1d1 R0``00`>L @@dPODFA@04 Spʄ1dA R<0 <000<0 <<Ld ꔠ匐@@dP)DFA@04 Spʄ1dXA R$0 $000$0 $$L> @ g< g(g -LMQ`&R"Q W 0\: c\pGPVWpG @lV@1  `dVPJJ:$:@:X: -LMQ`&R"Q W 0\: c\pGPVWpG @lV@1  `dYVPcJ`Jt::::Q@-@  P 0 0RQJ PQ00P00S 0@1  -LMR`@p/Q,P  U$010^c^PT UP 0  nT 1@bPTI I::$:P: -LDM,ȟh h`, d P0l Pp@Zd l`  0p  <K d 0Z d <0K 1 0 l `q0V  0P 3 "R @+ RTd 00 R0 0#0Qh`0l 0`0  `eV00 Q030"S@VL5 ,0S <,2< KY\K<K h0Q0 0#0Q*Z d <0K '+d <0Ky$d0 <Kgh: -LGM@ \, pL POoK YP 0`P.00CS"hh,hh,hh,i,i,h,h,4i,4i,h,h,h,hh,hh,hh,0S& lK lK lKY 0 lK|0 ,0S l,0 l0KmyQ lK0`}gt: -L M@0 40  TT T#T80BPP|pP0`0 s|V 4 R  0~ 0 , K h3h#p@Pw|@dDFA 02 S01b1 R0``00` D|W 00p 0 0WV40SM ,0  }W*4 `R> 0gCPQ0!0@Q0a005:c0PQ0C00",@0("@cP(|DFA@04 S`1d1 R ,0, 0,  00,  {l,< By,0  xl!,@0d!@cP{DFA@04 S`41d1 R ,0, 0,  00,  {l, l n, KL 0;x?l k`.| @T Tl  Td  T T TL  TD  T T4 T, T@ g< g@ g(g g !g!g"gp"g"gP#g -QPLMPe u R̥ ĥ0X* 1S X:0S 0= 0X9 0UaA `m{ @R  @5 # G{P  00CS, o,o,o,o,o,o,q,q,q,r,r,lo,r,r,r,r,lo,r,s,s,s,D ?. !P0@ 0 P0U`(DD@DP 060#0 ?.P ?.&"(  ?.!@ b("(L0/>P 0j0#0 ?.P0 ?.&"(  ?.!@ b("(0/>P 0\0#0 ?.P0pm7@r~@0S l? 20S 0/>1 0 ?.! (0 ?.&"( 0\qXATql @0P  q 10A q(q&q$Al 00l P`d@ r P@0`  !lR0 S00v<<@ g< ! b1! `` ^:p p-L M``0@P$K 0 Z0$ $0K  00 Q &pg:  0 00 -LM @00`XpW PU (<0L1`0/1"b0bS5T 0 k*P:$0WpW6^ 0lP 0 R h00h0 00pŏP@0000 0=*PT@ H0$=<=70 SQ,::: -LM ^0 , 4 `@^ p (<0@4`0/1"b0bS 0 R0011(pX R ,K 0児P@00iT<0  0)P@8   0P4P - 0 R h00h0 040@_00 0P0 ,d T0S堒,<00<00, H ,0 0 R0$0 \R0 Rz<0PS( P"?A3cPg@Ÿ80 0P= sP. 0 R$ < Ġ /0 0\0 d0, 3T0,L,<00<00, H },0 0P <h04h0T `P<@0  '<<@,P 4 R 0&)겐0,0  <@0=;<0(0CX0/"b\0P T;00x0 04<,Q:,::::L:p:::: -LM 0 0 $5S @ 0dpPPT 00CP0  A0`TPVXPK0K  !PpK0K !P0S  P0(00 0  E0`S 0!0 Sm @(Ÿ  0PpQ `0 V!P0V P`80 VP 0 (0R- Q0S&  T0S 廏` VP d00 TQ[0 d03T0`80 VPNK P000Q 0 T 0 (0Rŏ  @`0 0K@ŽP0H00 @A 00 K峎P0 @DPH0c 堏鐮,<0 R< -L M0p00 00 P0, S j V@ 0,T@# V L#0S 0C0Ÿ 0P 0 T 0P@q0p` 0S  0 ;g: 0Sh0 0S 0Sh0Po0`0 `; 0 R 0h0 0 0 ` 0S00d0X0 0S``l0P0S 0S' P00SP0 ` 0S TP 0S``l0P0S 0Sl0P0s  0S0l0P0:ll00Sl0  ,0`@ 0P>:D:L#0S0__@L8,:(:@:`::p: -LM P@,`:0 64 20<  D D@/">C2"/P!008BS@ C4p?#@W8 40$tDCY8 ,0 <  004,  `T@,P@1@#W<P@1T@XP2@p"S 0 S08 SL3 R2PPP2@p"S 0 S08 SL3 RPX P"00 SPPP#00@ SPDpm,@PD `P"‘\00pS04pS ࠡ`P PP ‘\00@S04pS ࠡ`P  - PL\`@pKP 10SBt0 0ZF8 0 T 1P-9@ E`,@(`<VP3"0 SPPP#0 SP8 0`X8 T`0l!`!R @ R D0| 2a @`& -LMPp  P,P ,@`VPUPa 0 P` ,@V,0`VP 0 PP`,0UPV -LM PP`4  T 0cSP\q8 0 B0C0 Y0 0 0! d ,K0P@,H"H`Q@ 8  3S 2 0O [0 T0XP<0 0!8?\>`0 0/ ?> 00cR#@[ P80iW00\!8?\>`0 0/ ?> 00cR#i P<PX!@!400C40 g!40040T0XP%0 @?Q>`0 0?>0 0c$00C$0 P B 40P 00C 00@0 00,= ,x,zTU p g -LM PP 4 pP0 00W~ 0 0 ! 0d 0,K^Pl,"H`0S 3S GY00W "0O00W T08 WsW@!40 S@TTA 0 0P7^!?Q>`0 0ς?>00c ^$00g$0 P g 40  0W0g 0 40 g0C40!400400,哊$࣋,Y,ދ 0 ,?:0 8 W00 ?Q>`0 0ς?>0 0c8 ^$0g0$0 P 4  00 0 40040,_0 ,U p g -LMH2@Q`0o`T p P 0Pc (@80  P(W`@ZD  000C0 P B 00C0\%@1R6 |0P @P0 0` PE0 RX0  200000C0 0 RT000T00C000 0哢 800c@}` Z"IP U T -LM `Tp 1S0 0 ! 0d 0,KP, 8 80"H@0S 3S 8ފh$% 0WP0SPU 0PG0UC0SPEUT3 Q, 8 Uʼ000 3 P@ l?p >14 PHX P0 ^ 0 S40\4 \` 0n0rP02U8(@8  P80PU,080 , 8 8180``0P,080 ~5U : -LM `pP4 PP00 0 0 0! d ,K0LP, ,划H Z8  3 S 3 0S P2 U0O@ @P> Z!\000/ > 00cR#< 018 a^ Ϡ\0.Q 00/ P  p1PR\0/ PJ @1 Z\0`000?0Q0P PP1640.Z\0!00> 00c# 00 0C 0  P B 40 P00C0 ,k0W W0 00 P 2 020 05U p g:::: -LM p`0PR 0O0  0548T 0A0U2Sʼ@0 $0X: h5 0`ş R00p  D0400 00 ! 0d  ,K0QP,,$HZ 3S 94 0O 00U 80A040 ?80 d448Z`0.!48000?.a 0 bS1P4 0< T0USZ% #@?T>`0 0/ ?>1LQ 3T`0 0?>0 0cZ$00 0$0 P R  0 0 0480  34R`008008?.a 0 bS1P< 0 2 `R4 `0RA P00,b$08 0a$08P×n 0 0n 00000 P 000\%1R |04@P@P0 0` PEl1 RX0  2000000 ,1 RT000T000 040` Z`0PB P! 0 R`0  0K000 P 0 000\%L0R|0Pk0 (n4( :P:h:::U p gT::: -LM Pp,0 Ww*_0 0 ! 0d 0,KP@, ,!H`X4  3S ч`1 0O $414AQ\000?00p S28 - 08X\000/ 0100 0W0p50 0 0  P 0 P00 ,Q00C0 P B 20C 20< 3=S0 22U p g::D: -RLM`, p{ @?Q1 Q`000.,0Ae8崁/.  b  B020!%Pp1 @R, `08P/.  b  B020! P5 00`,,08P0 eS0Y`0.!00/ > 00cR#0@g0P 0 S P Q,0` V3X2, 0@ L38,0, @/>QU 1 E   @$?p > 1^ࠡD T! 0  S \ d@E? >j1^࠱D T!@  LP \l0 \ 1 Q0 110b1X10l1$5S!0SL\ T3Ѝ?>1 E -LM P@P 0 85 0 00 0 @ R@  PU00\pP@ ` VV V 0 4R@_i 0SE:0SA:0 @T00 T00S  Rʠp0(`VP@PZ P@P U 0S:0S: 0S @0 0@PPV8 8%0@P0L 0`@V \  0PP (0 P0@ xK P`@ PP 0x0(     0S:20S/*@5L 0`(0 @ xK 0vPP \  0PY 0d x02T0 0<H @0@P0`|0Kd KPP | 0` B| 1X`tKV P    pd0G0 0@K@_PPO`@K|0H \a V pQ @00xK  PP3x`0` dG0 P d03 T0 d0KH<@0@P冄PPP ?\00Sa@  r忄t`K V@ *0 a00V@:Q00 TkD 0 Rh00dh0   R0ad0F0 K0փP `0KH ,y 0 s계 RV? P0! 0xK 00  zPP x`P` 0 0PZ d0 3T00 P00!a 20<H 0@Pl Rt 0 0 K0jPPZ0 @0b0 0 d03T0 0 T@ 00xK  PP;x`0t` 0 XP d0pK3 T0 H<0@P咃PP"` 01X` X0 0  (0 xK00 @  @UPPP K@@000x1( P U  U ҃S>00K L0R-PK ?@K 00 KKK K0P00@0S:0  ..::- M ЍJ -LMPT`$ 80  000    0 08 00R00S 0pK[  0 R 0U 000O 0 R U0D  0 R 0V( 000O 0 Ry V0  @ H0P@   0 R 00 0 000 O 0 R  00$ H  0 0\%1RC P` 0p0 0 0$@}x`0dCA0 4K0P@@0Q!.xd40 H 8 R T0$ @ 4岂4^4,5Sʠ0' 70V0   V 0000uU0aU 0000RT : -LNKgMTQ`U@|a 8 0BRS p 0S  XQ0S R PP >K ᧖ 0P(P,P4P 0 PSlQ  0.K0T1QSNXaqVJlT45S:05XS*00^K01 `qS?K 0 0PP 0 R 0^K000nK _ 9q L弁000  0L00K0K @lX850p1  0 R 0~K0l^K000P `P~K@ 00@.K@`Klq8Kt 0KPSo`t0堀 p0UOl0 t $x! t!t1 aR00X0pPK@/0Sjt!L Rt! PC@KBZ 0S1( ? 0p0 \aQ  `!P 0S!0(0 0p0p`P U pՠ000  0PRoK p 0S㠀1( ? 0p0 0 S0p (0P UP@K p 0S㠀1X ? 00 p0K 0 SpA 0 X0PU 0 R 0^K000TaV8+0  XK@ 0 l`PtS/ PKt0 p0QO0@H K㠀t 0S t.Ka00h1dA0e@K 0 RYtPt Z\@ 0T PQ 0SG 1p0.Kh1dA0PE\!0OT`aS\\6 0S `a.K1p0h1dA0) \QUlQ0 0S ^K000\aVBlQ0QT @aT pՠlq^KT0`Q3/nK h G|a p堀d|a 0S ^K000 0 R |qg /0 00| 0- |ah00fh0K0`q WNKlP  p 0 S# 0S:0S*la LS>R-`0 .K a0000Qꠀ 0S:0 K0w`a VjNKlP  0S" 0S:Z0SW*la LS>R-`0 .K a00D00Q= 0S:0 5`^K1( 0O& 0S!0(0 1p0p` U pl P01R/0 0S:0S :l0@h  q| pࠀ| lKS>0 lAL R-NK ?  K00@ꠀ 0S:0 1( nK0O`!SlQ~Kd @FP@tQ@K  0 K@ (|P1 qPpq R| P py 0 R 0 00l1h0 |AxQ p堀@|A c0t 1X t^K1X a0OPXqW0K0 ta0R00X0  p堀0^K000>l>KP @@A NKPp` S?K 0P0 PP 0 RY 0^K000Wl0@ 80S L1pqHgL厀 L~L VlP f p 0 S# 0S:0S*l LS>R-`0 .K a00@00Q@ꠀ 0S:0 0.K00K0NT 0( S/& 0S :0S:(0S$h0S! 0S 0(pS   0 R 0 0f00` 0S:0 0TaS頀Xq0S0TS)g<: -L4M0 `0 80 P T 4 0\ D H0 t0PHPU H 8XH00@ 04D@ L@ 5< 00 ]3 ,00,0<0<0 <80&Q0 < T`妳<P@8<|H, 0P UU Ud#U80B``^pQD 00 j^0 D3thA@ T0$ @<}P@T Dt H0PB4U 0cpaPEVXHUp 80SRHfaV3D0S) P2P"@DP @dH^DFA 02 S`1b1 RD 0D D 00 ^P  TDZ<00 :00}d "L0,K0)P @,0TT T P  0R0d ",KT0P0PT0 ,0@P P0L0 00P0 <}u D X @UI U  UD  UA U Up  U:h  U7UX U2P U/<l}0P0(g@ g< g@ g(g g !g!g"gp"g"gP#gT: -LM @0KPP0 K 80  P 0 5R/8 0S#:0S:0 00  ,K08|P@8Q,854H 0 80, ,} LRS>-0`pǏ00  0S:0 A-P8@T`p T ?>00c0Q3@T TX0X  0S  R1 018ĠS΁D 0 Q/0D@$P4`P05S`P RD0D0 0 < $0D000@ <T06PD P DPDLDP ,;D ,LDP#OPDx#PWX00 9004X wX040 aghd^9TT::::E-0 LS03R %5p00P5,5S ڬ4S9Ӭ4հ4S@0Ӱ400tA/SpPo5@"p%$\ZH0L0SO/͎ -L M$0Qp `; P@ҍ X00#00' PP@р L.|  0Y 0Q @ P$0ԑ:$0  -$0L Ppԁ  ~P@`@0 S@`V kP@P @ 40 0e@ < -p`P\LP0d -40( 8$@<( @`@, T0C0,0VZ  !Z MBl  D D"!T: p-LM80@SP0 0hl0S  ȉ`V p  00S0 ժ\ -LMa@@ -RPp =SAT8 K8 4P , 0@  8p $0 #=0T00S<K <0PpST 0$ @ ᄦ  0嶩0S  p@ =SPp! -: : -LM4 q8  |8 PU4,0KPŸ @T`0T"0y p@00@0, `,002 0zP@ ,T P0 0 0$@x`0dCA0 0K01tP@ ,0u8  @xq00 H 0 u0x00p1 4,0K\P@A 0S@@l0P0S 0S1 6P 0S@@l0P0S 0Sl0P0s ,0T $000\%0R ,08 0,5Sʠ 0p00t0 0S0l0P0l,80080PLhL5H sP5,5S,>QS. t0s0P0 SHŒp011pGW}s00P000 p g p-L Mp@P0Td``  pH@`< 80`@ph Oed<L-0`ɯ00  0S:0 0St0p D@ S>L0R-P@K ?  0D0X00\0 0 040D0X0 0\ *<0 0S:0 <D <d P` yUv< -L\M0 08  4 00PL 0UT0 p4@80S S mT8l  8 0l R0000  0S|6d t6X 0S 0lS00S 0 Sl 0< S"4%R:05S:8408 0P0R00S l  R:0S*u X 0SD 0@K0T`\ ^P <0l P <8@850  lX!RPPl00@P P H P0,KB0P8`Pkl0 Po 0 S 0S:0S* 0S l 0@ 04 R0000襅L 4}, Z` @0P`<  P0  #Q 0S:0S:<@00e`XHH8 P`\0S<@H0 0Sf ,"qX00V0S8P0008PUkXQ0 0S 0S 0 R? 0;08@PXY4z L^V T0@0K@\0@8@l X b0P@88X0Q\ R  0` 0;080P1 R 0, $R0000 x,p,Xp,0H Hr< S>0LR-pK`@K ?  pK0 0@ @`K eI 0S:0; L@DK 0 `@wP*D0S'\ P P`XW0T (Q  R 0.SR 0.SH0P 0PW -L8M0`\@ p@: \@7 P@0< K8\08 pPP P@@T0( R)0[*0[S""[0R0 0R@ R |@00T@ K0P@ @P T @P{@..<:- -LM@ KP 0 0 0-@DP L@P00 4 0 0 -( L0S 00#Oe 0-LMP@ KP  0S 0Sl0P0S {F0000 0- D0@L PP0s0餳< p-LMP0 @B 0  P 0sx 000Hp @_ 0S0( 0p00A{0@8@j|@p餳<0 0S00D d< X R  0S 000 p-L M0@ `Rp Km0 R= 0 00 0 R  00 0 O0 0 R  00 0( OH0P@ 0 0 R 0  00O0000 00 0 00 H  0@0 0 p g -LM`P@2 80SA-A-A-A-A-A-A-A-A-T0$ $PV 0Sh0d `0X 0S  0S 0pSt   0~  -LMp0P$K`0 R 0 00 0 R $00 $0 OH 0 R $00 $0( OH@0  0 R"0  "00O0000  0 * 00 0S00p00 0 0 R00t000 0 R00(0p0H0 0S0000 0 R000 0(0 0 R000D0,0 0 R000(000 0 R000@040 0 R00 00080 0 R00$0H0<0 0 R00d0X0D0 0 R00l0P0@080S; ST04 $  L 0S 00[D080T 00h/4[8$0Hl0 00 $00H $0H0@0  0 KKp g -LM@P0S` p0s 0s0s$0sH0sL0s@0sD0s3 T0$   0Sp00R P R 0Sd0X0 x3 R 0SD0D0d0X00H00D Q  0 R00#d#X R q T0$ } 0Pt0s4  00K R000080Sp mSf 40p0PT4,0S:00 S*(qI T0$ C  0S00p  P P \0  0἗P(q00000(s00 000Pq T0$   0Bu  00sT0$  S0s|0sgr 0Sd0X0?D 8#8S: 0Sd0X0#8#888d0X0  0S  d0X000d0X0+*g -@P 0` R00p  LQp P,Q 80S  % 0 R00tZP   0!:0 000000<  0  w O -L M`q@p  w 0 Sp00R @PP   0St 0, ,0  0, S 0pShZR0 PP  00   0 R00tpp 0 R00p@@PP00 0PP( PPPa,0SZ000Z 0S 0;0, R 0S 0;00 0 0 R0, 0, t   0 R00pwP J00 o og 0Sp00Tc 0St00We P^W 0StppK 0Sp@@A \:E p-LM080S 0 R00 d X R  0 R00 d X R `T wwpw 0  0u` t  -$"LEM0`,0 8 Rpy T T0RpW  TPcP1 RW 0Sd X 10S W  KvT1 ,0S H,000000000 0P 0 0C000C0000 v w MOK ? 0UP Ŗ἖ᷖgp:0_g -DLMM`0 P,0  0H1 HQ9 H1L 0RD0R T DH!0S< L 0S L10   R 0S 0R H!  0SH1  p00S@( HP'uL$u?uYD!000@!8嚑PD0 0C0 RD  00C0D!00008u0: S Y@D 0 RD00L H"6T!R \  P@Y6 T1SL00C0HT!0R0C0 L 0 RL  00C0L!000H 0 RH  00C0H!H0 00<1 0P@~u ǿtKPpP1P 0S 0 0  p   0 R  0S00t000 Pp  Pp n 0 Pr r2 ,0S ,0000@P1800 00000000 0PpdT0( 2RSOK0L1  0@! U/K  < PpE 0 R0000 0 00 PR00002rT1H + 0Pp3T|PpMOK 2TP 0GpW y ぽ P10o0 0C000C00000000PErTH  0S00t00t07g0_g :<<$< -LMPp@` Vv |0S !rr00S Bu 2r r iP 0 R00D!d1 1@R#P P; j!!0bR0S- PP0S$ P ]PP?>1!E , B 0H 0C0,OV$0"Q ,V -L M P,劂@BP00  0ƕ&0,KtUP^,0TH(` (`>1 1@R#@  d> aq HP/ 0lA0 P@P.!1D0,0C000*  R0C 0,& 101,U(0J"p `P;  $h ,V:::: -L M @`P`$a U0: I , &$KTP$0$`Hp3?> 1@PR#  0,0 00D 00$yU$U;  :::: -L M @PA \00\0SC(,6倢0 Ɣ&0,KT0S-,0(H`Qp Q ;  ' 0,&0 00 00 Q,& 10C1X0,U< R,WU; j h$:D:p: -RLp`$P@ $P`A0Qd 3P 0l1 P0PL<P @P; q :::: -0LM ; b: -L|M0   0 Q0p  0 Q0 Jʠ a0(@T &0xKSPPx00xT(0 v|K 0 PP  | p(0000&0PUx &|02T0x0 0x0<H=x0@P0Kd KPP 0` B1 X@t0KT0   d0H& xK0SPPNx``K H0QA T  nT 0 |K  0BPP/ |@dH@ |   0&PU 6d K3T0` H<0@PSPP0SL 0A xSxSx,T0t@KTpL:Q! *0P ʀ0dKA`0&0`Tx 00: 00xT0 @PW 04C0 00 000Ad0D& xK0RPx `0KH xKSxS 6Tp:T;0! 0 o|K 0 PP |@@0| 0 pA xS0P&0PuT 63T000<H30@PxPSS0 &K0RPPT& 0GT 63T0 0 |K  0HPP|@X@t@ &0P(Tx p0K&0 |02T0x H<x0@PxRPP`0| X 0X0 0 O: -L M @^ 0    Q -LDMT@d ` d0 h P`P刀ԡ 4s@h pTXpKU\PK  0JP@sQ\ #0(1( `!R0 0  R` Vh 0S ,!$0(0Q0` 0 A1QXP\ p; X@i T3 UR00d04  0 S00P @  H\@0X0T00S 0S $0`V * h0^1 ,1 S 0DS\0 pUR(0` 30000$ `V*h SH,!0 0Q (00 3&T00 彇L0 ,00,0(UP@ [R SPg@-0 : S l0@@0p-`P : S R0V@l0 u L0S d@0  dPpVu -LMPp@` R 0S 0S1ST0$ %$K̤$  000 >0 ֆP 0S  Zg 0 0 p -LM@TP$  0`K፤0" 00 T00 0 U00 H 0@0K0\ [Pd l1ğS t@t Pl1 xU:h!1!@PC.@dDFA 02 Sp;1b1 R0``00`.0@h!P0S:`!0S:PP R d1Spt0a0 d1 ,0S ,807 0.$t  㝺l 0t!p! i ᓺ`^ @TO Tt  TJl  TG T TT  T@L  T=T< T84 T5g@ g< g@ g(g: g !g!g"gp"g"gP#g -LlM0 ` 06t0  h 0` d0 @l@ , p @4 0d `嶀h@h0@ PP<0 X@ \ h x  4T0$  00CS4` UPPPl 0@RR@0 8@ H0 D0 x\ 0 008 H0 4 l0TS1 4A0S-p@L@ pP t t0 BOK|  @K  0 `@X0 S0;04p N06x Rc 04d ~PP!0|@Px0lx00S, 400 KT0PP 0   d@Q 0Q 00 R _X`\ 4Xp  060044@00@0` , K}8\RD<pD D0H<  SG00< 8 0b@0 ?4 /P#  |t0 0c p ?J@_UT pL ,K/0 PP <:: 0-LM0 \P&@tl  00\\ 0SP 0S<P00 $@,:L:`::::: -LSMh! #hA0  ,0 6(@Kp1 34  L0S㈀ `0 0#60C SL--D-$-D-,-D-4-D-<-D-L- A?(K h1KK  _hAx 0R 00l1 Lp@pLEh_SK 00LKGTK@l`X WKT lUK MOK \A @a 8 D Pa K?P@`Qx0 0R@`pd0S0@ 0Pp@d ` px0V`0MKS >K>Kp @Pl!Ծd+0P0@0|0S i|0`P/VUh1 0e@ J H F D B @ > A?(K <g:,:<: -L M@0Kx RK/P 0~000Kb0K/P(000~000 -LM@$K_` 0K pP$0 0 L0S, `0) 0#60C S--8--8- -8-(-8-0-8-@-00$~0000000000 0  -L 0P 0,S 0HMLh Lh -LM@phN -L0!&R 0(: -LM@!00CS  h驭L: p-LM@!VU`"S Px P 0apg 0!R  0! Q0 00p::: -L0!Qh 1S 01 0@^ 1 ! 10@0^:: -P@0L`$ 00Rp0V $ Rr   0h -L@\p`P 0LS0 $ RU0V $ Rr U  0h000hT -L M$$@ ( 0@:dC@0PhQhOe -0qLM|0x 0PbU|07 1  P`5 t䠟 R0@0& N P `0S00@@ x 0 0Q0x h p0Q0p  b@EPhH< gOeXQh:4: |00`|0Ph-8p0P0 0Cp  0  XQhPh 0-@LTP 00ST 0S 00 0C 00TTp  0pP0002 0201@XQhPh -LM 0@S@0 S p00Cp0PhP0 R0S2B "0 -0L@pT` PU  PR00R00SU@TPOe p-LMP P` P p@ ? `202:$, -(0AL0$1@TPop 0S @TP \0@S000@`p@ 0SxNh p-LM0P@ R*p0@S 0a!p R P 01U`P V000V00C00S R000  xNhD:`: -LM @R)(0 Z$$ aV p@P0S@PUZ0`tV$ Zc|oh?p00Cp0@T   l90 0*V U  + V U 000"U  ` 0```W)P@ U  000  Q9kU  0H00.^@?0 L410411Phg::: -LMtϟ@ϟ R   *0 P0@ < D 0 = DKP. 0@8P0 S+80 % D0P  4S R0 0 0  (0S   ㆖DKΟ000( L Q00RP  0SP @ $0  0l ` #6P`1`!0CLS00 p P   0Ka0  H 0B0@P 0V0R00S0 ^ PUPPU R 0, 0 0cp @_0 P P   fp XP@ĐKT8 D0 KP00 1@ TZ0(Q00S  0S0(\00S0 7 0@000̠ ,00 @0K40 b 000P0@ `K 0 0 0S  P@P1sS@ TZD0X aDK P@ P00 0R0 P 0P  0S U 0SAʠ000 0R0  D00 Œ4 @0 P 8 j(ʟp h0R  {- ^ =$8@ UD0/#202^)@101P` 0' 0SVV8 'V ɟh0p R000 000;$ 2A020@ 0Hc000C0 0V'P  $^ 000C000@ 202#2"0A 2"`M8 ֔o T R`  0` 004 ``@T" \7 L01001VTǟ0 10140  00S    R04 D0 Œ0@-P 2 C028 ㆔p h0Rtቸ2Q X#2 C028@ iD0Cm2" 2  00!6H 0```&P " g#2H0222020 g'0 b' ,2202"8 ğ000P` @| 0@@Q& Q00V@@T' p 2" 2028 ݓV 3Cp h0R 000iß 000ҷp 10 1 x101"022@ 02"0@ 0 cH0꫷22 L410418⏓Ÿ00 00 ,0 0K P0@0@0l4 p000P0 0 0K P@ P 0"Y800 0T840 S000  F 0^0P00 @%ST~22  <0000 $r" 202l)0@ 0HcP T@8  T0 R !0 00040 D04 0Q 00!2025H< <::(:g4:@:L:X:PgPhQh@0  00ĐK p 0DK P@e0S 1S0T01 aP 00S2! D0!000D0 00RD4 \ 001@Ta 2^00S[2SW .!S@` p+~8 u v1D@KPU @ L0R:P0R:PUJU  P Q-Lp@`: 0PPJT: T    -pL@P` 2  h) -LM` KP@ P2 T *$pK PJT: $0T: $0T*D0S `$0#&R :0R*0a!(0 P ~ QThd: -LM0 P 0 XU @p`6  P 0$  cR 540 X(@ 0  @긑  00U X 0  㠑  ` 0 X ᑑP000 `  <_9" -L0P>@0T~n@@ p`g0 @ \L 0T0Q00S ,0V 08W@3H0>0 S   -L MR,0 `LQp   *0@T Ö 㼛, 0oi0 0H<: p-LM@ LQ,00`0,0**+0L1pH<0 00@- @58 0  0 @2(  0P 6OPh p-LM@ ,0$ ph, L0*0HPUH 10`S ,0P04,0{$ 000pPH<Ph: 0-LM@P Q 10S Q\ 0Sl( 0P P],0 0 1C0S%gPh2:: g -0P@LT`p , 00S @TV 0 R@W m!@U1S10S SL0 Q* Qp `0SP%g"PhX< 0-@L ,0P  10S,  00D 000L,0* 00h>Q0hPhH< -|0LM\ d \0+ KK>S$4Z!G PhXQhTh: -L$M8 04 S8p0CP~:wp 0`ZC%Z0>0>0S1#  ~0Z@ p<0  40,K@ 5 P<   X00 P00S 0 X3ZP<@e, T @!8 l< P d0p` @000 `O0  NP0000,h 00K L00  0P<\ B .H<<_9" -1LM ,0 0`Vp,@p娐PLA P 0_,p^,K 0  n TP@ 0F P00(QhQhXQhPePePePh\0ǠȠŇ@`P'0 ` p P`P000U 0 0 00 0FP(m PP @:x:: -0ap #6RL`QP: P@ 2% " ZU:s"@T  P PU@  0S:P 0S*2 "!6L! -0a #6RLP Q@: dPJ! T: R p$`QV  @P 0S:Q 0S*! -LM.0 L (0K^ #̌P@# 0p` @@TPD ,1, UL0`pc!  0 B @T  ~0 04 mjzZEUd,4H0 h p0S %,0 0EH<:L0℡~(K0p!p@0 `P `@@PJ<1, WL04 c P` e0P@  4 `)W00S,,4P `ܒ0 @@@q@Th40 44 4 zG坻%XQh'H<::: p-LM΁TL0K! 0@`P `@2PpXQh' -LMPNPA@Tp`Lp,K, X0    \$ 0,奯LXQh':0 -L`@PT@@0p*v@w p-LM@P`*phe -`L0S 0 !,B$ R; 00S000@T \p\P 0@0 T0,  S(<@0hڋQhdHP `X0 P L,@TP8&0@$dXQhPhfL<@:H<RhShp: -LM@T0<<h,((x  T1x@0CT1hShRhXQhPh -<pPX 5PP 0P00 <_9"H<Rh|ThThRh0@- 1@P, \  ^:\ $0S 00000S( \ 0^5:$0 ^%:\ 00\ $0S\0000 0^:ShTh -LM @T`pP 0D @P Q0#03QP U ,0U 0S: -LM 0@HB@N@N@ -L4ML0 40 0@\@K@ P*0 P0\h\ , KYP, V,$0 D V* 0P  Q0#03QP D0 ,0R 0S:D4 Z  @PK0@400  D`@pK00K aP(Q, 0S:0$ R:X $0R *0S!* R 0S!$0 S: 0S* R 0S!, %*Q $ 00\*\0 5@pK00K #PR,0 R/*X $@pK0 00K P0D 0S*, , R 0S, %*0S05,0 5:$@pK0 00K PP`Z0J0 0  @ Ռ 0 Q,0] Q[:D RQ 0SD 5$50 5:J,D 0F ,0RD $0 ( -L MLP`p V `1Wp!V`!, K00 PcP,0@ 0, R0%0%0 0 T0,0 N 0SK*$Wh: Yl` (0S .0 "6C0 D0SN40F (00 RAs2 $ tp1 $ L0( cc40 040( 0S0000C0  00, 0h V0 ,@ @ 0S:,00 0 m0 $ L0( cc$ ȳ0 $ D0  $,@ 0V0S00u  R0ԑ00đ\0 0R010201<0 0R*000000%gPhX,0 $@0\A 0 S:2\7*Z`!>20K0  0 @P 00 >2Q2^:40`, R ,00C,0,(0,?Z ``0K |0 0,0 @p` -L$M`4 :#:S @>0. Q< "&0@ PD  H D Hu0 KP 0D0 8 0,@PL@  1 0<S-*$<0Q*0 S` 0S]$04 <S1& (0 $Q!0V)0K*)K jtuVp:00L00 S  0<S: Hu4@ }DL V8 (*80S0)0K 00 HaP 0S)KZ )0[ S  )Kjp:uV:0 , 000c P ) K D  -LM 0  S 0` p @ 40S0@0S0 (PU`p >0~pW  0h:#:S P:SQ:Q:J q   `PS7 5  0 &P 0SR  R ,0( 0C,0  ,  0 @`` 0K P000 ^P q ,0 0R,0 $ 80SS SPS P9 QS@@S- 0   000  : 0K  0=PH  10S     0@ |0 ͳP80 J,0( 0C,0 : O,⌘ VʦU^  R  1 0R-*  (  -LM`P@1/ 0S, *"*@S>0NPb@` *T p  004  8t, KP,0$ @D P )tZ  -L Mp0*"*0>0>0SpbFZ@ W>: W< @0` P000 `0 sP0000 0P ,0KE0  ,Ps0  s<_9" -LM ! ^>0.@  aR0@  P@ P @@ -LM*"*>0b^@0  LP@ P@ -L0 *"*0>0>0S b^ h.h.h..... 0   0P  0 -LM*"*>0b * 0H ,6S# `p0d$#&@PQ : 0`\:P  Ph -LM!>0 a 0* P   -0LS   0 ` P P # -L  -L,M00 R0, P4 8 0@00 0S ,0>0>000  #20#0 Y030"8S8 p`004 $&80! 0 0, < P@<X0Q9 `p0 @000x"`u0d trP000@- 42 H)&R R 46S  @ ,  0Nr,0 0P@, 7r\ 0 80S 0 @ T 0 < <\ Tlj 80S   |0@ 0 P 4 00 T|0 0 , :#:S 0p$<_9"Ph -p| '6Jh0@@``LA@HVT 0 S @T 0S0SXQh2S,2 R 000  0 " "00C02 0 R l0 000 202  B 00 0202 R  0PhxQhQhQh2-0C22HSD000   202  B xQhPh -LM2@ P0 00  202  B 2 0h0h0   @@2402   " @002PhxQhQhQh2 03 R 0+ 000 202  B 2S2 R00|00 0h 00  0<02 0   R  0QhPhxQhQh202Ҧ202840 #Q:0 Q: 10b1Th -LM , 0 "X00 ZY"0@0ŸT0d0l h`x ^ `Y0  a0<"6AB4  8 3v0YCQ< <0 b40Zi8 1P0@8 04j Xf4 "*p@0&04`  8pj0>00 00>0 0 0P  P00( ,0d 0 @\00`T@@0DPXL@L  00 0 c8 4°XQhxQhh<Шf:ThB}ȨfPh̨fQhl<:4: -PL R: 00B 0 0 P 地PhD: -LM,a> 0R^PA0 pW 0gS*僰@`0S:>0 N@ T *$PK0S J $弡T:|| Ph5*DD@0>0>0 0p<Ȩf̨ft:Rh 0^ 0 ^@ 0R:0^@60 0 R   0S 0C^P0@P0UT 0R( 0R0S*0B60 0 B0CR0  R  B0^P @P0U 0R*60 0 0R0  R  B@0^P @P0Uh0> 00 `PP00 T Z !0Z050G Z, `Ph0dp3qPU,  Q 0 0 00   #&h:` !0 0h `01 P#&:h` P!UDF Z,<0X ,00 o7oh U00R0S 0̠ W0U0V00S 2T 0  TV U0P0UA P V ? 0!6 P0 U00R0S  0 0G  0 0 -`0@LTpPP P W* 2$"  2 02P10@T0 $C02 ^N!202ꩌ2  0 p   0!6 @000 X0 0,A0 0 0册(.Qh -LM800CV!   bp ` 4Z00@#:0#T7H@T 0Z0!02 02 @TX 00 \Pɣ Р2@ Z00S ٛ!2022@02H@T,]g$P,8.X.X.X.X.@.X.X.X.X.X.X.X.X.X.X.H.X.X.X.X.X.P.X.X.X.X.X.X.X.X.X.X.X.X.`.h. -LM``@`0L pQPP HP 00Ȋh֩0 QXQhgp:PhU`89R(,J 0QhPhPhQhQh{: -LM pW     ? W̠ b -@-0@0S0  S  R P U ' pWK 10 1 @0="0Q/S 00 0C002"$10$1 01001 @pTR 20p00p0Yd1 0R1000@ 0S04ʾ0  h p0S 0 l h0R 00230X00 \ P0S P0KU q 0 0 PPP Xd| Wx \0KQ0  @h(41X0P41 0P@ ` K0K0PXPP@P > Wp  402"  Q  .ڙ  Rg 2d0 `0K$ T  T ޙۙ˙202&08! W8!  2  0aD h0K @0 0@0!6 k K P 202 @@ T  K 0 !6D 0 P  ' 0!60P P@ @@ 2(10(1,10,1#Ph -8RL101@@0T1A d0SsqP1d0Sf@D 0 ^pc@dlh0PN 1@T ZW ڸ X@ ZW"0S00 0C00"`Zھ" 0 P  W<1pG0<1 0!6 P x2J02q J `2"02p T00R00 S n8,P101zPhQhxQhQh -`LM Vj3PP >0@^nPQQ:h(0  0aS 0 8 4 y \v,$&R:0Ra0, 53:q 0,&R:0R03:0S @,10a%v1P12" Q4 0*R0# Q 8 P, P\ , 1`ABP2#40 Q0!0000 00C0" $00C$0"0 2b```"00 PP,00S ,0 4 0 < R@0RD 0S$k04PhThXQhQh -LMpt@T' P`Q0000 0002g00b0@]0$ 0R@0$0 D @TiGXQhPhl< -@0LM@T 0( T  @<: p-DB MLP8  $ `  0`\TP`PXL `0`0<Ta 0`|t`` 0`<( a`($a! 1`<0!,148!t0dx |0hxph0L!`pPh:::0:l::::D:X::::H:d::::4:l:XQh: 0-L@M 0@d@@c P0 S@0 P!\0PPPʖ@Tx 0@ d P埜X Tx0 P嗜0h?8Phf:Uh gQh`d::fTh::Uh: -LMx`Vp 0W- `V0pQ`00 0S 0  00 00 `0D4p H$ Q0Dd00d00S 0  00`V 0S0 @P@dDFA 02 ST1b1 R000 \efPh< g@ g(g@-0\ P p@@4S DP \Q DQH4H40H4H4DSDd00Cd0fPh -X0LM\  0R \ @ TT000@ef p-d0ML` @P0 K@ @P0,d(4p f:-X0^ P ($\,40\DP ^f -EMLPM0|$ ,0  pb0S S dnP@,P `V FK@0D @P4 L$ p t H )P@dd00C@S񟗖....P..d.80S|0# @ a3 ,0S |,p(PP@ @ \@rd P\md#vg00@d80S|00 0080S+  x\ SdBK@$@0xcPP@ 80S \d\dm<J0nPP@ 0 K@\ pdPP@  OTx @tB~KpGpGG>K0C+KA0C+cP; 1` Y( PU! WpG 4 O#J6; 0`P@An2$`P`@*DTU WpG Y|@<0@d |4 gUh`!e :,:g:@:fPh -L|Mܒ@0XpP 0 0)P@80S S @0X 0 0)%$ P2!b10S pP 0OP$K8 4#RZ 0`E` 0 VP @QCN@ 0 !0P C@\0PP@" 0R50X @00@0 0D!000dh00h0 !T0,0 $4>0CFT0 0㱔P`dgd0 塔P 0K 0s)P@qp KT$;, PP@cT0 4P$Lvgd<`:Ph(_gl::::: p-LM0@( +($00PP(0; (IP` 0 00p@80S$ ) 0@ P0  )t$h00bh0@EP kL0(,$0フ0弓\cpPl@ 坠gPhf: -L M @ 6@dD$D/ -L M@ 0@dD$D/ -LMT0O$K4#&:P_Pp ($@ĐPb0O&#J86$[\d \@@*TPmi*0 0+400 }@i[ 7(: -L$M8 @< j`8Ǚ@ G@ 00  <_8 億 <0$SH H@0夛D 8L$@D? 4 e4K 00K, K)P00s 8LD  ?.e40`PD"pe)@8写`< H00 W p@0000^$ P0l$ R(: 0S$:06>0. U$ & @0 b$Kp @@P$0 0c#& $ a8  e$0 0e#&B:A- p0Q:>a?1 &#l!b0QPop*H00p "F!V: U p -L0HK 0 0P@/ U8 W00W00SbP R00Q0#02SXT-0 0C0 S UzX0 aG\ (!0HK 0  <PP TX :g p-LM0 PU@ p0 S@`@0P0@0    g -L M0 p` 0S 0S0000P 0-LMPZ1@0T0 U( T0S% (@T@T 01 P0S @0@T0hZ0  (Q,0,0, 0<0000S @0 0@0000S0@Vhff0S@-+@,  0 000@ڗ:<< RQ-L 0P0000 P 00S000v: RQ-L P P 00S00000SW: -L@M\TK K < 4 <#:0K [0*":("0007,: 0-PLMU^ KK @<4 Ġ<̌,ʠ#:0KK@ P 0[S*0":(0"$000 T: -LMT2@P H2R@p 3S,0S00S}40Sz80Sw 0  QV 0`Sh0Sg 0  0GP\ 0R,0  0S0sJ 0SI R 0S0S0S 1VP5 02,\ ,48 <#R: -aP, 00#P @0  0,\,, P , #^010く/uhgVh -LM0@,0 @0  0  000 h01!p 1!pZW.PW&UPE!00C0PP*p 48<#h\ ,,00@P c1Ka]`PX UPE000P:Pp 48<#ho\ d,,00@P"8]z`P p <<<{ d0lY Pp\P; K`P9W P >4K40[S/ Kd@KxK 1P 0 1\@0[d 0@0K@["tp0  K@ KT0 P YP 0S \00\0ZhK KYPpQ|巑L5T <5T5` (K``V P K0[ pS (K@K K 1 0 1\KXPp 0P WY Y\00CS\0H4T? !<4T 44T8 r 10aR001#0p 10bP001#000|3T 3TU @rV1.ZjUy @fV1 q8#0000q#0000L|g!2R/W2TO 2TX1X2T p2Tx2T d2TW X p L2  R): p (2  R*0S & 00SP 5#$0$  R 5R00%"48<#P g|1T @1D1^L1T\1T* 1VL1T T:@10SPW  0[n 1T3劐e tEaWu 0Q0 T 0Q0Q*00Q 0gliHLi0UiViiileiHgildiHfiHii"i !i i ixFixi %i i ::Ri Ii Qi Si Ti p gi Gi Mi >i0:Ni0WiHPi Oi Ji(Ki -l9LAMpWP0, ` 1  5 -0S S/cH0SV< Q5 HP`PP,蜠K E 0[S  -0S h@ 0 SRx8 RV5 H0S |0SH|0[S` q (0000q'00 00 0@P  Ad00d 7@ 0 0Y0  ǟ,0 S x,xiP0005S Y ^P d0 >PKT5$#Ġ0Č6K7K4xKl p0 lK0P .KKPKt0 P 0S0 0F0$ dKT\K0HKc0KdPKTPƟ@K.DDHK CKHPKGKP@  ZP 80S0C80ŵ@T 80S0C80Ŕ0 .K00 VPA 00S 00$x5 H0Kp P] 5| PşHK UP@7  nZP 80S0C80A@T( 80S0C80 .K P 0S0 00$10Nx4 R*4 i(0  hGOK@%THK dK  ,ğ(P0Q Q SP  w .KP 0S0 00$103 R /  (0庎Vg@K@SXß HK( dK0 P  R =F2 R (0 Y hK SP 000 ` P0 82 R 0L jPl 1 R0 1 0 W PNVO  OP`7| {S00( 0 )0 X1(  5 0`00|00 R` 0S  0S`00 0`N U 0 R  0 R 0[S0[0S[Q5#$0$)K%"48<#Q ,PSgdp gl:`9_9+g*g_9|:::X:uh:: p-LM@ PN0 `0S R Q0000S ph ,P0`00 0(0 `埍: p-LM@P R0000 0P @`U00 0S S @0S SS00o0S0@ R \00C\0 0@ 0 GV 0S0C 0 ph10~ Ruhl:: 0- LQP 0 @R T0h? c -LMM$0YZ,0 0P X1  4Q x4Q -`4 ,0S X,9v0S^0S[F/0SSV0SSRQO3XS O3X0P p@/`Kx+R  V KVU00  3  R0TK\0K"hP 0@ XC !xK qVU0h0  d  P` 0@QP@0pS0S 12XKOKQ0)v2Xq  SK @V0T1 `V OK0 S `VT\ +VT< PU p ` 0S0C 0 00 R 0PV PpPD|0ST PU p ` 0S0C 0 00 0@0S00PVPpP"|xf:@-|0\ 0S \ Q @ 0 0R 0 0^@0 0xf p-LMp`@PT 0S @T 6L@DP0 0P0 S00@@ pxf -p0LM@T 0S @T P P R0600 hMxf -LIMp`0,0 ſ00 P 0SvP,6 ^LP`g 0 0 PU 0SPU6L Ⴟ100,0 S ,s0SU P 0 0 0R 0OK`0`0OMK@0K<0A1T (K 000Sg7 L R0600 L 0S0C 0 :7{S/K ,700SP` V OP 00 0 `g:1i -LJMp0P 0 $ 0`0CS 0  0S CsC7 R000  R 0CS  NKDOJK00<0 K 0-K 6Lzg,:2i -pL@P 6 K`V70 0 @T6@ K -LM@P6K P RP0S0S 00S0 0- @LTP 0S@T00S OP@-`p000 @0:P^0) S^0S \PP\00A000P0#" 00  0#" 00  P0S\dfd -LM0@S S  NPP P 0P P P0P P_9 -LM@P P P 0-P0L@T P0 oNP0@T00uh-P* 003P: 00 ? >-RALQBp`L̈ 9NPUe 0 S\D@ @\P0 S gx`9p:: -L M`0 X, 0 2PU8 O@KT1 PU0 R) 0 P@ 0X0Ÿ,Ÿ 0 0>> Y 0 0>>P@ 0 0 0>P@ 01 @T p0S @T00 R YDJ P?J8 $1 R 0 0 \ P00Q00Si"QPW,p 0@ 000, PʿP, p0bSʳX0 0 R PZψ0cghhrhd: -LMw, @pT`P 0S$ @TW  @T 0 R @TU0 0 R`0 h0 RP6,0SW y  Pp0d -LM@ @0T0  0 R @T0K G%X0SA  AR 0 RQ R\0500S\ \S:00S S* S00S S:00S S* Pcgd 0- LP  H @8Q8 R*H8pW  048< S  8pW0<0 8 Rt0Sf*0H00 @Pp\ HmD(T pp 048<@x 0  @H( H0@0D@0 0$L@ 00L@0 @  0L40`(0QD0 |@ D0 0Sp@ R@T 0 00SKZ @@$ @PP  $D 048<00 <$ 0\0  0@4<2DL   800,0#2P,6  0R0P00S@T  0S@T Q  0cPT  0cP000D ` VD @ 0S0@T 0"R@080 T8P 0S P0S喰@Z @0`C@0(0C8#88#$(," @"(  G( G8 0VJ* G80 0 B0 8&YD 00b$0M@00C080! S P 0P U8 #H0@\ 1 0@804 `<ß00ϲ8 6PP 8֯"Ÿ0D 0b0@"00C0H R 1 0@Ÿ@08 褭㶲XŸ00喲h㮲8"00厲H㦲00?R R:0`P?@ @AGPE( B0S( *BP'WZ'08 HQ 1 0@80zHP1B0  0Fm BP E,0K8 6P<080  , 0R0% ~*0|뀪f|fihftdWhVhpdWhXihih`: -PLUp `2X !@@F( F0 &?Z P$4D 00b0? 00C0̬WhWh0 0   00 80<808 8<<80808 < -LM㽱㹱0aS008PU U p00C08P<0 R% Up 0R`<0S P<@0 z 0XR<0Sㅱ00f oc 0@<bꜪfVhihWhpd ih -造Lj0S J`P00E80S Hp`80@@80SP00m0ꜪfVhih -L$)(0q 0 q0ddddQ0-4 $Q Q(0 `0P@ 0R갗/̗/ԗ/ܗ// 0@000 0Q QX0RH0 R@0RP0R00 R80 0-pP@LP 0S P  =P @0 S00 0{d: -$L M0p`@A P0`P 0'S1@ 0S 0S 0S0S0S 0S (0K  #) (P,0:S @0 40 P0MS1z  80S $00cj 0 㴫XT 10000 00SV:XJ p4 &E "E R9 R/  R' R < 4( <"4)<(#,(` ## 0P `@0P`(` 00S00000S 00S0 0 0 00S1 Rt]/.{0㥭0S: 00 B00 0  0h0h$0C0CMcEu1P@  0R0% :P 0 SR0Q0P@ 00K P 0 0R0% * V UV (UP zWhd<:WhWh(_h`: -L$M4 0 4 p0Qg ! 0@00X80 $ 0 S8%@ ` :V :0 0< jPP0X,!!- 0 @0S }ʀS S eS) < R0<  <0P40K 8 80@00 0S0`z0P 1   0 @<0S$/P////0 ;P@ 00S 1 0@0 < 000<0 0 S S0P 1 (  0 @<\ \00<P0P 1  0 @<\ \000 00S 1 0  0 @00S=ʂS000S 1 @0@<PW X&S 00S 1 x  0 @0(0(P '<0& 0 吩900S1 p 8^000S 1  0 @X000S 1 8  0 @<\A(0 0P@<00 f 1 0@ S_*h<PrP 1'1$ 101< 2Z< 1:)011<01$ 8L ( B B00 0g(0 0@g(@0~ Z0  ƟA.L` BP`0@ `0Pi0< 0 S! ʇSf DS! S000S 1 h  0 @<0S'XP%00_P  s0 <5000S 1 `  0 @< RX0T%0<0?P  5R0 5000S 1 P  0 @<\qX$0 0P  ;10 ;000S 1 X  0 @<PPXL$0<0P  20 2S 0CS40S X X#00ݨP Z ß `LP`0@ (` < R F<@<qP 00(#1100$ 101<0000 0Z 1<p 0g̐  80 S- p32( 8 Y A A0M=4\ A0 @1P:)010P 0-$004 s0 (0P$00 p00g4C< R<\XO000S 1 H  0 @<0SX1T!00@P  N:S0 I:1 R$!0`P0@0S 1  0@08  0w0P@ ',0K 㔭P`0  , 0R0%` *P `P@=wWhdX: _hʚ;8_htZgXXg@_hd*g+g0_h:(_h`: -LM/R, 0 p^ 00 S0% I:X 0 ` P0 3V <+V V2 0R0% :P 3V0000`QQ@0 4 ,0S ,T` 0K&Pp  0R0% * 0 S0% :X dKO<0\ d0Kc K\@Kl  dK0L +PS@@KHK2<0 H0KGK@ HK 00 P@: 048 <:R0D0 00 H K\p 倠 |P p x 儀 h`K ,3 (3!10S dK K0 $(,<4<!4"< K0 l 2 Rღfv\@K  A@ 0K0 ㍬Ppr  00R0% k*,Vc 0@S0% :P9 0!4 R`P Q 0KhPp  0R0% *_ 0R0%@ /:T 0 0Ra% 0S" 0S0% :P 00020C0 `P 0K4Pp  0R0% *+ 0K"Pp@  0R0%@ *<V0K0 Pp  00R0% *$0P@ \ ug(_h:ghdd:`: -L M@0(  $( ,<4<,4"|P@kU110SPHDPK;0 C0KD K<`K0SG C P, 40" L0P0SS<1 R \0R:1  R' \0R$*W*0P@ PpP 80S0C80ڔ0@T @T (0S `(^ f\0W00S0%" Kgdddghd: -&LDM0PTP ,0 0S80\0 `P dP @p` :Y  HK@h@ :0@K hG0KHK>HKz5P@0[S U5 ,0S ,T^?0[0S 00f@CZ #г/г///0ST 0S  SZ T @0Kt@ [R R h@K u:H0KPd0 Z Z Z 񟗳ꄴ/|/X/d/<0\0 @AnPP !!$ 1$010 1ᮩUF 1:)01``\ $0R0 R㲩@n$Ꮹ$ R 1 0+10 ,`(`0 (@ ?>Z /(/T//0000s00kO00004XK X0 $>00 00880"000` P, 0S0 00 $00!800 000c0  80S 0 T I8 $00 08 0b`0< 0\ `0 J< \ GT Kd0 8 P\ <;91 -1 ?0[0S1 0S5#$0$#K ?0[0ST `  ,1, KPP 0S 0S 0 0R0%0 0":d0 d R  0dP ȣPP0K ܩPpd  P 0R0%0 *0L0K ˩Ppu L 0R0% n* zsg:tZgXXgD[g*g+gd`: -L MR`kPᢨ@XlPp H !1 01!  qWVW 0U01 P<P,0   80S$ 00 ,  ,P X Y @z*0@.S T:X000 p,  @UP* YN* T *0S .S  Y*0S .S0, 0SN*0H>SKA @a0@RSD0SA La0LRS00L S:XA @a0@RS `A@0@ \-P+^H`PP@X Y @*0.S@,0U* T:0 0, S*00S0C00  00 S000C00 00c 0Wݢ 0 0 `  <q@\>l$ᾧ$ R 1 0 +10 ,(tZgXXgD[g -QLMP`pd V00UPT0 SRJ00SSFPES`FLSH0SBj0S>0S:0 S6?Q3 ?R0Q0E\) R0FP$ Q$ @R" Q 00S00S 7P0pi0\0jS\ 0jSg 7P -L Mp, 0p  4p 0SAR0 > 0`V @ T 0 R @T40S` pV,0 `Y0P P P  0   P  000P ~7P040 cg -LPRM40 020 pP 0$< 0 W8 `x U @T 0 R @TWPU0X0`P`80#2   X0#00 zPK EP<  0 <  4 R- R0' 0R0"00c,$,!$#,,  ,KD;  @;00S 48 A 4 8 100S00,0 08 04<#$ 0P<0 <  <0 cgp g -|#L4M0Pp,0 Pp 0R0% :Z- HK60 H0KG K0c HKT0 @T: h0 A@TW2 h 20S'j@HKLP0 ჵPPP |2 ,0S t,GZ@L⋴@0S  PK 0 2P@ r0:S,0S00S40S80S , d6P0S 0S$0S(0S T R6PQ 0"0 # W (!09PX  h 00S!X@P0LHKX  P X嘠PP0P0 piꐠ@L@0S  PK X0L L0K 㔦PP7 L 0R0% 0*Cpg,vh? :@ihʚ;`: -$(LM0'Q,0   (\ 00S:p:00(L00 (( 0@℠K 0 : :K5P` K`KPK9 K 0K@Kp{5K`KPK   0 _6@T 0  5P0 @T0[Sp RE  9` 0: 0000@S1\6   0:( @@ 401K<1 0P Q 1 0@Q 1 0C0@\ 񟗗////X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X/X///(/@/X/p/////0S 1 0@\ 3 ,0S ,XX0S1  0@0S10S10S10S10S10S10S1 0S1B0S10S10S10S10S 1t@K  4KK0  tP 80S0C80 R01 Rᛞ|K&0 nP_0[0S1@  TȠ }0P+^TPK(@L0( Ġ 00@S*PL ( +8@0 R 4@40(0@xnguhdd(:d8:x:: -LM@P`p @0 o頪f: -&LAM0p,0 `@0PK 7Z - L6 R @6 R 0R0%P s:Ui  K7K 70[SU 0[SI 0[S 5 Rş@0 5 ,0S ,*WKr| n0[0S0S @5 R K`0 0mH@K!30@K KG0KHK7 ^P` 0P 0S 4 R80S0C80űg^K KKU m@K +3P80S0C80ž0[`S 0[@S KK 3P00  3 R K KK)NK(H( vPz!R0 ! 僑Q Y0 00 S T3 R` KK@ KKY0PI 0PimO !@! 0K@# !R3삟! b20SPAdPK@K2`K2~20KxK c0KdK0K0KKK6\KK 6KK 6FK !0@^P@K\2KK0 0KK6ホ b]1 R K KK m0[0S@@RT1 R K KKd]= 1 R XK@ KKw 0 l0 R K KKi0[0S5#$0$.K0[0S5#$0$-K0P@ E?K ᱢP p P  0R0%P {*L`lgTdddgh::8:x:::dd/`::::(_h`: -&L4M0 P`,0 E6 R VU 40 <0SL0  H@K10 @KG0KHK6 LHL000 Pj 0Sg  Pp`I@eP 5"$ " pp!p pXE .@he$ $Q 1+ 010 (p,p<81 p0p0c,  80S00 0 b L R,#Y0T 0000R:DP  0 0R 40 0 SP  P p`0@0: 00 @ @@5  5(v0(0@@@@@40 PQ 0P x5@ t5P L P(` L gY0 0@T0 R4 30 S T  Q@a@ 0DS:?>0R@0!0 0 g 000 ᅝPUt0Sn 0Sd 0SZ 0SP !@( B("("48<##80@@ 0:4( : 40 0@@Y P L0S 1 0@LQ 1`P 0@L  0@1P@ p1 ,0S |,ZT00S000 00S0 0 000S000 00S0 0 0aG kbAAg00SR\P 0SM 1 0( LY *4`g?X֚U Қ0  P 4P00S0P0 gPghTdtZgXXgD[gh[h\: -LM`@PT :Rp/U U S*` T ᝚ \(`P Q` T4`S*`0S` ̙ @A4`0T0U00S. - 0L  QPddf 0-LM PZP@ 40P00 KPPy\0SL LZ@808 &`P0Z0Z0d$/ - LMR 40 S L00P00 0 C\it: - LMR 40 S 0 0 *\i: p-L MQPPP 0@S0 `ph"P 0<P=Ep*p 0 ph=FpdWh -LM@00K p" 0@ 00 "@0P ,` U0@K!!  F00K  ?@0@K 90 p0 -LM`140@!0c480!0c4<0 0c4 D{0 0c4 D@!390Q 00R D bw1pZP, @0m1PP A0 R ~p0H, 00 S0 L 0C # 0 0 R I1Yp@ꫪp g -LM, 0PR* L0Qڂ, 0S*@Dp`@40x #1@T4<@0 ,0H 4 800 _,p g 40w00S8 !48<#,#80 4-00S' 00S !48<#,#8 0 4 00S00S 04 d1P@ 00S 00S 04 00S 51(p?P4 c !0@Wp 1  0@070Sl> @ 0T  # 0@)05S1#=#=\GehhihihuhhuhuhuhTd@ih|ddghrhhhxih0ihd:`uhihihcg`: -L MPp 0)S0`(4P 0 0A( Q0%(":P `@D 02P`P @0 00K( :PP 0 0R0% *,0K( *PP , 0R0% *dhh`: -RL M`p40 @0S SP V g* }pP P`eV@1P@ ԔSN SVZAP 0/0K .00(<4<"4!<^00 S: 00g0 @P,0  00g0 @P,0  0g0 @P*0  0g+0 V R*K>."[P"48<4 #8V0Pˆʎihxih -0L0@Sp S \S S 0@ 0S 1  D0 { @0`P``0xih -L$M4h, H @| 0 R[ 6 0(@3T QT +T,  PP> p3T0000aa 0V13T T +Th0@)0 ΪH0PH ,0 S ,M<Th0  )0㴪H PǓ1P@ <T (^P@  00Q  )0㓪H0SH 夓h DK)0D 傪H PhhH t@PK T-@ [R R Y 0S )00 dHPhhH T?0[0S03K?0[0S )0LH PhhH :g :hh -LM$0K@ pٔ3T#0[#0[00aa\@X\PP H011 01!  +UV#U !0 00l<  80S ޒ$00 00lV* 0 ᙔ `@h{\$$ R 1 0 +10 ,(pd`9@: -LM1p 0S 0 S- 0 S*0 S'0 S$X8h@0  Po00{@x0( b0S 0o0C0 MRM.0YT'Z0 , P 40 80S0C80Ō'00P N6\@000 S   0P&`@<TR `h  0 @<0S 1 8  0 @ & Ɵ 0 0S00S 0 l5 R %P 40 80S0C80ڔ%00R00@ ( <0( Hca<!0 R \0R:1  R \0R*P&\ 1 0@0 R <!0 R \0R:1  R \0R*00 \0400,0 0\Z ,4 R 0@55 R R  R R < ,0`Pi <0S 1 X0@X3P@ 00S\ A\ I000000000000000000000000000000000000000000000000000000000000000000Y 000  0 0@<0S 1 H 0@Y  0@0 R00Sl000h00Sb 00SZ0 0 0V 00SP P<B 00 \0PPp, `V+ @ %P,0~ P 80S0C80ڈ 00xl%, 00,0   hP) @L4 \_MP@0ihxddp gP:uhuhih\d:`d(ihuh -LM\pK 0 P , 0 5%U p `  Q_QSQG<Q;l0@S @h0S 0@d0S 0@`0(S 0@0fT0S0`0(@CT00:Z   P ppp 0 `P 00` R Z" 00`  `0 <00l0S Z 0 0 l  l00lh0S Z 0< 0 h  h00hdP Z 0+ 0 d0d  dP0S  0S0S0Ss 0Sm @0 ^] 0U0  0S  Q  40 0S> 80S0C80600Q h$ 000   (0SS Q> X0<0 X0 400  1Q<1 1 P0@UF 0S=  R: 565S3 +0@\ 1 X 0@A  L0KR LK\ ,0 S ,GLP 80S0C80dOLPU 0s00tK^\0K x@K@pP t \ ̠t 500   R R  R R  R Rv Rn Rd l RHx0S tt Q5 \,: 04(^ 1 h0@Q<t4(<"4\  0b0C0t S 0 d0S   h0S 00  l0S,0 0  ,00 ^ @}WPp 7 !"$ "0000 0W 1:)01|7p (@PP ' @ 0Ko P   0n8#8#00!$ S  n  04<#$ 0 @ 0D8#8#$(,""(  03Pe 0 S  0S00000 ,,<,0 00 0 @\ 1 p  0 @ ^ b0S 1 `0@p00`W \0  pXQ5P@ @700 @0 4P@ 7 0(S ` 1  0 V1@01|0K K! P࠳ C1 @01 00S00000S 00S0 0 0 00Sz00Sp`#0410 Qhe00S_ 00SV# 0410  00SG IQA00 @0 1<Q<12   000S0 U 0S Q42  0S U 0s00Q\   R 1 P0@0S 1 0@5ST!0@\ 1 X 0@3 P 0S P0S 50SP@ T !P@ R 0S  O Q X0<0 X0 dL0PA ]gHihih:tZgXXg@[ghih`ihPihPU' V W `  %PJ@hT$'$ R 1 0 +10 ,(c*a0  [ʚ;`9 -L`P@\ )R1S*P 0\0T00S ᐇT T PP0p 0 :RpW 0 :Rpp 0 0pT \ d -@0`TLpP) P$`U` 0S{UGX "P P`@3{. @{'@g -L4MT0pP,0 D5\P W`@8 0FSA*0+0+0,0 .0T R 0\0 0S$0S \,0 S ,y@0S@T5s@PK PP` d4 R X4 P 5`S10`0-0T RTK T 0 Sr3T0[ 0 T RXK X0SX0[0ǕT 0SP0S0S0S Qd 0SQS0SI 0HKL0 &0 H0KG K@KLKFL0S <`}GV 5S0S$ @T 0\  @T\ KP@[ 0S0 000@0Q)PT00J00S5#$0$ 00S1`1 Rj1 Pe `!P 0(T% 0S"P0S0S0S Q; 0SP 81 RA,1 P< 0`S @T1 V 0S @T' PT  R000 |00S1#$0$ !P  5Pp7 $0P 0 0Pgghd:H00CSY20X3030303040 RO 0S 0S> ,2 Q6*Q 2 Q/ 0S0S0S 0S HPK@0 H0KG K@KP Q 0%R 00S  100S1#$0$ *R  00 SY R 0 0R 0" 0%* R  0 10R f R0S 00j < R 0 10R0S0Sg:Hgfd::: -0LS< 1\ 0S \0 R0 R 5Q  UP P0 0 (0#0 ,0#0 00# 0 40# 00S0#$(,"Q(dTduhuh -L$Md P \1, @<`K^Hp; <fPP$ \! !0X0R00S 0\00  aa ᨁ,0 S ,51USU 01 ᓁ P0@ ><tgTdp g0@15SQ CSd0PUhX}@0  a00 ?0#3 0e0uh&ꐍ0 k& -LMŸP@Q2  0 n 䁟0S00 0Sl 5Pp8| P`H 8v shl1 p ` `R0 0U0 0 p @ppp 0S 1i003 0 0 0Ba0k 0( x>0b `P\0(0i>0W <P00(0(>Pdfdd; 0 0 0Ba|0 R ( tD>0⯴ \PX0(09>0⤴ 84/>;Lddf;0000n 0( |= ( l= R 0T00  0|  0S C pph.ph=;;0;\;f -LM00 0 0 @0@ @@m -PLM@ -|0 0R h0 R 0P (0h=Q 0Shy000 M=Hdd;; -PLM@ R000h_7=; -LpLM0P,0 `@ <KT2 l Rl@2 Rh 0S# (2 RŸ@0 4m1 ,0S ,o&ᷳPⴳ @(0>=<0S80S40S00S5 0R0% A:P7 d@KH EP%` R 0 l 僡 Y0 00 S 0 R <KzY0 J=@ <Kl  0@0 R <0P@ h0K rPp h 0R0% *(<gldTddgh;;H;;(_h`: -LpM0@,0 `1PK c6 R 0 0S# 6 RƟ@0 ldƟ,0 S `,% P @(0,<0[S 6 R K <0[0S 0R0%` Y:VO @KPE SP= 0 4 TPK8( LKLK0T<0K0 43K[T 8 4  <4(<"4%$Q0S !E!0$?0D@$#3 000  04 8 <4<("4!<0PPP @ P,d0Si A TQ 0S& @Q  0 A Y0 00S 3 RF K_Y0 D;<0K@ @m90 $(,<4<!4"L T:0S\  \ SP1:PT0@S z2 R & 0P;2 R  0; R 0S ; R0S\ 0SX SR 0 SB K`0 K0KK%0h [0  /h K0h [2 00h0K1\K 0$(,<4m `R000 TP @|dTm|\phP@ 80 R ◮X0 (@ 8d ; -L,MP @pm T@ D  1 ; S00D0 7P` L0L00L0L0L00L0L0 80< D@H80< D@HL0 P0j W P_ L0 @T 0 R @TY @l80S P1 \00\0`0pX0 P0ԮP 0Y@ 8K0q  00bS00bc8 xRQ:Q0 D0S 0 <0 ,0 H =H 00+P@ 0 R ݭX0 (@f780< S L0 < KP<Pt0 R ⼭<X0 (LD7tL0 ``8<0<<<p g dX ; ; -LMT@T  @P HP 1S@T p-LMS@T L0@T2 R @T 0S L0t@T@T 0Sf L04@TtR@T 0@ @T@T 0@00@Tp0S P T @T 0@@Tp0S P00000P PU L0 dP` x1 R X0 \`6P` 01 RP X0 `600SP  PPP00P0IPP0P 0 P0v 00Snp@T| 0S L0@TfP0 P 00S#PF TKF(duhuhd ; -L0~n0`pf\PP 0f0V@0*` VT( K,0K JTZ:0 P, 0L00 H< p02SN H%%>!D @A0AS= R ;%4 0 , %00 #0BWS h0000000000000000000000000000000x0000000000000000(080000D0T0h00000000|00000000000,0<0D0L0X000h0t0000000 0ts0A0CS Q X@@0S $% , R|2xl2D PL4 8<40$ 1?3?3  0  0x0!pn x ell%10?30 @U0P%  0?200  024P`9`g9;;;: ;';;^<(o;;;;;:,;g9;g9:g9g9\;<;;g9;b<;4 ;;;;;;; 0-@PL> `Sl h0 $$ à 0 < 0 $00<;;g9;(; -pL`@Pu$ T 4 Z DU pP@TXD4(4P4;8;@;D;<; ; -L0 Z\@`%Z' !00St 0t  rW\PD  e/H;0!;;;;е: -O8@LMpOSP!b$ $00S 0 hdX@@  fH;@0!;;;P;<;е: -@$40$&S !PL$pdxl dVHX;`;H;;0!;;е:;:'\; ) h9 -LMpL`@PL 8P$1( <0D $00HL!000wwww -LMY  `Q00SpP @ZJ $0 0T@TZ S@* $0 0@T T: -LM\  Q@@Tp` PYJ@ ( 08@#8 XPUZ TP*@ (0@8#8 PX U: -LM\  Q@@Tp` PYJA , 0@ \PUZ TP*A ,0@ P\ U: -L@p`P! R ,0 $10 \ =0.0 R,0 >x p 00e,! R ,0 $10 \ 1dPgd g 0-0 L@  ,0P   H0 RH 0h0,P,Phgd p-LM0@S`P: S S00 S S R/ !R0 R R R =R 0 R R R =R=S Q `P0  R R R 0  R R R0Spp p-LM0OgThaT `!0X!00,SH1  !00(!3PP 00B!30P0 !300 30$6!@0`3PP 00B 30\0 `!`t0t @ n@4`P0P @08 0C0p(whwh4wh,wh wh P dKP8\00S 0L!X0T  P L  HD  @<  8$4 ( 0,, 0 (4$ 8 < D H\  d 1 100 1`08<$100 p-LM0 @P0 "!HN 0L`L @000ph F HphUgPh -L,M \`p V\ H0C 0* H:$&R   R  R0RႡ0僡0# XL P P KpH00CH0 p 020P0LP 2 HPK A @ i8!(P \$6BS@-L!@0 H@ -LMp`WLP0 S@0 0 W`u@ g$ 0S00Dwh -` LR000 | |0@PW@dDFA 02b SpD 0 S0``00`hwW< g@ g(g -` LMT ^LL @Q Q\ 0 @Vg g (1 R 00Dwh@f0 -LM0` 0 !HAHP1UP`!p000PG4 1 UPRL1`t1AT  0P= @Tp4 H` 0`W ! R ,0 $10 \ V0.0 R' ! R ,0 $10 \ ;d"Tp  0 `mg gPhDwh1d ; -`,1LM 080@0K(UPUK  _PU Kp0(  PP  覥PU K0@ @ P_0呥P00P0GH 0-tPtL0n@Q011!!PLP@0L!0*4 - 40L0C0l d whdwh gvhwh~h0LMn<`p4 OP@B 40 R08 &8 P00U* Vؠ 0. f   0Z UJjF:804 0S80 d@X00K@, KP00L00  fH0 >0 NH<M0@- 0@^0 0@T 0 P^0@ЍS0@P ! -LM8 \p 0 0 0c@0 < 唒W`D h 0x"Y, K00K K, 0S 00 Rr .: #:L4  0808@0S @4^ P>0. U:00R ^ RG 0 0c4 :#: cQ!P4 4@ 000lQ0S@@ < \ D 0 RD ,040pW0<0 `D@0W@< 00 ^P @,0<@0 S0h (8(#8Q4 "*4*64 00S 4 KHy00 0 bS0!>0>00>000 0S0l0l -L@㬀TPp`  (0@T -L@, TPp` ,@ T -L@㬀TPp` 0  @XT -L@, TPp`1 @\ T@-^@>0.  Q:00R^  -LM@`TSp R a :@TVPbUP!W W `e L 0D@WHvh0wh -LM`0VPp R a :VP@bT@!W W `d L 0D@WHvh0wh 0-`@L\0P 0  ,0R 0 0S0hNwhvhD; -LM`PV r @0S  2S @2S2S lph)d&0JS 1111p11p1p1p10  00@ 0 P1`VAA0S 1 R$ 1 ?#+0AB%@ Z 11@T !mt h81\ ?# $1H1@Q1@!+B%0@ P00 0X u" 0|  cm,k9whX:L:;;;;;$;';,wh$whwhwh4whn9@wh,;n9T;@:;;80K0@<  0 P vhPhgn9 gvhH<fh;;;; p-LM( \@SP`8 0 P L (GD@;$64300S8@< D )Hx&hdH T L( ;0 ;n98 ;X ; ;;x ; ; ; ; ;!;$!;4!;@!;L!;t!; -LM \@P`p  0 P`0L1 -LML ^0P0p @`H   \l 0 `p0 L1@  -l!LM000 0.!0 S@C$1HpxL17 X1: `N @0\ PP 0@P Hm P   0d0.S4  0S00T|  @0 R  0H 0@Phg;vh p-LM@0P`XT" T K0V0P00S 0[0ppTK0V0P00S 00pK0V0P00S 1[0pvh!; 88#4S S - LM(4P`0Sp @"0pP`(0S00V00\00S 4@Q0 0CS ~V00\00S(TA0SP(4 SJ@)1)1 *18*18*18*18*18*18*18*18*18*1@*1@\. 0 P?D 0 :#:cQ! `*No  @Q`1h#R& EP  `0S000S pp`V  Q#  *`00xh!;,yh0S@ Tǟ#&R:0R*0a00  1@W2 0@0 HQ`  @0 `6W  T  8 4S44SSD0 SH0H0S S L6!X@0`0ó @0` &U  @0`00@080@ 0`D0 00Q00S D 0S D0 10#R0 S 5D8 0`zTU X5 Y @ R4000$ $@ ZW 5Uh 5 Rd 0R0` <S 4 YZ  4$0 ) 2Q D 0S? D0 0S4W+ 4S44SSD0 SH0H0S S 4!AT@0`0ó @0` U  @0`00@0  300S p3 0 P3@q 0Sn ,3Ph ?q P8 ]  "U 48  0 `D 0SK `I@0F HQC h2H=H0HSU @2 Y(2 T.  8 4S44SSD0 SH0H0S S 1!aV@0`0ó @0` x!U:  @0`00@080@ 0`D0 00Q00S D 0S D0 10#R0 S 0D8 0@ 0S 0P O0 |eg)*(":1"(Q 001 0RyhTh0? =#& R6:0R3*0l$0  1"R 8\ 0P \0T\ 0 @00@0   $0 2R @ ` #& R:0R*0l(0  1"R 8\ 0P \0T\ @00@0  Thvh -,0L ^  08gvh -!*(L":M1Q"( 001 0R  0`* " !Q:0Q *0b!0 P 0Th -LM 0LQp@+0 T ?= ?0S% RA` 00#! @R00  00#!H0S  S 0 0iA0Qgvh(yh 0-0LS@P 0SP200T* 00S 0 R 0T 0 R 0S 0S  R00h00 0T   0 0 0P00vh"*01\06S0:0@<,I?xhf0^P`0Pl Sc SW 0 4 U,  @4U 3 #6SppW 0&*000 00^>>fVE1U,&: R,IP% 8#8US#&6?N00^ U.Q !hXE&14 0 0!1jZEP5H0H 000 <0040 000 000 $0 #$;0$;xhxhyhxhyhyhd$;0xh -``LM0pS P0  @P@^00 RxhP0P0S  \:00Q0Sxh0@-l0@P 0S P  T :00U0S000xh0-0L 0 000 00 0 0 0 x0x p0p p0?00?X0 yhyh yhxhxh yhxh$yhyh]1yh[1yhxh0yhxhxhxhxh8yh -0L0Όn`VPp@0?0?0000?%:F%6;PK #;J jV!ZNdd$; -LMPP̠%/*Ȑ%:8#*!% vWp!R#8 001 0R  :U#E*`L0HS @000ZU@:U:vhU#&R :0R*0a!B 0 T H4$4DLt8@T V 0 *$j@T@꨿fTh`%;%; -!LM!:1`PV!& 0 01 pRPJ$JT 000P帠00 0+; 00帐 .P p@:#:S `@*:#:"*S:*21@`P0 P ,0 P 逿ffyh|fyh -0LM@@pPP% KTPU$: 8 #! R#8 001 R00*"5* `  0@UP4 XQhL!.@ L1:404L1L@H@L!L -0V800`H`0 0 04騕8 -LM 0@<  h gq$ -:#:LMS`@PR pK D  VjVJZ0L ^| Pt4U@`H@ $@K,0  $ 00ZUzjd0^P 0,0 63L 0L0H p0ß> P@0&nD0 0YD `0n 0O8: 0H #: 0A3 :0:Ÿ: 03,0 9,B(P `:@"PU @Z B`2 0xP0 ">0>0P2PD@1l . ($BP  0 1!L p rS S@ 0R@0 0D0 dp0S  0CSSp0D 0S 0Sx  P00SR 0S 0SPx x  0S 0SPx x   00  0! < Q08 0000,0S0?0,080S00, 8);););WEV);); -80LSP`p (0S KKT r> 1R0S vPV# (@2@R0`! 0R 0R: 0S  P 0 0 V08Je/e/WEV -LMp( @PD@8PX, `L T(0 "<00 @ #R P@jHo@ Y 0S 0S`v  P00SR 0S 0S`Pv v  0S 0S`Pv v 0 01,0 0T0,0 @0(0<00  QP@H( @0e?C\ 0R 0e?C@T e/000 Q@00:00N0SP (HWEV -LM(`< @PtD8/\") T0S`Q@ 4<0(` 4# S0 S00Y0 4 8 0@4000;0000 -L M8@4T 0 @@Gf́hP+; -LM@`.0pS1P0U 'PP0S UPP 00C0`.(@101~.z.PX+;́h`+; -LM @P !000$00S(hźh -L,MRP,`Kp@ 㩾%40K,KK P@ P030[4 [2[81[<4U @ /0[0 [.[8-[<4 00t0  >0 N|+; -LM2(KJP`0p f,0 @p(@K@ @u0' -L M$PK@p`M0:$0KH  㶽  㲽  㮽$  㪽8k$P0 P ` PKB' -LM2(KJP`0p 40(K $`KPp@ @!0 -L M,`KpL0PH@X@0 ,K@+PK(KP P0u' -LMP0`Kpսҽ@0K UP#K0 /K.KP @,PK -L$M@4`Kpᮽ 㫽`0PT@!$Z4K-K [0 3K2K@ P,@K0 0 0bS00-0  4$ 00bS -L MYP pR`@0 0SX1 h 400Sd  0P@8 04SOX00 0>S  400S Y00 R  048 @00 R 08< 40@Y00 R  048 @00 R  0480@P  0@P@RP0 N -L M,`K@Pϼ0p0(0K([pZ,K0 +KP pP -L$MP @4KD@` pᨼ``$U-Kz4K 0 3KP `p,@K -L M0pK@` ㈼ᅼ$P_0K*K[0$t$h .K)`K(pK@ P'@K -0L@ p50S h Pu,0P" P 0`V U004P< (0;4P00@ @0$0 0ShV hNP 0,0hT -LM0$ @(X , ,0PP& !P&`V +0p0p P0 +V 00SJp P` 0,0e+;+; -Lp`PP Y@  ?` 0$0  00 @0 000P 0ҕ20•U p` q+@P+  -LM,0@S$̮1,1Ԯ1Ԯ1ܮ1 1,1<1X100Cs0 0 00, 0S P;p  ,;0S +; 0-LM0@0S S T@D P0`` P P0@DS000Sa`,Pg,; - `L$0p04PSu0@0p0CS0Օ Q?ꬰ111`1|11б111t1t1111$0( R0(0Q 0  f0@0@S 0S :S1U@01 0S 0CSh 00S :S @ 0RS 0SV0  0SS @ 0S 0)S 10101 @@@p@ -LM(00 S 0 r,;$,; 0-PL 4@ @0!qT p@D]T4@ 3S05 00hLmxF0; 08< 4 0<S8! 420S 08< 4FPgPQ <P]P  0 S0@ ld\0,L0,lu;0!;*;@*;\*;(:p*;t*;*;*;*;*;*;';+;(+;8+; -8qLM@P 0Uă`9 U 0 ܿU <0?R0S0AS11111 0@0p| P0c0T  0D 08    0f0dxu;|u;u;u;u;u; -@LMMT`pP1 )@T 0 S 1S 0S0t P0S hq< 0 hpT 0 o9u;u;v;Tv; -LM BֵB@o() 0S@0 @)鐂h -LM@) R000 (h> 0-LP),0@T 0U @T(0鐂h p-LM0`@V@ P7 P0[0X Z ,0S괸1ظ111$1,141$0  B0[0$ phkK 0Y0X 4(|0[0Ml0H,X00 0X 4(Y0e 7ph 2 v;v;v;v; p-LM@PO < 0Q^C0S>  R50ˠʌ ʌ00ɌH0 @P`w(00P  phT(0 ``00  004`;00`(PJ8```X`Tw; w;0w;C: -L"M\P@`p l2\ ,@0S p  02\U 2\ @}̠ 0@ @l1\뤠 ` 㶼Q 0S(   0|000 0  0p0#00, 00 |6@ ` ㌼L@D04p80P0&<@1011011 011@01101`0\ X0\x0P Q1400  00  Q@Q QQ`19 Q- LHz; -0PLQ0000 1S010 130S00z3q P4 00#`Vq 4@40!`R 3V hb ddXz;hz;z; 0-LPP#@P441S@T ^0[4# p-LM P@| 0`\ p| 0`\0` -pLM@`p iLP@0T 0!R@ 0Td -PLMP@"0P0aV 0 q1 ,0 10C40  Q 1Q4 t T0Tu8@  40!Q<@ 0<0   PW4 U,0U 40PUY ѳ nP 40!ZY 1 L60d!0Q<@80T@3T SP@ 8 T1 0 08 <401T00  p0S Xp0 R @< T00T^80 T4040!0 0C< 80 d؀9d'-\0 S S S S SL\ 0 0S S S S S SL\ 0 S" SS 0B_S \00 "#0  0801000  0  L\00 ^ 00 \S00  SS -LMDŸ Q, @4 / 0@\0 | w\3 \p 聟X- P`K PK@K ~  zP@0!0 1R 0t <1 ,0S D,Z 711111111111111111111111111111111ꨀ꤀ꠀ꜀ꘀꔀꐀꌀꈀꄀꀀ|xt`\hdg;0!;z;؀9 {;{; {;P{;`{;h{;t{;|{;{;{;{;{;{;{;{;{;e:{;|;|;H|; -LM40p1` SP p 㿱P@ 0p Źl2 dd2  $0pPP0 @Rp Rz Rk U 40!Q 1 f # 0,Ky0!0Q  202202 202,04S!20\: 2|04KS1ԱL0 1ı0 4@ aP( U$1 ! 41 R0S1A0 -p 0=0 0 04P4 x㺱 4@: غP0S`RUd4fpd9؀9118: -L MPB p0, u`@᠟  0PES u@,0Y囸 0 ôP 吸00 000 ⷴP儸  ⮴0 P 0  00 R0 ,@ -LMK 0(9 -P`P0 S00Ł0@p$ (00L\p%1d  0T 0Q00040S$T1 hdd';؀9@1b: -@L#`$P P00$ ;004P$ fF$PԀ#0 PUb p@0SP 0@ 0UP0U hpp@0SP 00@ 0UTP0YYTd1dXdd - 8L8#Č M R00,p \, mP@y 00 ԠNP`mPU< 1*X`  Y  Y 0  101PU 06c -j1 010, 100, 10, R ,8Q2 RP`X-. P` V X` -8P`101EP1`0 0` .A`d - 0!4LM#`pP@4 0PP* V0 70  V0 700(PUP - 1 011    1<1d -D@!88#L!PP<`09 0!<`03 p<`(᝵P+V D00S 0 00UP "`hY"<`@`q"`EP"U hx04000;00d -L,MԀ0SU 1z $@TN $0$0御g pT(P\D0`0S2 `<@P P2 46S7 4pK p00&((*&<&%4K20K1 K0K/`K-K,PK p0P<H0  @0   dP0S 0SPp 1!:U :U vt:U :c7U 7UV 0kd7U \7UHQ #  4IP 0,;6U=6U"*6U 6U"P$6UQ Qc00 "  d 0@P 0 0006U 5U 5U㲀U@ R0`0 %0HS"5%@P@dDFA 02 Sh1b1 R0``00` 0P0S1 0" 0#$0$   BR !C4$@P@dDFA 02 S`1b1 R0``00`bR㭬0 0bJ10000 2 0,$,!$#, \@Z`s0STtCP R0`04 .㌯  0@@@#P02 <4(<"4!<002 0#$0$ 0 S0S0002@2@dP㽫`|2U t2U  E@0D,S? 0\PKP@PZ0[Y [$ R !ᓨdP@ 0P@E`@K P 0 P0"  6[#$0$&K s0U 0,10SU0U 1U} 00U0v0Us 00Un 0gd Q@c Q |;c@c c c c c c c c c c c c c pd sd ccedA c@rdAc c cmdqdgdfdhdcmc ccX!g< g@ g(gddQQ` -L M,0 0e00 P᤮ ,塮Za@Q0p0m 3㑮 d0( 008,!2040 1 P t  d 0T*@KϠ<0  DX@<0`0`` &P0 0bP 0 P4Y *(0 ("4400$ 0 0,0X oS@ ǭ00 ㈪pX!gQ|;Tm:WEV\1|; -L,M` 0 ؀"4pKP@ . %4K@(0K P P@P# [$['0[(["[(,&[!P[8<%@[$ 40 RQ  0cP  N -L$M@4 ` ,@ p,PP ,0K ) 0K@@@ p?P@,0S@@T,4 ,0 , 0^ @@ㅪ0 N -LMP`p $P P@ $0K   pPPPPP $\00S 00  00  J -L$M@`p 0@ 屩PPb 0KN 0@@@@ pP@0\@@T  0,0K 0+ K  *K)K4K@@@ pP@0Q@@T, [00 0+0[ 0  * [000 0)0[ 0  40S T 0 ;@ߩ 0  N -L$M,`KP @pجY0,K0 (K$pKP @@@  -L$MP $ 1`L  Pp8 (K$0K @@@ `/P@$ R@@T00$000$ 0S (0S T0 @s 0  N -L M0pK@` m$PE.KD$h$t*0K0 -`K,pK+@K)K(K P PPp@  -SLM@Pj Qf뜁pQ0`0V :  Pp0 0@T@b@bPU?J! @0L\, 0 @=p0 @P@dDFA 02 Sʬ1b1 R0``00`0N^J0D@T;p H`X!g< g@ g(g -L M0`KP pΫG0KP*K @(K8)K0 -K,pK+K@ @@ N -L M(`KPp 㫫@K}(K0 pKP @@ -LM@}̠ 0@ @ -L M0@KP `p|BU0K/[@/K&.K)K4 Π0 -pK*K`(`K{ -L Mp0@KP` ROCV0K/['Ġ/K)K8'KP 0 *Kp (pKP - ML`0 PpPP@0nT `:PP` -LP -L d -D@!88#L!P` 4pK 00&((*&<&%4K20K1 K0K/`K-K,PK p0P00 0 00<H0 @ 0   P@0S  p0SZ0   S S  S S S  D 40PS@P  0`440 0 S@   048` 04D0 Ϥ@ 4K 00K @ @v0^ 0?0S0S,P K0@p K` KHP<L0XP#HP T@ 4PPK0pK@P0\@$<T`0 dP `@Kp@K40S0 440 Q -L$MP 60@0pQ2,Kl  隡5,KX0L @` `0S0@00 E؀9}; -LX  0 P0$0B(0P S 0딂h2$h0!;};~; p- LMQ0`00@0  "!\ R0000 0  000  "! 0  "!p锂hPh p-LM0@P`S2 22$2$222@ wD0P!!00P ` p@@@~딂h$~;-0!! R R0000 0  0!! ̝ -LM @ 0@0rhr~(h Q- L 0w: -QLM@  r oP~;\~; p-LM@ ,`K0Ps  00 ,0 02K80 $ 0 P 0pe:L2 -0LP 0-0@00LHP/ 80S0h 0';2 -LM ("(\`, p\PUB 0PCpu UpZ" 0S Up @PPEu, P@ 0SQ, P@  , P@PEu   PPE@u  p,   -LMKK!@ 0KK@ @s -LM K [Kl@( 0"( @@] p-LȠMP`,Ƞ@ 0 @P`Jp@-$0 @,@@ fff 0-LM K0[S00Q@@TpP0X0 0KK @P 00K[04hff p-LM K0[S00QPPU|`x0@`0 K 0KP P P0 K K [0[p4hff 0-,P@0LS 00f -LMU HTᘕ_ 0040 08#4 RT hX `@h(H&hX00$HTP0< P80 p@0@08H#8$HTP  8  B8 qp<00<0 U< R008 R0S~8 PR< <0 R 0@ 80 Tp@P0@08H#8$HTP 8  B8 @p<00<0 U8 <0SRQ 8 <0pRp0S0D0 000 SP4 P= X7 V1Z] @0SL W: D R) Z PU@ 110D P P  P,0 S0  R p H T 0` V Vp H T 0` V V 00`00,0 , (8h"(#8(&h, 00 ]@0@0H8$H#8T2w@t@H$H T&(j@g0@0H8$H#8T\@Y@H$H TN Hh~;p~;x~; PP-L +P)P NP00LPP3 pc`P@^00S' X0`S0P@pTWV G @PC0P@ T:$ 0MP~;~;$ 0S R,h -LM`ϟP 0 SP R἟0>0 IPR P P NAP AP) PT #PF HP  JP -U .U (0ES-0ES-U} ,@E0SU0SFV <@K r < .0SK4 0` x0HS- V0(S V<P0`0HnVHPPXP[Pm [=```AP@PmPz vPqmieam O[P OVPwNQsXM1PNHlNC >0S\]8PW^34PRZ.PM[)PN: X1PWkUNpP+L P&M\Pk DN`PLPM\Pk 3NPPLPM\P@k"O\P, OPNN jX1P !Pj 0@S0PjqPj @PjrPj zPjN LU?PPjLU* MU LU!P* Pi4P~*z Pui oP LUh1Pc*_ PZ@ie T*P PK 9`GPV MPQ0E)US<+U*U9 MULU6 NU4 L@E0S H0ES>.+:*8`4$YP 0S+ P,h00 PhPPgLU MUP?PlgP?<7P`LpE0SE@E0)US1+U*U. MULU+ NU) 0)US+U*U MULU NU 0S? Pf0P?PPf?PfrQP{Pw PeJUHU KUqMkP MfP MaPbe`,@E0S|0,STHSPO?NP ?IPE@De@??sPe: 0S?6hPd1 0S?-`P ?(bPd"#P AP.U,U /U ,@E0S=vPhd ='P = 'P .Uz =3P$d 0SD|@,T! 0Pc .U .U,U /U?P@c?P@c ? P ,T?P@Lc @ABc =0P 0S=1P pppb  pplb =hP?pP@by|?{bP ?vjPlbp?o`P ?jjP[ad=cpPaD]H\@0SW@VS|0,SaO?NPaI\Px UPD|0,SA?@ P<G;p8I7P,a2PO P.?-P)H(P$@#0`,h4hL2e:~;~;~;~;~;~;~;~;~;~;~;; ;;;$;0;8;@;H;P;X;`;h;p;x;;;;;;;;;;;;;;;;;;;;; ;(;0;8;@;H;P;X;`;l;t;;? P@AB\`,@E0S?`P` 0S?P` 0S?P`.U,U /U?P@` -L$M4 @400 )@K蠟Pɘ8@ 80僀 0 80`R:p )0K pp pWP@  0 `Q*800S80 04 A,h\d0 2S-L 0 p-LMPp@;0`00 X04 @0P P0D H0H H08L 8@P` 8 ph3ꔀ;;28<2<2|<2h p-L MP @K `㾗M0S  |m0 p 0-LM0P@KmP0-- -LM00` KP`p0#@ K0KK@@ pP 00 00鼀; -LM00@P0#`0K10KP1`K PP 0000*[+[0P[/`[.p[,[!2 B"1??@R@L NDB   A P`p{P`p P`p ; -LdM d d0,"{>Ch0 @0C8@ P0>~ 0p`gMPP 0g0V0@ p PWT( K,0K jVJZ0( P, 0L00 H<0~N0@pdPP *"*0 T *` 㶿V\$ K(0K JTZ:8n P( 0L00 H<qpW ίdK4800  dp ` \ T@ PP X ˹ 0Sp40< ,l<L h@ SH l#tp_LK0, D @ 1 R^Pt @RAR101R101R101 R0!&0h\h(h$h -LM 00#!ppb0S `r`@P0   000 R "060  "!00#!160   000 R ! 060  "!c  "!X1\1!&0   000 R?0  "!G  "!00!&0   000 R0  "!+  "!x0|0!& 1 L 0!!8 06  06e$h܆h(hh000 16 0 1E$hh܆h(h -0LM@$h 0 P16$hh-0  "!H0  0 ! 0!܆h$h(h06 -DLM@ 0Q@0 Z0  "!\h -L@M T< p'V0!PPa W |0 8p@[ 0 @!! 00 PPz@0  "!F\hQg܂; -LM x!0@  "!Q0000 80SP 0!!C\h -LM , ;?o`sp'J10, 0\ 0160PU PP   0 @PUv?o0cS`X,D0@0!0&$00 ,0!oH$h\hhPh܆h(h -LM<p0 0cS5$Q00cS 0 b0cR1! P0 Ppp 0p`Ā̔0 0C0 @0 lp00cSdL 0` c@0P` `n0 0cShhhhhfhf p-!A1LMd` 0@Pᑑ@0 0{0 -0 ( 0  0 @^`VL HHL0 p h( g, ghL g4;X;E.€;;;;> -\ LM0S H0K0 \ 0   0S 2L gh؃; -40L R 0P p-LM@P400  `V` 0  ph`帆0@004 0\040 \0@40 \ph; ;; p-0LMx @0t0D L0l l0P T0d d0@`(PKX \0H`<<<@0 0( $@ pi2i2Xj2j2j2`k2l2L~;2  `  ` -LM`dP{004 ,@}PU 0;P0 PP `0  04 8#8Ste ;00 p-LM@ `$0KP K0 0K$%H  P$0P@p ; 0- @LP P 0  4   0S $ 0 -LMX@0 , 40 pW8 00X0  P 1("(R R8 pW! d` V$ 0! ` Vx0  P   P` P , V40 0 ,00 00$ (0̂2h222 -LMԀ0pSP `0S @ 0 0 @8S`0SVp1SV 40 0,V0$0  eh;e hep; -LM @p0 4<0P,`,0K \0$ K(0K,d`$0S @0S (P0P 0P 0@S 00< 4( 0`|P`4 0R0< 0 00 0 @ `00<  h; - @LM0  0~n0p`fPP 0f0V@0*` VT( K,0K JTZ:0头Ķ P, 0L00 H<   P`0R P 0$ $ 00`fdfehf\f -@0L R 000 0S 0S 0`fdfhf -4L,\ \ `fhf 0- 0P @@ @  @ @RL h0T d`  0h@0R  Q 00# 0Q 0 000 (-"H 8TLpP#h1 '0T 0S \0 0 : S 0Tl0S 0 R00Q\ :@@0T\ 9\ : < -LMQ0 P @p/ T( R0R 1`T R 00Kp0; S, H# Rr Re R  T PPM P `@0`0VA` Ƞ ;,H; S) 0 @0D T  8:S00S@ 2T@ 30D8S0D8#H8T@ 008#HA0A11,R0W0 R001T; 00l1R d1R R;00A Rx(!t Ha[0 080 030 0.0 0)0 0$0 @00 00 <0 <0 9 ,`K 0<0 0L  -p!LM04 S\q1Tq080 0K  x8P`@`V@DPEAJ3[ S"[00b0cS x 0KxX8@ @08@ 040`၀?000 R # 3 R?H0`?À 4@ 0R # 3ee 4S @08#<@8oS: S>; S P 0 R0,R؅9 -LM@Q $2@2d222<0000000000000000000000 -<00000@ L `+ p\&0S \\ 0PP*; Sh!,\1R 0P: R: S:#:A >; S= ^; x   Sp , d0R P0 R:U  hK P0S έ ; p-LM0`PP@ S(pP o0\  00  00  0 \p -L,M@  `^Q 0S `^ \ ^PK aQLXPpPKa @0T*<@8oS: S >; S|p2Q} @ T:XZ WePKa @p0T[* ; S1QO: Sʠ,ʠ >; S<@8oS: S <= S= 1P: 1P7 |1P4 TP*00@ ;   S 1Q P0 R:U 1 c0 @0Tp:XZ 10 p@: S:#: >; S Pw: SZ%Zr >; SPPm0S徬 $;L;0Q 0`c Q- L透;\0`0';Q p-LMX@PT 0S1P!00 S P0 p0`0CS0000 R000S0S|0t 2c1劎PtD唭0D M00ሏXd2d<;; -LMp ,0 0'0#0#@00 40 0XY 4@ l0d@0l04 @p0,0p04  D t00h0t00P @ <0 R"8 ` x0S P?#<00cS{ 00pSUN faqh-pyp` @0iK0cS0x 0͇1p嵉XT0P  $0S ,$͏ygg,e$eh(h@; p-x0LM R 00p`B P0`S ph`000 0@@0 ~= p-LMQ@@P Q pTP P0S \ R 0`S 盔\ `1PS 0-LbMP@0 @S0 4P0-L0S600`"R 0fK1 Y0 S tY0n0 0`20(H0@ 2c 1 P gP;<\;d; 000pe 00C0pe -LM  -LMPp^@`   0S & 0S ^ 0S K09 P  0R 0 0 0 0 0 00  -LMp $0K`PP@0 PP @ @` $ $0 $P$0( 4$ P@0 $$0($0 0- 0 0CSL@ 0P U R 0 0 0 00C00  $Peg 0 -LM0p$0 @R1 1DQ@T XcXCXT#00LßQD  y 0S 00B0S S3  jhX 0f WP` 2X  0S00S 0S  ` KyP ` ` P L 00S 8 0V fVW0X0f840` p\PP` 00B0S Sf VPd P010  P 0S}?d0000dB0S0 S`\ X @ 0T4`090 /P@TX 0 ȕ  01 0CĠ UKV0Kg';;;Ȗ;0!;;~:Dz;D;p;|;;53;;;;934;X;x; -L MX p, 90S 0S,`0Vʆ0AP P , `0VX 0 DXZ  P X0S  0S<  3 K P  TI GP 0  0 00  `PP   ' d   W R d 0SS00D 4 0 Ԗ;;;H;l;; -00QLX0 Q S R 3(>3L>3|>3>3>3 X]%10#0 0 0000 ]%20#00  ]10#0  ]0%0  ]0 0 0 ]0 00  \~]0  @v]00 00鄘;;;;;;;Ș;@- R@ 000 R R0S0S p-L M`@`<f SPPb 3SV|S 0 S  0= S; L\0  L\0 00cS 0L0 0\0 P `YS|ÖBePSp"c|!h[|fSph鸒Ԙ; - @LM0  f; 0-LMP@K!01S 00CSA3hB3B3B3B3B3B30K00K K 00K K/[0@K} (V 0!\0 0[0!0!0 0; -LdMx @a x01, |0  R t lPK| 0x |0 Q | t 3x 4| hK@ 5K!00 | U0K0Q  h| 0pK x cp[` VP\ 0 ?>1!B bQ\^P` VZ U5` V 4\p0 ?>1!B bQ 0h B0P` V0x t |0CKh thKVK| 0  Q 0 ,0S ,yg;$;0; -L@M!0!`(0 3 4dpK5K06K2 @0Q0K, R@KP@  ?K0BL D0 0 㻑0PT C (0S P(y 0e%0 契PU@0Tg0!;;;;P R0$00S<  S \ 0S 00S 0 $000S 0S$00 0$0 R 0P 0S -LM@$0SPp P 1`1P,  P L1P P <1P 40 P  1P1P 1P P0P<@S0P! 0P ʼ0P0P 0P0P0Pʈ0P|0PtpD;;P;@v:Hv:T;\;Pv:`;|;  d;l;Dv: -L\MŸt !p x t0p A,0 p Bl WW| 0| Y I0W 0$0P00 l 345KY@H| 46KVK'0  X,0 S ,ox0I \V0Kf`KPW0 Y04 E F \P`x0tp hK TK3L34L3\L3dL3J3lL3xL3L3L3 0CKUK0 QhKl0CK U0K0 Z@ 0CKUK@0@ |@x@X pUKdd< 0CK0 D <gt;;w:0!;;;;;;;;;ę; -L@M̀!!P( 0p00 0` (0S |(w 3dK4@ 5K<6KR@KQD0Q@K,0 0?K0 0S 0S igЙ;0!;; -LDMܠp P, 0`0 @ @hKX  ,0S h,w 3VK45K<6K 40UK00 0$ CK圏hK(g;0!;; -L@MĀ!!0@(0 0p00`PK0 0dK P (0S \(Ww 3RPK45K<6K00QPK,0 0 ?Ka g$;0!;<; -LMp\ ; @W 1@S0pT OP`# 0PS@01S@T0S ʏW0 0 1 pbPӎL; -LMp1a @T 0PU 0PS 0U QOP@   UW  0 0p O @\  PU1SPU O00000CS(R3TR3R3@S3S3@T3T3U3 OP  OP@ 0 040iG]O@U NP 0@ x1 1  @@ NP P0T0@ Y  00 PU@@ NP P0T0@ :  00 PU @NPt *  0  @@ NP P0T0@   00 PU@@ eNPi P0T0@   00 PU{N<姍u@@ ANP E 00@pt; 0-L@PIP 00h -PpL`pf N`Vh pC!dT! lcd@pClVlfNpCh`ꘚ; -L,M` P @$Rp0S  0 R 0$S0S0 R 0S 0 $30S00S0 0S000H0 P '0P  HY00Q00SH Y00R00SL0 oH Y00RQa 0%S0S00S0 0SL 0^^$@ ^ 80BS0X3Y3Y3Y3Y3^t30 ^t30 ^  0B K D0KDK0,0 CK< 8 4@ 0 0H0Sx300x3t3@0t3t30t3`rt30t304圌K(嘌L哌^괚;;;,;`;; -L M 0 KT`(p 02P $\@\0d3 \ 0 pe 0P $\$\x3S M꼛;; -LM@( Kd00"0P , 0S P4 0$S0S 0 DQ0(0  4 S4 d#h3  LP`@ AP PU@* 0S 0$S p W1Q Mp W$ P@T 0 S q p Wp W P@T 0AS;$]3^3^3,^3@^3T^3h^3|^3ċp Wp P0S pWP L0S 0@T `0@P0TL P0 0LL友  5  1  -        0P L_ ;8;d;;9 -? LRP3\  _3`3`3`3@0 0@@$0 ZUL\00I|# 2lA %KU$0 0 $ `V, V 00 8(;U0<0 @ 000  C` (  0C W0, G00@00  C`VP 0(0 ,`UD@p UX` @00 @$ h @00 @$ D @00 @$ w:u;p*;(:;;v:? R  x3  x3  -LMt0@s<]2s hV -<L0 p-LMD0`0S9 ʲ` 0R& 00 P `0 0S`0: `l0 P h0d 0Rh0 ፲0d0ᄲ$ `l0 P h00h0x# 0-@L0< R0S0`0PS0h\d0S0d0| -L M0`<@\  $0K #T$PP' 0"Q1 @T 0S 0S $\ \0 pW 0p W$$0@S$0 P#ĉ9 p-LM0@<0S hP`0U l`l 0S`l0h00Ch0 R $0S PU`0Sd0pphp p-LM\`2 ,2 0 p\6\- \00 p\0SPU0P000 0 " 0S R00 00 vFp20 0 K@T00DSp3333PU0P 00R20 0΅PU2 00 P 0R0ޅ 0΅20 00 0TPU2 $20  P0$(0!P:00pe-0S S s 0S0S s0S sP   R 0B30 R  e P0-L@ T:} @0S @P80P4 4 -}0S000h%}d;d e ;:;h;P 0S S0S0 00 : -LM@ :00CS0h` p-LM 0`S@P*|$000( 8 0T0 < 040 L 0P0 d 0h0, t 00x0 | 3H0H 0 @`, 0:`p|ꄝ;';`3T3; -`@0PL0p<XP7㠰0@0CS0 W p0 0B)p0 ڞo0PU|| 00S PU@ 0@ 0W 00LJXd3dQ Q -LM0 @  0 ?]<< -L1 e!\:0> 0C0 n>S -LhM ` PPpK $P@ < R RXp0 SD0Sl -LM 0@S R P 0S0  0S   -LBM p0004p`5Pq@tam0 \Ymv u0@0X0 @T@0s 3@R{ CKA A Bf0,0 S 4,Q㭝P0S@P`0T!8|@|J0pSpW)P0S vP R@W00T00S KP`T@!T@#  ^  v>PpP R@T|00|0 K#g$;4; 0-X0L Ƞ Ƞ,A000|0P0CS00e 0-0PSL@D0 TL3> R0 0L P   0-X0L Ƞ Ƞ,A0000P0CS00e -LMx0S`P(  aX2Q 9L2Q( @2Q (0 S $(Q4002Q0S|00|04 @0R0 KPp-|00K K00 S;#0 0 w1t1QA h1Q\1Q% T1QQ Q@00 4@0@T@0 TpW  L1QH0D0Q Q@00  0ppQH0D0xP D1 QPx x0Svx ~g}fUDU@<;Uvt~fUU 0-LM\ @.Q@@?0@0CS00e -0LM Ƞ Ƞ,Q0S@p -A ` P0lS` J|e 0-FOL\ LmL>FOL ~L00Ba3<Q -L(M0PS`Z LpX @ W*0@ 0SLK S <00p0 T:!P0P @T*0P\?@T:@T*0\%@T:L0W 1S c LK/q@GTP LK0|  @{TQ*0P \ Q:0LKpQ*0 \ Q:0,LK p -LMm? R`1S  K` T!R\13 0K <\ 0[D!2 0K HQ 0[P!2 0K K0`0 Q-L H0Q 00(0Q`1 W@W@ W -0PLPp@0S' p+0\1c?@L`c ab. 00@W0@m004\e00ff; 0-LM00P@K4U 4 0000\ 00Cf 0 ,h -L|M`K0 K pK@XPP< @0S<6[S4 t0S 8\X 80Kp[Ƞ 80S4^00 1S80KḀ@40Oφh P40RφL P40Uφ0 P ;$;8;T;t;; -L M@K K5 0.P -t2L0M<00P00 @4 0p04K(18 K0(1(1<`K0(1 08@!4`Pt < 0S d0L!48`P` < 0S 0!48X`PC <00SXp7 `0Kp0 (48p{P `VF 1(Q! 0,wd,1`Vdp0 (48p\,1`V pڤ DK0D @@ O4(1Z0(10#(10d 48`?P @Ed30ܡ;;1;20!;;;;D9x28; Q0- L@P Q 041SN?@_Q -40PLP0 -LMp`@-L, )00cX00 #(1,1`XPd@P0E S e,1PU @,0 0 001X 410Sϗ@4, 00Lo騗N? R$1S010$1 0$1n0Q00 W@ - 0LS u P 0S0S00CS -L M p^` @c0  c IPr 0 P4V*0SW 0PU:PU ᱾P '@(K@aᇾ) [0T<0D0 <0s ^0 0D0D0S(!  Ic40 800 D ;c00P 0 S00S< )0[@T00SD    pc 0R0S 0S0S $c';;H;p;t;;;;X;Q Q p-LM`@0P0.HP)ߖ0@0CS0/ẖ0PUtt 00S PU@ 0@@ 00 ĺp陽ꗽXdh4d 0-LM0088@PLĠK^0 K0K@KKKKPKPKPKP[0 p-L M8`8@ PK00LĠ 0K#0KK 0K@K@K@K@KP p0!0 0K߾L 0SP -LM 88 `#4V *0X 40S 0S Q 0 @0  P0@b" ?#? UC1@+C#P0S0/"?CQ@00CS0 @04< P0CP1 R> D0s; 4DH0P60V00LR0LP0P SP PP@rH@o딐HPPMLT`pH@@P 00 pTPH0 0 pMLy00@N00@0-zde<آ;xeP4 -LM080@# 0 <@   ( `;;; 0-0 LA0S 0@0PSH0S00dHLHPPP0S PPݻLP@Pde -LM@0`ỻPp- ㇻPP& 0 S9#S$0 Ά $H6p0W D@$K PPp0 S9#S$0 ᝻ ; 0-`0LA0S 0000P0CS0 0de 0- LP@0!PP 0 ջP 0S 000CSPPP 00 -LMP`@` `000 4 080P@XY\` 0X0 Y 0\0 ` 0S4叻Pp X0S0S S0 X0Y R 00CS񟗩, 4D 4D 4< 4D 4 40 Y0X0S S0BS 4 4 4 4 4#0`T 0S0@T<0S~ =Q{ X Ru R00e 4D0 jP i4<@0 `PX0SI 00p@婺Pp @TZX 0S/ 6S, 0S' S|2Y T00BSH 4 4 4H 4 4P0 i7,1` ,`%`1>P X S4>H0 P P= i`>0S4κP 0 S00S=  X0S 0@Tf 00S> 00S<  i_PJ a > < : 8 6S(0Y0 00S PS 00';;(;,;e:8;<;9T;l;;9;t;ԣ;ܣ;;;; -pL`@P@P(PU@Zビ0@0CS0ӿ^AT P 0W1 !0 p KpA@ -QL1  Q S 0S L -L`p@PPPU@Z@P`@PPU@Z鳸@`ꕹp -LM0@S  1S01 1S齸P P1 010C1P1 ]; -LM`pP @ 0TP@@ Ƞ,Ƞ Z0000 R P@@x= -LM@PP`  h0!T` 0D0040 R PࠁࠓM=Y0S 0r0Ss 0Rr0 R0S0w00ZR0S 0{ z0 0$S$0 -LMP@U`1p @喹0<0L00MQ0PNPOPRPSP L0 -L ML0Xp 0 8@8P`DD!LMNORPPQ@S`j -L MP0pN=U``GGGL0 0 10S U0d0e B0C f0g 0S0)0K h 0C4i0 j k000nmo@lp)PK)0[s@p0qr?"  & 0P00p000 0 0PPEDd 0 P@00 0S Axe= p-L M0PS@- 0BS<44`44p4444@4T 0R0P RA R*R# T00CS000@  0PPpph9$0\# ] 8& 0 ?T T 0Q0ph &D 0@@@ 0@ T R 0\`@ `@48" <S^  hi0jk 48 L\ <e[4b[` 5P`7 H00H0  R@1J#T ,K,@ < >@˷0S ,,P,0S:0 S:#S@MH00CSH0 LS S<: e<; -@1LM (("AL0`SA0Pp: ۱PP3 H00H0  R*#R$ H00CSH0 $,X >hD$K P_P0 S:#S$0 P P< eD; -L5X;e5 XXmt00t0 L1OX |0p00p0 ~ 1S zl;P? R`| -LM? @R0p'_o# d R 5 \4X04i͂,0 00 0S  1S >O4< p-AMLAO0P `0< P 0 C400|\\  .ZP202p; N`p'N4; -LM@? R#? R 5+Q P 5;5Q 0S010C1<P5 ;%5 > -? LRP0p₏5@@ Z*~o @yTڴ5 H - m7P9 7P3 H ] V Ocx2S 5O@05% +%#4 X3T0m3P m( N ꠩;O4<; p-LM@? ?dPP? 3'dPP = τ%dd @*nPP ̠x ` PAmpS 4MpL H K4L4ة;;; 0-? LR_? ( R $@T ld0@Tc0 0-@LOP1c000,  0 -P?pLP@`wx1TZ1TD*1T4 1T ` L%# = S =@S @ 8C8`2%2  / o2 $ @ o5050 R0Ss 0y4P`5@`0l0T `0TT0P\բڠD0T/0`2i 1i i i 5i i 6i( p-L Mt0@0t0P`LO0 K`大 1SỀp8<`: -LM@h -00%P-@%LU  2xPS|P:P!`PpPP`PpP P ? r~{brx{blP  P02 L  }LVP |P0|2 xmL dgL@P xݥPxR ,XL RL8;X;x;;;ت;2,02 7 -LM@  . 20CS2h隬 -L MϠ ^`Pp  @0?0(0K:HCʠHC6 GD(K!K%K#@K"0K'PK&K$pKp@T -LM?`pPP 00S S @ @K@K 0@ K l0 PT0@U0[ [0ppK+ ; -LMϠ P`UCĠp@ K 0Kih 0P} K L0v @40Po[T pK! ; -LM82/ 6S00@ RA?< R 0, G0ShqK0; 0- 0$3_(0LS $@T *b0@T`0 0-@LOP`000,  0 -LM?D 0Rp( 00 ,0  (0S (]3 04K4 [30[ d1R`hU&h@ P0K< 50 0 Z0S0KΠ =0!U @P`gL; 0/Qـ 0-@MLP 0@Kl 0X 0@0@ @H(1[#4S4  <0@H 0@HK <0@@yH 0@pH H0@gH 0@^0 04@WHѭ  0   0-@MLP 0@@H(㺭 0@7H 㱭 0@.H<㨭 H0@%H㟭 0@ (0@ 0@0" -LM 0S0 0tP 00갫9 -LM`Pp,J0p2 ᎮP@"0 Q#?㕯@@"0R\#T3@/2R)P@ p$I Hb3!L p%.p᭤  `I0< H" 0S;9830@TL♤P 0 S00S\" 0@T}?0r4 -(I/0@  0`K0`K0`i 0υb υ0Z!?@@I~ (  X0P10p|!5x1 t!0p1o h!40d18  <0 L!L1p{ 0]$ R "0u"Y /0  }H AQ00S`"x00SX"s ip)I';9Lo4\;w4d;R;;;``0 +p^:t4q4Tw4$\4(]4]4^4^4;; -LM00PS0`/ ? hP9dP4lP/HmHj|2p0CS205@O ]2 0CS 2|H Ǡꚣ꘣ꖣQ Q? 0-L|@APU $ 011010  1 q|U0 |@@$e|$0S !0 0,(B q77BtZgXXgD[g; ?0-LP *$@7P  0S 0 hP7  4Pq7 -LMO0 S    JP7  PS7 -LM@0p(0 0`S0P 5@ R, R00RPPU 202PV 8̠8A   @3_8応B"0AR(0K g 0( T   04 S(0 l00l0h00h0r(00 0Pu 7Pl00l0 <P Zu E|4L; -P?`LVp0@ au5X;e5 XXm9ut00t0 LTAX <Sp00p0 ,p 1S il;P? R 埖 0-? LRi@0P 0x0 0kx0x0m0x0x0 0x0oPl00l0 p-AMLAO0P `0oq P  0 C40 <\\  b厚P202po @ Ep'`4; -LM@? R5+Q P 5;5Q 0S010C1<P5 ;%5 v -LM? PR0p5@@ t" ?~o gd@9Tڴ5`   0s7P5 I7P/ $  # "  82S 5O@05%+%8t^& D%&@0i%& P i&tG@꠩;<4<; p-LM@? ?$0PP? #$'*nPP ̠8 L P哚忙p饡 @p鞡 |4;; -P?LP@p`ks1T\1TF*1T6 1T ` s%% = S =@S @ 8C8`2/%2  `: `z2 `- @ [5050 R0e 04P`5@`0I 40T(0P\դڢ2i 1i i i i  -LMP0/@|To t00t0{?qs0 K p, 1SCs<`: -00%P-@%LU` V%8PP<P7@P`PpPP`PpPP閙rnbꐙrnbP @塘P0@2ꪠ ?ꤠ ?P <勘P0<2ꔠ x?ꎠ d>ؙP 8uP8R ,>y >8;X;x;;;ت; 0-LMP"D@0K 0KK@KPKKKKK10 0-LM8QP#@0?00K@!Ġ0%K K@KPKK0KK0K0 -L(M`0KhP@Y$0[# [4Sp>d4K8 KܺP@ H@!0>4Pp,> 000 P@6 0  P@$   0 P@ 4 妡唥nߟ LP>4x՟ (џ ;;ܭ; ;4;\;; -LM05P <5Ϡ000  m@/B0T00p` @ 0ȠȠ W p" \P `HT@5O<5 H 8  #8! 5# -LM @WP/P = hꤨ; -LM 0S4! 0 0P 00L9 -LMpBP KP  = ` l0@VJ(2S ,2S 0P|1 fPHP nqO@`P $l=~ 1!0@5 1!0 X 0pwd0  -q P 0 S00S," 0`V00S0"00S("  4*=鬮;;$;̮;#;;84444; -LMp`P@= =' |0Slr`` ἀ!ΠT开0\D i/i<';;ܦ;X4g< -@LpH2`Shpf0P0S 5@ x00p0H2Q Q? -RLM`pP P$ ; 0 0 Pp@4PP 0 !!$ !0``1` `bpU! zp@4$Wp$ R 1 0+10 ,`(`PV 4̠@A   @_動4n"0;R(0K 哖( R ~ 0 4(0 l(0 Sl00l0h00h0( P o 7Pl00l0 <P o ơ4L; -P?`LVp0@ o5X;e5 XXmcot00t0  L~;X 8}p00p0 Vj 1S >l; p-AMLAO0P `0k P  0/"-C4? 0@ 8\X  嶕P|20|2pÜ 4;Yp4 ; -LM@? R5+Q P 5;5Q 0S010C1<P5 ;%5 -L M0p5P@` n@~υ 0@/ 005  00 @ 7Pp w7P 42S %@ %5;5in P  :꠩;; p-LM@? ? 夓PP?  囓&nPP ̠4 L P3p :p ̛4;; -P?LP@p`jkn1T[1TE*1T5 1T ` ?n%$ = S =@S @ 8C8`@2N%@2  ?  ]@2 ?  @ [505.0 R0E` 0k4P`5@`040T(0P\եڣ2i 1i i i i  -LMP0/@|To t00t09m0 K p塔 @1Sm<`: -0 5P=5U@4LPP8P7<Pl`PpPdPX`PpPPPPrhXb drhlbꀔP <P0<2& 9  9jP 8P082 x9  d{9TP 4P4R ,l9 f98;X;x;;;ت; 0-LM @P0"PP 0@  呖PP 0S 09 -LM`PA@09 ,9I02  "0 eP'>'.0@ 22u P`9ړ022 @Tp>2s$ 2s l2~OP$K0` ~ ? 1 D 81!0@5 1!0 X 0`C1  l ʐ┓P 0 S00S"  80@T00S00S" $ :P ,T}(0!R@TuWPp 0 S ,(0!0"(1';;9@;X;|;*T g;44 44rX;t;; -PL[lPp`00@S 5@ 00-lmr -LM@? R5+Q P 5;5Q 0S010C1<P5 ;%5 - !LMOPp `0{h'>  P ||  q坑0Sd20d20K# p '4 -0 5P=5U@LP7 P8`PpP0PP`PpPHPHrfPb0rf8bꋒP  (P0 21 p7+ \7uP PR $7 7x;;;ت; -P?`LP@pDlk 1T51T&*0T 0T p @k @ p>@ s50530 R0e]04Pp040T(0P\2i 1i i i i -? Rt00t07<`: -LM0`5P@ k7P: 7P4 ?? Pp 6ij?"> Pp s tpO0\  pLx%@ %5;56꠩;;;4; -RLM`pP P$ ; 0 0g Pj@/PP 0 !!$ !0``1` `qjU! j@.$fj$ R 1 0+10 ,`(` (00C(0 ( R (0 Sl00l0h00h0( ` i 7Pl00l0 <P i y꼯;4ܯ; -LM@?PU`0p i5V;U5 VV t00t0 5V _i 児(K 03 P(0St0p000t0p01S DiGd `l; 0-LP@% 04 P*0S 0P:00SQ Q?Aq- $0A0 0!q "e -LM 0S4 0 0bP 00H9 -LMP`p@T 5 H5" wP@$ #?@#0S#@2/@3S0 KP@000400  4 2>ᡏ080@0<0 `Tk80se <0sb @0s_ h,`K 0P@J 4 U tP1tp!51 !01o !4018  <0 !1p  0@I$ R "0" PB0 2Kh nh4 Bh02a44.P  0S 0S 0@T0S@0S80S0S<d94•P';;;l4;4H9;4T4X44`4 444$;@;T;p; -@2LSPotP0⏉0⌉h2p0CS2R5@ I@02g0  -PL M@`P P`^EtF(K ”?00(0K%K#pK!K'K&K„$PK"`K*2P0CS2& -PLM@p` R`pUFG,K @00,0K)PK*PK+K'K%K(`K&pK2P0CS2 -PLMK B KT0  P00[ -PLM@p` R`UGF,K @00,0K&PK+K)K'K*pK(`K%PK幏2P0CS2굓 -LMP`B哏Tj7gp0/y 0 5 T  7PE 7P = w} u m lHH0S D0SP5P@@05%+%f TP0f2$< 꼩;L4<; p-LMBPT p+ >$ 64`0@  hTphh'Q Q -LM┡2 S`( tp5 U  <5   (0S (0K )[ 0)KDRU@ P5<5  0 0S ?0 00U@P5 g; p-LM2`SP4"8 "4D0 P&4<H0 POD0|  `x夋20CS2pbꂓ ,1`{ p4;; -RLM`pP P$ ; 0 0c Pe@$*PP 0 !!$ !0``1` `eU! e@ *$e$ R 1 0+10 ,`(`` 5X0p !1PZd Y0XP0Pha ㋅$UP 0 S00S " 0@T00S$"00S"  4a-';;ܦ;;$;4P44 4n; -@LEa`p`00PS 5@ 00a <anQ Q0m -RLM`pP P$ ; 0 0 P a@j%PP 0 !!$ !0``1` ``U! `@O%$`$ R 1 0+10 ,`(` τ$ @ptoPP ˠ( ` P嗅Ä驌 4+颌 ꞌ 44ة;;; p-0LM@PQ00 5@ R R00R``V p|20|200SU(phnp"0 *|bm,; -0`@LQPp+^0T 0T p ^505-h0T  R\  @ p@ "mi i i 0-P@P0L HR 0t00t0* 1S 0hm<`: -0 5P=5U@(LPP,P70PT`PpPLP@`PpP8P麄8r:Y@b괄Lr4YTb(P 0ŃP002΋ ?*ȋ 9*P ,寃P0,2긋 x)*겋 d#*P (噃P(R꣋ ,*ꝋ *8;X;x;;;ت; -@LP`]!1pR001SP1 P 0 Q1  ]X 10 1]7 -!L000p`0 @`P]0S$ ]] 0R000Sp0p00p]h0|0h0 |000~]000000 0@@0 ](h$hpjg -LM 0S4 0 0ĆP 00x9 -LMP`|p@tk) hg)ᄌ ٍP@@<#?@#0S #@3/@3S4 KP@400400 偆4 2>080@0<0 `Tp80si <0sf @0sc ]0`K .0P@Kp )  tP"1tp!51 !01o !4018  <0 !1p  0@f=$ R "0"(H P0 2\ ̀ ( \02(4⊃P  0S 0S 0@T}0S@0S80S0S<l ( T';;ܦ;4ܰ;h4x9;444$585454h4x;$;;; -@2LSPotPp0}0}\\2p0CS2嬈5@ p=T02%\0 H -LMP`P p 2S Q?0@0$0K20020FGD$K#0K@K!KK"`K KpK偄2@0CS2} 0-LMBPT 0K K 0PP[ -L MB T0K @K@KP [0[ -LM 0K\ K  P -L M@B$\ K0K K @wP 0-LMBL^B$L K0K PK@KK 0[PPP -PLBpT㓯e[o @Tڜl | 5R r 5 C h 7P5 z7P- g> j <H0S D0SP5P@@05%+%[;  p l0 [('@$  /;.4<; p-LMBPT pLD <` 00@  \T ph\.'Q Q -LM2`Sp`t5 X  <5  o$  DRU@ P   0S- P  0@pU@P5<5 Y   H@ o 5 &* p-LM2`SP4"8 "4D0 fP&4<H0 _PO̠D0x  `ˀ20CS2pᵆՇ (F&`· p4;; -RLM`pP P$ ; 0 0\W PZ@xPP 0 !!$ !0``1` `YU! Z@]$Y$ R 1 0+10 ,`(`vP 00ꬮ9 -L4M`P{p@p d{0Q0S@0D L0 P0 n}P@ Zz 0`00sPw 4 sP@ Gz 4s0P80 T4P0s- L0s( @0s|# 3 #S0W T0 0X D <0 < <4 @0 <1(0 , 4 8 0 $` (0 p!1TK\}4JsP& 0S00SL  0@T00S@ 04L000S 0 4SP < 0';;;;;;X;xe338;X; p-LMD0@SP`\ 0R`00 ,pp0`\0rDqHfGD` Q0- L@P Q 0\0S`@E 0-LMW0PXS0 0P8@ 0800K@0DD0K 0K KK0KPKPKPKK@KHt0R RR W0SWX0SXQd @ 0-LM0088P@0@NK0K0K KKPKK0K@K@K@Kt0 -LM#1@R#R<K Qp 'Qp KQpp8'48`0'Ƞ'0K@0@'\N&K$0K0$K( K%PK#K `KK0K@K(pK"@K!@KsKQp Qp Q p  Qp K Q p Q p 0Q p sp  -LM@h0  0-@@ LP  @@< S@  S@  S@(d@n0 -LM`0@S a@0s D0f S Z0LLH4@, D0 @PpP 05 0-`PLU@D0S0qPDupPHfDP|x vx ij;;`0SH0R RRDqb a 0 b b0\<<b0fRa00Qb00 -LM 0S4 0 0sP 00Ԯ9 -L4M`Pyp@` Ty0@00`D L0 P0 +{P@ x 0\00NqPu 4 qP@ x 4Aq080 T8P0s1 L0s, @0st' 0504QPT0 P1̠@ < @ 0` , (0 4 D 8 $P P@ w 0 An 0TKX64qP 0 S00SL  0@T00S@  04L000SP  @ 4';;$;;;;X;e|;338;X; -D0@pSLP\p`X0S\p0 mz0`X0pDYoHfD` Q0- L@P Q 0X0S\@ 0-LM?0@/PK0 K0K0@K@K@K@K@KK0KrP@04w 0P; 0-LM@ @0PK0@K@K@K@K@K@K0KKqP@0w 0l; p-L M@P %@0` K0@K@K@K@K 0KKKPKqP@pv _p鈴; -L M(`KP!0@ p@0C&PK$K#K"K!K'0K%K(KqP$̠P $H00$PK#PK"PK!PK(K'0K&@K%KqPPv (餴;P0SQ55005PQ0SQ55005QQ5@05R RR 0-(@K QLP U >ʖQ: 1ʖQ- KQ 0     008#(< S SwP0 LP0 S  S08#(00KQ Q Q ʖ Q K Q Q $0Q   -LM\0@S@0s D0S V0pP `K0 kV0PEUU V0P fLLH4@DD0d @mP @ P<Ĵ;;5̴; 0-\PLU@ 0D0S oPDmPHf`DPu .u (ij;; -LM\0@SHR RRu DhoS R 0XV0 0R0R00R0 S00S0S0 0S0S0<<S0h銚;RR00QS00 -LM 0S4  0 0qP 009 -L4MpPv@P Dv0<@00pLM L P KxP@y0vnPr 4 nP@f4mn0`80 T*<0s! P0s L0s 004@DT0 h1 @ (0 4 8 0p ,@ $P }k0x0f   Hf <0+S`d L ! T0S4XT0 gP0'iPD 0"iP\ 0) 0X T!0@ 4<0gP@  00|eض;; -$0 (("L|e 0-@DLP-\P&80P<PTPHP `Px00x00f0`0f0H0WiTgTPRi<g 0 S200S1+ $0@T!00P P P 0  p0 5b00S0 00Sp0   X ܦ;';;;$#(#.#,##d*h*|*4#8*;;x;}#h}5<#8#Ш; -LŸ2 RP0p  0  0SXb0S=;( =@K%!@00CS0j 0S A ` 00C! 0Pa0 S AP?AP#xAP =d1 adX cP00&k  k  idX cP00k  k x QdP bP00j hg j Ta \ix*|#}#;x#8*<*L#D#H#$#;ت;x;;8;X; -0LmMSp  !`B!@%=?ZDP U@@T,0 @  eYV0    cbP0j0, L 0騸;(9<*H*̸;0*4*D#'dt5; -LM?pH0 \`,0 H \(A0S Q00C!00 S1 @I ]0P p0pᴠᶐ,0@0000@ *|@  ,p @c ED0P@@KoE#8*<*(*,*D#s5' -2LM 2Rp` l2R `2R ]PH2H"p 0 00@02@ BŸ   @b*,$ 0@? SO 1 R 1R" ʌ1R 1R T|1 @p1 p p 0 00 0 1R 41R0ASl5l5l5 l58l58l5(l50l58l58l58l58l58l58l5@l5 0P 0S0S? 2K"K,pKsH0 ,pK2K"Kk# *$*D#s5'*D "( -L@M`83? Q@ (3\ 3Q d3QA  ] C0?pP% W@-00 00 Rh2  *lŸ $` p b 7l2P@ @    B,%-(~ 0""K0 2K"K 1 R 10S SK,`K1 R\1Q 1Q0S2K?,`K2K "Kd!P0p2`TKPK&zV?G K5K]PpPW 0"K0C "K So5o5p5o5p5p5p5o5o5o5 p50,`K2KT0000000S:T0,`K@KBK# D#'s5$*;( 8 <" -t0tPL @`T0 0 q @ w40P 0(00C ` 0@ #8*<*H* p-QLMd@ P L0L 0 S `V`p0` \#H*<*8* p-LM\@`P+  \$ \ 0 \0 P 0S|0 \p0 d 0 S pp40P$0P#8*<*H*`*\* p-LM 0@0 0`_P Pt01P@ 0@@YP  ,0 S 4,VG4s0KtpKg; -LM!03 2 -L8Mp0T`KP4  0 0 0T0KR K@SKQKP K00Qڣ0*JKΠ >P0*0K"Kp0 0 )0Kd0@) K&0K4 >07!0K$K#@K(@K'@K%@K, 0S  Bg ; -LM=@SP `Ktp 0 S K U0 0KP  [PP -"L|M0PK ,0 ϊ  0 P@0 2 ,0S ,阐Kl u`2 Qh00KP2 K@K@K 0@ K K0K@K^ 00K!*0 0K0+ KKK0KK@K`:S@K S000K> n Kp`P4@`*p6W @P`0*K,>d@ 0.K K0K-@K/@K l vP@  P@ HP@P  0PP@}  0P@s|  0P@i  0PP@`  50Pw@Xgd9; * + -LX0`V@0 9XP 0 S00S+0`VP@ iQ~L1 @1 .001PP1`9IpIi-12 @1/@1 ψP 00&N *. *`V@ڗ?09 (p1!51 0!1 \01 ;! >X0+ {岴@%0@ -@0 @000\=00S+r pkꤻ;p^:   te 5555555  Z 0-l00@ PRL  P ;S R0wWuW Q Q  0S00 R-L`pP P$ ; 0 0 Pp0@PP 0 !!$ !0``1` `=0U U0@l$20$ R 1 0+10 ,`(`PV0L@0~  xVP@7 DV0S70  7P6 0- ^!L p@`Vp X KVP0 `VP10A7 . p-PLMU`@P0S 0`S 0SPU@p7V`* ` -LKMR`2, pY0 ,0S ,5A0AS R RR XW @Ÿ@B0  @V?U V>K PV01S4 @ 0 $ B@10! 2@018 0 08 < h00h0m/D  7Pl00l0 =S80@@004 0 Č41Ȍ @̌0RPP61 >0 RPP,< . PT ASPP@%@ %5;5l--p b- ^-Z-$yu 6 5;; -PL@`p]-10&S^`5@5@5@55@5@5@5@5@5@5@5@5@5@5@5@5@5@5@5@5@5@5@5@5@5@5@5@5@5@5@5@5@5@5@5@5l5l5505Y0 R - 0E%@  Q @Q @ A5;8; ;  @H  4P5A0AS  -L M5 A0AS@%P 0 R,t00t0` P 0~ `VPZ1S,bl $KxS $  -LM@P,5`=5e;S~;S   io,mS RkhS Rk -LM 0S4 0 0UP 00h9 -L M0;u[@d  `}[ \P0  oR. SP h PS ++0@U;s ;s$ 3#p;p  ԋ` 0; kw R Z , @~t> ; 092iy9 RI l X P&NxPN>U0@ 2 "52 0"2 0 ( `1!; !!w3  X0㕯@0!=H= 1 1!1, =oOd$PO4P=@U0@dPO(P=U0@ڕPKNP=U0@ڌ `RP 0 S00S+0PU?00S+   os';;;;$; 5 55 ;ܳ995h555Դ55x) H ̳9; p-LMP0@E+`_ᕴ/ LFC;S P;S 6 + /OpR PR PQ0; 0-@P L\LbQPP  .Q0S4 < 0  H;l; - <p@SL`PlNQ | -Lp`{ .QP Z P0SS *@L+0S@!< 101,<$00,01<, *<S. *PL$*,$0S 0,1 01;00,(,<<0,8 ,1 0X<`8  tZgXXgD[gd:K P0!#R00@1  S0C⠐81 E) @PP 2!$ ! ! )U *) @4$)$ R 1 0+10 (,g>41 <S20 0 "004!0 0>0 LH  L KP<@0<1 ,0S ,0  L@PP 9l FK!4 0 )l00!$   1,K:)01B KKQ )H͗1 0KK $A 1 , 壨  P7 @jg 05 ; -LM5p=@S`0P `IT$ <S0Sd9`9h90Ch9 $  P $ .P0P<05 c5;59S@T 0S1010C1,R$<P$ K P@ P$ P $Qt00t0B - )00!5R!; A5@! -LM0 5P<@SC\0P̂5 h:t00t0W: -LMP@`#%l1T0p! CT1T2 L1T  ,p4W $5A0AS p505 0S 5 @ @    4Pp9S"L00S@0T  ်4Pp i i i ϖ1i -L Mp@Cd? (K 'T(K'K%@K#PK!`K&@K$pK"0KMP:R 0; p-L M@?0P$` K " K 0K0KK0KPKPK@KPKLP[pR pP; -L Mp@Cd?(K 'T(K'K%@K#PK!`K&@K$pK"0KLPQ hP; -L M@p`&@0(K  'T(0K'K%K#PK&`K$pK"@K!@KLPQ Fx; -L Mp@Cd@(K 'T(K'K%@K#PK!`K&@K$pK"0KLPQ &x; -LPp`@Mp @TT $h h le:, !0-"(LXP@MQ @TT G0 0; -LPp`@x4  @TT 46@A%C("(4$He a1l|he: -L M0p@3PPE 0 #0Q1##0S555$5505858585858585858585855(#$3 1 #@ 9S 9S FoZ  FMN]%o"|2 1 v#)D pd"Z -H"fD2 1 `#@ "Y2 aC0I D@O JZ  -D!@1` : 6Z  , h!,l1 1 &#)D  $1  01[8#Y#h #͠##: 0P`/̄<\l02-  0. <0p -L`@u0@h#cTdTDP@p  @GTP d@9f: p-LM`POV@ V@@|0 L\R@ #T@  8, @ ph  0-L@PT T 00CS 0h -LMPc0@1 @T@T0>S @"cTdT  "bP9l0)~Ol.0 NQH p@ 0t~ @pm !0@tT`pڜ GP N 1 > 0 EPP|1 >0 EP@yPD3P,. 0  F !F Q 5QN n    5;5%@ %9 S^  M \TM H@L9"VS; ܽ; 5D;;<;\; 0-@PP\5L=05U   t P;S ;S0hF E[F E[gF[D .0-0@L PNq W0CQ  T 00HSAQ B00HS00h< -LM`? (K$K(K^T@L0p 'KP#K @&@K%@K"pK!@K?F VE5 p-RLP΁.M`  0 pht0 tP0P@> @@ ˅K 0phYf ;b d < -LMpzsP`Us 0 0$  0Q< $P< <800S`P 40PP<00S<0   Zz ` <4<8  4  @h h0@K4@ , @P 0 P $000S$ 0040$0$40D`(00(0 d55Ծ; sr-LP`p  0 $@T uv u 80U 0@Tv D0VW W-P  ;(;H; p-rqLMP`  0 $ R uv0@ u 80U T pv D0VT404040@Prh; -QLM@8 0C?. B"0 鐿;; - 0L0\ s0 00 0-$@0 TLP,00 L0 P0@T0 0-$@LTP L0 0@T0 0-$@0 TLP,00  L0 0@T0 0-$@LTP L0 0@T0 -PPL0@& 00 1 ` ^{'i$8 80$8P 8T0@8$0P 8$8 4  T0  h뤸9; p-LMT P0`@H \ 8  0$ P@0 8$8P <8V @ $8P@40 }TppT0 p0h@T0 00 T00T0| `X08<#30$P 8T0@ \ 0 <$ 8P< 5<; 0-P(0L0xT0@08T0$P0 4PL0 0hI p-LMPP 5* 0` p8 $48@P0$ 4@@ pd R0d0 `00S`0 L0`@@ppp p-LMT0@![Y$80 P8}`$8P0 4P ` cVH0S T0  p8$;P8 T0hT -LL  -PP 00LR`p @$<0 T ,00@mh, \00Q0S p-LMP0`, P@ @@0[0Td0`[@P`dp 0-T0L @PP X0  v k _ U\0   B 1   X00H  00h魳T 0@ T d00<0H 00㝳T 0@ T d00<0H0 0㍳\0HT  0d0T 0+ ~\0T H 0d0T 0+ p\0H( 0gH0& ^X0H0& UX0H0# KX0~H0# BX0sH0":iHPQ- -LMT0@h0S 0 ?C5A0P 0S0Q T  (RL#R!&R$0RA0R#& -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 000. 000008P0 $4P0@8$ 4T0@@ \0 -P   006    0000000  < 000 006 000@006 000 0008P0$ 48PP0$ 4 -L>P (9 p-LM@P`/  |+(0tH0 L8 P`0 T0d  $8P4 00 X0pphX(9 ;9 0-(0PL@ F 0ES 55X5L5 H0"S 00 H0"Syp H0"S 8P0 $408$;P 80% 8P0 $4V>8$0P 80 -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 0 00000$8P0 4# 8P0 $4P0@8$ 4@ 000 006 @006  0000008$P0 4@ 0-@L8P0$ 48P0P $4$0 S8P0 80 -L)P L9 p-LM@P`  t(0lH0 L8 P`0T0 $8P4 00 X0pphEL9 ;@9 0-(0PL@ 7 0ES 555\5 H0"S 00 H0"Sfp H0"S 8P0 $408$;P 80% }0 -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 0 000008P0 $48@P0$ 4@@@DT5454545545454545454545545454554545455000000000006006 -LM@ 8$P 08 -L2P p9 p-LM@P`#  t(0lH0 L8 P`0T0 $8P4 00 X0pphNp9 ;d9 0-(0PL@ 7 0ES 55585 H0"S 00 H0"Sop H0"S 8P0 $408$;P 80% 0 -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 000 000008$P0 4  00000000000006 -LhP 鬹9 p-LM@P`Y  tU(0lH0 L8 P`0T0 $8P4 00 X0pphꬹ9 ;9 0-(0PL@ 7 0ES 555`5 H0"S 0"0 H0"Sp H0"S 8P0 $408$;P 80% 0 -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 000 00000P08$ 4000  00000000006 -LP ܹ9 p-LMP@`  (0 H018L0P`0d 0T0 P2X!3SC L T0 @4H00-㍮H00@ ㆮH&0!,~H&0*wH#0,oH #0hH  0ph`H+-0?> S$  4 T0 0T0ܹ9 ;й9CP 0-@L8P0 $40P$8`0 88P0 $408$9P 8P$8P0 4 P }U8P0$ 40P$8; 88P0$ 408$Pp0 8 $80P8$8P 088$P 080 p-LM(0P`@ R9 1R pH0,S p5 8P0$48@P0$ 40`0d 0S`0L0` R H0"SH0 S 8P0 $408$;P 80% 0S`<64646@64646646464646646464646<6L0$8P =8$8P 08L 06S $8P0$8P <8$8P @0L 06S $8P :8$8P 0$8P !<8$8P <pL0rp -Pp@ 0`,@00L 8P0$4 P8P0$48 P0$ P48P0 $48P0 $48 P0@$48P0 $4P08$ 4,00,0 00300  ; S 00000T0 + 000 00000000 00006600T0      004+  R  R ; S00400; S004  00 0 -LMT >@$8P8$8P <8$8P <8$8P > -LM 0T@$P  @%#,00R0S ? <;Z p-LM@P`,(0H0 L8 P@00T0( `R ph $8P4 00 X0pphS@;9d; 0-(0L@P0  H0"S0ES6|6660%0tp00; -LM@8$P 1<8 0-LP@P  0?.C5BBTL 0 0 別P, 0 健PꜺ9(_<; p-LM@P`0S  ( |H 0LP`8000T0 $8P4 00 X0pphmꜺ9 ;9; -(0L@pPA H0 S?0BS 6 6L 6 60% ` V a80P$ 8 0$8P 8;?8$P0 4 - 5; -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 0 000008P0 $48@P0$ 4@  000 006 @006  000000$\ 0 咤P8$P0X 48$P0 4 ; -LP غ9 p-LM PL5 3S@`* L5 3S?   {(0H0 P`8 0L T0 $8P4 00 X0pph\,0L0? 0L0 غ9 ;̺99 0-(0PL@ 7 0ES t66@66 H0"S 08<0 H0"Sp H0"S 8P0 $408$;P 80% 0 -LMP` 0P00,P08 $@4 ,0 0,0P0p8$4 00 0,  00300 0008P0 $48@P0$ 4@ 00000 00000000 006 -LM@8P0$ 408$0P 8 -LP 9 p-LM@P`  x(0pH0 L8 P`00T0 $8P4 00 X0pph9 ;9 0-0BPL@ S 6666 H0"S 0_c H0"Sp H0"S0% @ -L?P ,9 p-LM@P`0  t,(0lH0 L8 P`0T0 $8P4 00 X0pph[,9 ; 9 0-(0PL@ 7 0ES 66L66 H0"S 00 H0"S|p H0"S 8P0 $408$;P 80% 0 -LP P9 p-LM@P`  t(0lH0 L8 P`0T0 $8P4 00 X0pphP9 ;D9 0-(0PL@ 7 0ES p66<66 H0"S 0y}0 H0"Sp H0"S 8P0 $408$;P 80% J0 -PP0 @0 ,0L8 P0$p4P08 $4,0 0,0P0`8$4 00 0,   00300 000 00000 00000000 006 -LM@$8P 088$P 1<8 -LP 錻9 p-LM@P`  t(0lH0 L8 P`0T0 $8P4 00 X0pphꌻ9 ;9 0-(0PL@ 7 0ES 66686 H0"S 00 H0"S/p H0"S 8P0 $408$;P 80% Fy0 -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 000 00000P08$ 400000000@006 -L.P Ȼ9 p-LM@P`  x(0pH0 L8 P`00T0 $8P4 00 X0pphIȻ9 ;9 0-(0PL@ 7 0ES 666L6 H0"S 00 H0"Sjp H0"S 8P0 $408$;P 80% 0 -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 000 00000P08$ 4 00000000 006 p-LM 0`0@Pb 0?.AB"Z(0H0 L8 PP00T0P0 $840  X X0 \0  ph,ph4$8P04\H;x;9; 0-(0PL@ 7 0ES  60 66 6 H0"S 00 H0"Sp H0"S 8P0 $408$;P 80% 0 @5$ 3S? P @ -LMp`(0H0 08 L0Pp02 0d T0` P0P•L\PBp 0L\,0R 0*Q0 H&ťT0X0?  R;X0 X00 X0i0;9ix -LM(0@p` RP2 *R w{ H0"S 5 `P2L` ,P`0d 0S`0T0``0T0/R H0"S H0"S5 0T00pP2L0 ,0qQ* Q T00T0QL0P•Lp ,P•00Lp \0a6SP•L00 \P2Lh ,P•0L0h \P2Lp ,P• 88Lp \06S/ P2Lp ,P•C2<0( H 0L80P` 0d0T  $8P4 00 X0pph|9 ;9 0-(0PL@ 7 0ES +6,6+6,6 H0"S 00 H0"Sp H0"S 8P0 $408$;P 80% 0 -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 000 00000P08$ 400000000006 -LM@g<0 S 8P0$485P$8#8 88P0 $486P$8#8 88P0 $487P$8#8 88P0 $4 0 08$P 8 -LTP |9 p-LM`@PE  A(0H0 L8 0?>C2<0 PP @ 0 0d T0P0 $840  X X0 \0  phap$8P04\|9 ;p9 -(0L@p`P RF >R  00R <0SSS , V00R0S H0!S  5 8$P0 4`0d 0S`0`R H0"S H0"S 8P0 $408$;P 80% L 00SU416036036 36036036(36036(3603603603603603603603626@0$6S8 0P8$8 0P80$8P 800Si$8 0P8<$8P 8<0SX0P% $8;$8: 8J -PP 0@, 00L8P0$p4P08 `$4,0 0,0P0$84 00300 0 00000P08$ 4  P000  P  P0060 P0060006 P  P006 P0060006 -LM@1L0<0PS<<$8 88P0 $4 X08<C3P$0 8 $8P <8$8P <8 0-@L$8P 98P $8PP40  0U0: -LM@RP0Pp(`\Pr[X3 "">S S( P$81 88P0 $490 $8P8? R8P0$ 408$0P 81RRW P$80 88P0 $49P$80 88P0 $408$0 P8P$8`0 88P0 $498$0P 8Pp;p0; p-LMP`0PS@(ph !0$!8PP81SH9 p-LMH`0PS@p!0$!8PP81S꨽9 -LM@P8$0 88P0$ 483$8P#8 8P$80 88P0$ 483$8P#8 8P$8 0 88P0$ 4848$#8P 8 p-LMH`0PS@p!0$!8PP81SȽ9 p-LMH`0PS@p!0$!8PP81S9 p-LMH`0PS@p!0$!8PP81S9 p-LMH`0PS@p!0$!8PP81S`9<00C2S<<6<6<6<6<6<6<6<6<6<6<6<6<6<6<6<6<6<6<6<6<6<6<6<6<6<6<6<6<6<6<6<6<6<6<6<6<6<6<6<6<6<6<6<6<6<6<6<6<6<6<6@0SStY -LP 鴾9 p-LM@P`  x(0pH0 L8 P`00T0 $8P4 00 X0pph괾9 ;9 0-0BPL@ S >6@>6=6>6 H0"S 0& H0"Sp H0"S 8P0 $408$;P 80% +^ -LMPp@ 0`00,@8P0 $4P0P8 $4P,0 0,0P0$84 00 0,   00300 000B 00000$8P0 4$ 8P0 $4P0@8$ 4@ 000  @006  0000000068$P0 4   006  -LP 9 p-LMP@`  (0H0 L8 P`0 T0d 8P0 $4T   0XX0 pphH'ϝH' 0ǝ9 ;9 0-0BPL@ S $B6DB6A6B6 H0"S 0 H0"Sp H0"S 8P0 $408$;P 80% *] -LMPp@ 0`,@00 8P0$4 P8P0$4$08PP 4,0 0,0P0@8$4 00 0,   00300 000 00000 00000000 006 - LN5 Ó0 ?0 0 P 00ذ; p-LM`@P0 R %( H 0L80PP0 0d T0( Rp ph $8P4 00 X0pph\;ep;D989d; -1`LQPp@V(0Q 0GS E6pF6E6F6 H0"S H0,S 5 `8 P0$48@P0$ 4@@ `0d 0S`0L0`@|p H0"S0% -_ _e7T9p; -LMT0P`SPJ 000,8(!P0$4P0@8$!4p,00,00S ,0 00 -P0$8 4 0008P0 $4P0@8$ 4@ 000 00000000 00600 e7 :;;d9p; -LP 逿9 p-LM`@P  (0$H008L0PP 0 d0T  40  X X0 \0  L0p$8P04\ꀿ9 ;t9 -LMR`p@P? 7R  00R 5, V00R0S H0!S  5 $8P0l 4P`0d 0S`0`PR H0"S H0"S 8P0 $408$;P 80% L0P0$8 400SGK6\L6\L6K6\L6\L6PL6\L6\L6\L6\L6\L6\L6\L6\L6\L6dL6~` 6S" 0S0S $80P 8$88P $#R4$0 h0vPpb U' ! 0ESWW 8P0$ 480$:P 88P0$ 480$: `o8P0 $408$0P 8WW 8P0$ 480$:P 88P0 $480P$0 8P0$ 480$:8P0 $40P$8: 88P0 $408$000d 00400 6 <80`05pP \p  (0K80O^W P(@,K@*g<';6P66 0-L@PB  ,0\R0h (0 ,, -LMpp4 )@˾4)0|0 S0  ;8#000d $3R3R*3R 3R*3R3 R 0 405 2R{2R*2Rk2R25b:0600"SS228`00<0 80`V P |P㬀80`O^V Pp0t@ 09 l%d04 p5S A,0K0K4 @yp5S P p5S `p5S4 9pt 0@ R0 0$1R:1R1R1R 0R00R 0000000g0Rd:0R0^0R 0R 0Tt0R0O|0R t0K`0R d0Fg<6$$K$J$$!$.066h<6$$$o&$%'v&qqʄ -LMpd)ν ,|0S 00@#A>000d 0 506 0 040080*3 `0<0 2P P*2Pz 2Pv 22Pr p0t `0FS5880`VP \ 080`O^V Pĕ\  ,0K B0K@4S `4S 0   @ P0#4 ``<4 Yp0t  @ P ?` 00 p0t    @ P0#4 ``<4 up0Pg:h0PdbaP0P]H0PZ*=@0CSVg<6P6'%$$%6Q&S&"( ( -LMp0t@  2"r,`9r! d2 pL"0U RB = ,K+ K@12d1 ,0K @T,[ P+[@p12dQ00@TY pt0@ @ ! 0 T0p 0 ͠ 0S Ɨ+K,KR01,0K, [+0K  0 ,K+ K0,[+[ 0Q ,K0 0Q 0 ,0K+ K|0+[,[t 0Q 00+0KT0T 0Q, 0S0!,0K, [+0K  x>Aeeee -LM8 P8p0@ tp0@tD p0tH , p0tT @ @$41 0@00 4 @98D48 < p,@!8,27, 2<O^< p4Qpt 0@ p@t 0D pt,0H p@t00T 8om4! 0T0` D#@3 QQ 03Q (3Q 3Q 3Q 3Q 3Q 3Q 2Q 2Q 2Q 2Q 2Q 2Q "2QQ{ 2Qx |2Qu t2Qr l2Qo d2Ql \2Qi T2Qf L2Qc D2Q` <2Q] 0,"SS RO000 0R0玁0 C800 ( &  1 ,!`, 4< 04 {< R <X< @93<  0R0` C` @90 0'0  R0000 0S0:0 0 S:'0 00'Α0 0 00 [%&$!$J$K$$$$$$$o&'ve -  808 0 0 0 eeeeE-08 P` @TP0 p0P:P 00^0:0SS00Q  00QQ0 0Qeeee 0@-P@ 000 000 00eeee -LM`4 )I4|0 S0 1!00d 0 405 1Q^ _1QZ 0601p`0 080< t@ 8 8 80pWP  g0Pᬀ 80pO^W Ppt80@ 8  0l%4Tpŕ\ ,0K4 @0K@/\8 8 pŕ4\ 0Y0,0Q0g<6Att$6h<6it -L MP`0p0t00 0H 40 p0tP 0p@0c,Ÿ2t@ ,  p,@ pWOY>pt0H p@t 0P  ! 0T0g! 00 4 2 00, 8  R00ą 0g a 12  07\00L000Ũ0 ` 12 # 0# 04h0 PQ 0 0Rg0 0$00g0~/:y/:t/: th< -LM4 *0`S(0#4080 408 "3R 440  0 p0@ p0 P <S  40S 3%P 2P }2Ps ظ060440|0 S0  60+S2 d000 00"040` <588@80pW P8 P㬀80pO^W Pp0@ t g0 l%喸804 p5S A,0K0K48 @p5S P p5S ep5S4 80p t 0@ 0Sa0 1P0?SW0}S0y0S0P 0PkD0j0P 0Pa 0  p0@ p0 P =d1t0g<66h<6h<i<i W 7 04 0 u4S@,0K0K @04S 0FP W @ PP  < 4P  0e$4 }wf 000d 0 506 1!`0080l <* (0R#480`ㅀVP \`  (0K80O^V P@,K@4S ``n 0 @  0 0@ Pg<';66466i< -LMp`  ,05\R(0 0 1Pt@  0\i p0Pt p@t0  80 ,,/: -LMp` 0,  Rd`?ڰ#0稃!01Qx@  |3\t`#0 01Rx@  <\(#0 01R|@ 0 ,@0S 6p666(6 i鮰 0i駰0SV   0S1 0  0PzXU22002V v0#P P imk 0 $  $ 0 $ 0 $  0T 8p0Pt p0t @ q$p0Pt p@t <Jp0Pt p@t0 #/:Pi 0  H 0 t $ 0 @ jP@w00 ,2R0Aq  0\岯孯0|0 S0 4 !A> 000d 0 506 1!<`0l 8 0(K P l凯 0($ @PD1(`@ (Px U! m@18 3d1TP@ 0S 4S `QU LhJ?p0Pt p@t 0Pi000 P$013$0@ P⊡ X00P  PPX, 001  8  N04$/:j< k<eDk< -LMx0@  001<@$0 01 $ p-LM0 h0 P@` 0 <@Tp 1 0  -00L!0D $ -40LM@0D T -00L!0L $ -40LM@0L T -40LM@0T \ -LM`P )n2pqQ0 Q0 f@0r `+P@c |0 S10 !000㜡d @40 0`<58 @l(mPC P1P!  D30 8/4( K,0K 0 0 0}4SM^P 4S 0-pt 0|,K (0K[XP|@D|@pk000d @4@5 Ɵ RR VR vR R RR X6R P6R R R R R R~ <6RRx R6u %5QQm 5Qj 5Qg 5Qd 5Qa 5Q%] 0`  <08 5RRN 5RK 8`%\5QQe P5Qb H5Q_ @5Q\ 85QY 05QV @5@%<545  8p〆  WpPA` t 0pd@0t 80pW 4RR |4Rᐄ 80 \0 $0 T0 $0 T80pW P P#80pO^W P0h#d3QQ X3Q P3Q H3Q @3Q 83Q pt80P 0"2QQ 2Q 2Q 2Q 2Q 2Q 2QQ 2Q0 8 '$嵡 04 4S 0`"QQp $2Qm 2Qj 2Qg 2Qd 2Qa 1Q^ 1Q[ 0K4B ,0K@4SI !1QQ% 1Q" 1Q |1Q t1Q l1Q P 0X!QQ' H1Q0# 8 4'8  0 0QQ 0Q 0Q 0Q 0Q 0Q >A/>:4 064@0K:r꜀0 L0P 6@060000:00GhMhbiMibuuRurg<3M8M0M647e"e'e*eh< 7 7 477 7 -LM`G0 t3RR^ h3R[ p,@PpWOYo! 0 T +  2 "   0P2 2  <\W  p !t` 0 P2P"008 $2$"0080 $p0tP @ ;:   20S`1  1 R20SU!0S00Ƈ  20S T1  H1 R20S020ƅ(!0S00Ƈ  20S0 - 0 R) 0B0 T0 G  000S |0  00S 9 ! \00 0B0208M0M3e-ee"e'e*ejn -(@qL` 0 T $0@D , 0P^h 0T   T  0S00 -LM0` ,8pWP @4!S PONU @;2 /A\  0p 8ꢟl< -8 ZLp `4S OnX ` 4S 0 0QQ$ 0Q! 0Q 0Q 0Q 0Q 0! $8 @P8  l^0A  0T0@ $  hMhbiMibuuRurl< -03a`pM@ 0L P m0$0 10 T5 $044 \ -`pfL  P 0m|0$@0 0< T 0\ -L4M@ pVu_D6V c 0,K P- 0,$4 0%Q] c5Q5Q:5Q5P 5 D p , (xx0S 堞40S 嚞嘞P0K  0 PP-PP|,偞 0x,00 0P PPP k0 b$4d  005 0$40060` <D4P 84P04P:(4P 4P l 04\0H ,00808 3ZH0#3L P0Dp4#P D  03jx1ଐ 㜐l%|p ^P|H 0 1cA8 4 0#< 0<0/8000 P 0`< PLV 00P P`@PD LV8  01ca 2 0 <0&.<000 P dD ὝP80U<0/L000 P@  (>0<@ ,@=P0<0@ \!0\ sꍝ1` \080t!t1h l0Lh1P \1P T1T1P0,1` \0(1P 1=<@0CSQ 0D0 D 00Q 0Q:0Q00Q 0=\ 0 80֜l< -0L@p0@ ,8#8@ \0` ,00` \80Z @ dP`%U@ >\ 0 80꒜l< -LM`p0@pAd0A< ,倀=P0<0 \Q 0\ -QSaQ0偀PR@L$AdAp`,0L \0< ,400`< \ -LM@0 `P1clA 0< r,0<0 \@M^(0S P 4$0(@$ -LMx0@  001c148$0 01c1 $ p-LM0 h0 P@` 0 `48Tp 0a   -LM p0p@h`=dP \$0\0dP 0\iP p-LM2@`P 0,  Rd`? $+ 0\e $+ 1\Y $+ <\`M 0$+,0S 7 7$7<7 7 phGp0 ph@@ @AdA @0 T " 0 (  ( 0 ( 0 P(@XH%X$HUT22002ph PiC0CS 7"7"7 7 7 7"7060H1 < `008!pS00W80P \ (0K80pO^W P  0 0@d  :9d x@,K@ĕ\  0 4S 0S00g<';6@"7%7 -L,M, "0 p0t@ 4 p0tD p0tH 08 p0tT @ @`00 00"0!D0 4D0` 8 n,0 < 4 8 ,@4YOpt40@ p@t 0D 0!Q pt80H pt0T <Q,o@0< 0T,DpT10 0(H0 1L0 0H T0 40!2P 8T 40 8 ( & 0S!PL0 bH1< 0h< p0, t00  0200 00   H0<0< 0  < u000r;:;: -80ZLP `@p0 $ 0S 80`ONVp @  ;0S0 0 Tl< -LMP `Z2@]p0t$ Ps  $ 0@ P QNmI|0S 00t!A>000d 00 506 P1P!p<0`0l 4p8p 0(K P $ 0($ @0(P@ (Px X   @183d1 T `@0S HX 8 ipŕ\4 0T\4 0 8 8 `0eR RoR0 R(0R 0Rg<687h<:7en -LMPpp0P tptX p0`t\ p` t 0jx!2#` @, @TόYpt0X p@t0` oL! 0 T00  0 000c1 0P00@x 00000c1c00  00Q  MeHe -LM8XpP `@4 S PONU @`$0850S 8/l< -LMpt0`@ p0P t@8u|0 S10 !00040 1d  6 `0<58Lp@0tP 80pWP \p $0K80O^W Pp0t@ ptP ,@(K@`g<6,=76 -LMP`p0@ tpp0P tp0WT X t0 07 80 0, 40 ,A)^όpt 0@ p@P t 0pWT X 00t,0So%! 0T00"  0S40 00 0 55$$‘0 ,@ 0N,@ X000H000S8 00  04@0  Q0 -LM`()+ |0 S10 !000400d  `0<6 5880pWP  \ 080pO^W PZĕ\  (0K P@,K@ĕ \ 0f`g<6@76 -LMPp0@t@ 0@ 8 p0tH p0tD 4 p0tT , ,p,` 0pWopt 0T p@t40D pt 0H p@t80@ ,\o90,@! 0T00/ - 0 , @ 0, T@0D0^  0080 180 8@0A8@ 00  00 `04@0L4@  P@@4  0,,4  nj, @$3:)3: p-LM 0P , $@0Ƞ,Ƞ\`p . `0^ ph>P0$SL0V \ p(0$S(0 S;:727$9 -L$M 0 pP 0S`\ 8@4P,`K 00 `yP 0 0 `nP 00K P 徑0$ p10  (PLH媑Z 8契 (堑2 02< $ 1!Q 0Q  ? s 8 S 0 S   @ < P 4 pn 0  0  40< zTnM0 @p 0_PR44P@,P:sPx3 ~O `Y[0`c Y,娐;P3<2S 05f0 4 03f$2Se剐ꇐ}{w0 02>0X0u? R0 06#00S00&0,. 0-PL; 0 SD0S6S7S7S7DS7S7S7S7S7S7S7S7S7S7S7S7S7S7 00/00@C00 06Sx0 h0 T T006S  0! 00 00@p< -L\MSC 0S`l d h pt  0SĖ?0` K@0 @ @ 0 PĖ0` d P@`<3( QŖtT\lP h@ Yp #\m ,0p@r`000 2 !PUPt p0`0p0 p(0 \ŖŖ\l"htT00"h0b0`00d t `00Ė(0S-040TĖ(0S Q 2Q!!0\2 S dC> RhX $0 (` $0 (0,0 \0K` @T*1\K h0S0@h0  p4 t r P T K4 0 00 UPT :{4l0$`tĆ474$04$0`44 044704|~88 - 2L@1\`! ,0᳠ X Up p42 0!X \(P"x U0P0 "@`^T \p4̆@0  mr88t~ 0-LP@0h -C> RL  + 0B>>Q P4$0bS4% -LM 2@h2\``" , 2–@\P<"C.,U  2" rR  , 2"䁟QR@  ,T 2!, 2@!,T 2|!,P 2+, "@0+\ 2"R  5\ 2"R  5\ "5 \ "5 \ "0+\ 2 ,\@0 88844(4 404 0- 2LP,,0@% 0 000 ,\0 -LM2 S, `0pZ ATP @ ˯K %P0S5`<5V P JTT`@V*K 0(2S ,0S ,s 2,, 2@0,\g?  V 2,, 2@0,\ 2,,? @  2@0,\88 g\p< 0-@L3P9d H00 R 5@9 0p0hS H e< p-LM 2@ , 0`1 B^P\C. pQ0S 0 2b3c!044#0d [0phK2-0CS 2, "6-\ Q0 C>d [,. 0-@Lkp 0Pp5=50h 0-6N 0PL  ?2..0"0  l0,  P0 /$ P,2 0CS020酊lp< -LM6 p  P^ χ0џOP @PPj2S"@ 0  0CS@@'T`χ50O:^ P@ P`P(+2tS* 0,K P@ ,$ P0, p (P U  0  `d χ0O_P@ P`P $p 00 * 0 30"Plu0q0 KbM1[01K![p<| eq<@q< p-@LM XmST1T!0P5 H1H!0 2T :HH!6@ 24? .( *3,&女![ 0 SPK 1[  [p @Q> 0A @>-: 0p01K![t <@8#X N[/q!y012 s=:CSꔙ747$7$747$7$7$7<7<7$7$7<7<7d7D7\7D7\7L7L7d7d7d7L7T7T7$7$7\7d7$7$7$7$7$7$7$7l7l7l7$7$7$7$7$7$7$7$7$7$7$7$7$7$7$7$7$7$7$7$7$7$7$7$7$7$7$7$7$7$7$7$7t7t7t7t7t7$7$7$7$7$7$7$7$7$7$7$7$7$7$7$7$7777$7$7$7$7$7$7$7$7$7$7$7$7$7$7$7$7$7$7$7$7|77777777777$7$7$7$7$7$7$7$7$7$7777$77$7$7$7$7$7$7$77$77777$7$7$7$777$7$77$7$7$7$7$7$7$7$7$7$7$77$77777$7$7$77770S" S000 0CS7777777770\00`00d00\0h00000 0 00000 0 000 000 -LM@Q01-0R/ 00R0* R( 0AS\7\7h7h7h7h7h7h7h7h7h7h7h7h7h77h77000 , 0 1 000R 0{(` -0LSPf 40S` 0 0\0,0\ 0+\0 @, Aܱ0 , p R R% R R 0BS7777777777777707#u00CS񟗅ꄝ7777T7T7T7T7T7\7\7\7\7t7t7d7t7t7 㜱0 ,0*0 \0 ,}ヱ 0BSC R R, 0 0\0 , R R 0,#, 8#\< F Y0,, <4<,\0", :X"\ HDP I%P  0 ,0*0 \0 , 3 \D 3 1S }& 3 \8-%Pq0*0\0 0\ 0,, ` @ 0,\0,,@ } @`V  1 \(堰 $'0 X N -LM0`Sb PP /@T TK@T2 @T Tp pPU*0T1R,,0\0P ,U@5:@0S TT T 40S T k@PTT 0DS^07077 7070+,0$0+\0t$,0*+(0<$\0A.,0/  0A.\0#,0&0#\0#,(0 S0h#\@T 0S =<<#SSI0 , 8 \9?%0[,, 3[,\"@g0",0( 0CS0D"\@M4厯D@K n Kj2[[`0`S "Q:@. 01K[ KG0 , 0 \@  0,\0 ,M<@;F 0,\0 ,2 08 \0-,0"0-\0 ,0!0 \{_(9(8: -LM0@S 0S S0K @P ![,0R 01K![^ P -LMP#P ( R Q0(0 Q 1S0(0 Q| i 0Scz0pS 00 ,2\0, <\0( 1\ <.\(0`0@\!0Z/\0@!\.0\1S  @<\8!Z/1\0@\<!.0@\< Z/50K Pp  1[02 \Q Q 0K Pp1[: (_  S00 (0X0`!h! -0L0CS@`n0 ,0PS^  P XPP&(0SH 7D7<7D7q0^/0\ 0 \0 ,pܭ0S 0 ,P Pʭ0 ,P1U2U0000PDp@p0Sg`0$ ;\'  -LM0@ ,0S10@ +0 \Z P wP0 SS SS S S S 01 KV1[01K![00a-0 \ P -LM1PS b P@ ;0S 0,, <4<,\ 0S P@`K P@0 S Sg1[ :1K ![P@0S% X0PpS0XS00< S)   P@![ 0  WT W  ^P@;1K![W:*!K1[; P@1[01K![>P@}  P@v1[:1K![ -P@l![0*0Q!K1[: Q1[: 1[:1KP@Rk: 0-LM1@S[ 0S 08"PPK jP1[:1K![P0 , 5 \ LPP1[|01K![P` 9P1[D;1K![P( *P1[ 01K![PPKU P1[01K![U !K![P P1[ `0R1K R1[ 0 1[`01K1[ 0R1K1[01K![xPs Poj40R 0-LM1@S 0PK P;1[;1K![` !KQC꼵7ȴ77ȵ71[ 01K1[ 0R1K1[01K![@Pt0S P1[t p0R1K 1[<1K![,!K![%P0p P0R1[<1K![+!K![P 01[`01[@0 A -LM<@/0<,R/0< 0S<0< P  KcP1[<1K![P0S01P -LM0@SwP Q HPP -LM0P0CS!rP@  K3P@2[?02K"[`P@P@0SN 0SSD SB S: S2 0S) |P@ `pK @T @T 1[08#h VP@P@ FP@P@ }P@ Q>Q.2KP@ 0-8LM 3Q01K@PA. 00, ?0 0A.\< KPU1[1[;;1K![0 -0LM 1K@P0A. 0, ?00A.\8 KVP0 1[;1K![00 -LM K@AP? 0SI  K 8P 1[>1K1[![ 01K1[,@01K1[!K01K1[<1K 1[<1K(0Sꀻ77ػ771[;1K![P  0S ![ P1[;1K![+!K1[;K -L M0@(@ `,P" K[P@2^02[ :2KRR2[2[<<2K0BPPS"[2[*"K2[=Ã@0Ó\\Ń2K 0 \ 0SS S &K P@ 2[:2K"[*"K"[(P@"[!P@㝩0S5 BKP$pK @T }@Tx2[}0E8#X 0SSn P2[|v e@T \^0EP@8V#X 0S S  ULP@2[ 02KR2[2[002K2[02K"[UP@  0P@2[p02K"[P@{ P@t2[;2K"[P@j00CS0S0SkP@ ]P@SU&K P@G2[02K"[@ "K"[qP@H &K P@12[`02K"[^P2[@92K1꠆ 0-0@LTP+?@@@, 9:6+\0 ,0 0-LM0PS00 , K@KPM1[ @@1[9 SL  SL 0 \0 -LM0@ ,(0S47t7770S0 \ 0-LM @0BS0SR 0SP R0S0PK +P %P1[   KP KP![  1[  |0S 0(0K KoP1[S(P; S ; S |0SS 1S 01[; S1[; S0 -LM0pP ,0` ,@0DST1ST| TP 0DS@ 6T 0^/,P' 㴧0-,@0 3@1T0^/,P0 , @ 0^/\ @0 \@00S00 01^/\0 ,0A`0 \P` 7 S&pK 9P` 2P`{2[ A00CSv R0SORK *0S?IP`\1S (K* KsP`R2[S 1S~ 0,,0 0,\@ aT 1Sh 0 1,,0 0,\U*P` 0 \*0 , 0 \0 0\ 0-,@pT0S01 -LM0@S?`p0F00 PU 0S 0S 0SP0S0S P0S "K ]P2[P  SP dR R2[@002[  0 ,?@d0 000 p-LMP-@`K %\ \0 1[ #0D8#Hp p順 -LM 0@6 \0 , h -LM 0@6 \0 , h -LM@8 #80CpP S,U  `K 0 066 0 0  0\0 , 㻥P -LM0`@ ,pK 60' \0 ,vP8#hm0 ,0 0 `w0PUXm -LMh0!XS@`+d0S& Pp 0,0 `K`V V 0( 0\ii\[ 0-h0SL@!Xd0S0hP0@ , 0 \0h\[ -0LSP`= P5 0SS& S$ S p 5@pW0SW((**P@ V("(P@ 0 , p-QLM@`P.0S0(6 \@2㢤0 ,@?Tpp ; 0 p -0(SLP`"= P5 0SS& S$ S p 5@,pW0SW((**P@ V("(P@ 0 , p-(LMQ@"hP*0S0(B6 \@0 ,@ Tpp 9280 p -LM0S@ P! px8`8V04 \֣04 ,0p, -LM@08P `#x ?88PP04 \㞣h0, -LPP@ 0SwSj p P@_0 , 1` \0 ,0 Sd] 0 \0 ,0 S.F0 S S P@ 60S  0S@0,, <4<,\ 0 ,p0 ,0L@0 \0 ,D0@0 \0 ,' -LM@P 0 0CS777777775P  00CS KP1[91K![+P㨢 -LM 0@S` pK0., H0.\ |![p, Xs1[<P 0, 1 \`a p-LM8Q@U p`K N J1[)  C0SP ;0S1[0 `> U0., H0.\pppS` 0-LM @0BSP!0 0p 0R0 0 KP 01[8p0 KP[p 0 BptR(h7777777777777777p 0RPPUPp t0p l0p T00p P0p H0p@0@ Q<0PQ4 PQPQP A0 A A A A0  -LM 0S@  !P0  0P  0 p-L M 0 00@KP!P p1[`K0 lP1[);5 R0   ]P1[*:6B& 0K K6P2[![002SPS0nS0S000 p-LM 0`K 0 @P.P ![0C2 S"0K!K 1[ 0P1[ 0C3 0p P p-LM0`K 0@ PP p1[K 03 0 P1[0 P[@0)C3 R0 0S=3 0 P1[*:6B& 0 P1[0 p-0LM0000 00000@SP#`K P p P1[ 0SS S S Vp pp0 S0SS0 0 -LM0` ,0p0C8@S`7`7`7`7 7 7 7 7 7h7h7h7h7x7x77,7p700@00000 020 0 R 0 S;52K"[ 020@00"0KP2[;C52K"[R0  0000200<@000000000  0 0000 000000 0000 000000000kP00;00v 0\0 0000 000000 00 0P ,00;PP00S`  000P U00.89)9)00b6#1&$ 0] -LM0@00  \0 ,h鞟 -LM0@00  \0 ,h酟 -LM0ȠP ,Ƞ`H0L |4,808@S$ 0- S* $PK$00$0 $  $0\0 ,Qp$0 0$0  \0$0 -LM0@ Ƞ P<,@ T$ `*$pK8#Hh0 ,0`0@$0 qV: -L`P8p@k0 ,0PS S%@T T 0P0 \0P0 \0P0 \0@P0 \0 ,30#P0@P0 \y㨞0 ,30#0@T0#02SP  p-LM0@ ,80PS8`' S p0P0 \0 ,Pm 0 \0 ,ph[0P0 \0 ,I P0 \0 ,7 P0 \0 ,P 0-0LP ,80@S @ S  0@@S 00h\@0\ @0 \0 , @0 \0 ,ԝ@@0\ 0-L@P#:0 08#X0U 0U0 -8`L!H(\P"xW00 dW0S Pf 0SR 0SI S S _X*  !60X:P!0TSQ   !X* 4 <X0: 0mC 0@P 0S H0S0S P -(p"LM WP!`*1@ 0 \JPㆀp` @ 0, V : -LMȠ(,"`uPP%Up:0 @AH@pPPH 0\PPW: , -LM`p`P@U00 < ,0@T:順, -LQ Q  0,7P -LM@PT`, pKT @0 08P#H 1[?T08#h0V 0[@@ 0Kk#P@pK0 1[ @0# 1[[SɌ# 0KI꺺 p-0LMP1K@`K0 m08P#H.1[![>T01K[ 0K a c? #P80S S p0 , : \p麺' -8L!H(\`"Xp&U   dU R R! 8 R P80S  0@T巛 0X@ h h' (-"@TLP!x8`:P6 0WSQ   !T*0 "! 08#Hx,P T:T: -LM8p Ƞ,Ƞ H.P ` B("(V$+*  !0 @0 ,0208#HTT {08#hV:  ("(~  B("(w -LM0S`)K*K+K|S8 S 0S 0 ,% 0140 0 40'0<0 p凁00 P@\+ KO 0 P@) Kjd㺚40) [q@Y* K[4 W0*0[=#=*0K* [^PZp00 00 W:Z 800 S80 Z <* K4*0[<@0*0K* [;0 ' Y3P0)0Kdn40) [% 0#4+ K*0KYd\ 0 04 00 }0!, p0 ,@ p=W:W < S  7 p\W:W0<0 ,@ pW:0,0\꠆< p-LM@K0 `PU\0  [ ȠIP0![00 p p-LMP@`K0 408P#H, [T 1[#4000C S 7777777777@08#H T p0 ,00#0p - @L> pR0 RpPU `3)*0R1+@ 0\0 , 0S;@0 0\0 P,U` 5:1Spp -LMP, P Ppd W11@`2**0P1+@ 0\0 , 0S;@0 0\0@ , T`5:P` `@T*0P1R,,0\0@ ,T5:@ T*,` W0 *p@ T`:;1SJ0 Sd8888\0 1" 0 2" \  \00  12\ 0 3"\ 0 -LM 2R@PP0RqR,,, 0Rh 0RR,,0\0 , 0PE!R,, 0SR,,0\0 , 0S!R,,0 -`0P4L@8UDp:U)U' A0U!+@ 0\0 ,0!S +@ 0\0 ,41S -LM@PP` P 0P0V,,0\0 , 0pA!V,, 0S0V,,0\0 , 0S!V,,0\0 , -PPL`p P @0TP1V,,0\0@ ,T;!( 0r` p-LM0@Sp0,,0K PMQ![C (1RRQ!18 1K`P1^3 @R l8l8l88880!2200@S 888888880!22008#Q0!220!2200 (0![R 0p!F -LM0@0C S8888888888888 P <  P0S S  0,\0,, 000 0-0L S0S@ @ P08#Ƞ>10S (AR 0,\0 -LM0@0C S 8 8 8 8` 8` 8` 8` 8` 8L 8L 8L 8L 8,(P 0S 0,\ 0-0L@ ,0PS:S%S  R 0S R  0 \0 0,' WU0SW 0-0L@ ,0PS:S$S  R 0S R  0 \0 0,& W0SWU -LM0@),0 x(,0 \(,0 @(,0 $(,0 (,0 ',0 ',0 ',0 ',0 |',0 `',0 D',0 (',0  ',0 &,0 S/ 0&,0 &,0 &,0 t&,0 X&,0 <&, 0,&,0 &,0 %,0 %,0 %,0 %,0 x%,0 \%,0 @%,0 $%,0 %,0 $,0 $,0 $,0 $,0 |$,0 `$,0 D$,0 ($,0 S/ 0 $,0 #,0 #,0 #,0 #,0 t#, 0d#,0 <#,0 S0#,0 ",0 ",0 ",0 ",0 ",0 S0h",0 @",0 $",0 S0A,,0 !,0 S 0!,0 !,0 |!,0 `!,0 D!,0 (!,0  !, d@@@@@ @(@0@8@@@H@L@P@T@X@\@`@d@h@l@p@t@x@|@@@@@@@@@@@@@@@@@@@@@@@@@@ @4@<@@@@@@$AAA AAAA A -$QL0T  (Q(P ,\X -$1LS   S\-0\,1 *\=<0 <<L \,1S \ 0<,1 \XG-`0M@O0L 0P 0  @P@ P(P,PP00 ^`@0@00 `P0@ Rf  0P@ 0\K @\A \4 \! h1\ X1\ P1\ 0Ѝ0P@ @0pW P@0`PU` ` P `@0 P J0S(1S 0@0S0 -LM0@0CS88888888888888p8p88800040,00 ,-0 R4 Q 9 S0 S00 ,00000 S0 00Q00 00 ,04 0 004 0 0-0l@ LP0 \0@ ,0 -0l@`L P0p  \0@  0\ -PLM8 PP 0Sp Sr S> SS 4K $p@040C* K08Pd`#H2[Ġ0L8oS  0Q 1P8 T#X 000c8X ER 8004K $`@0* K08P#H2[0A 8}S XV`!TU0f8@!#X Y7#X,! 0AS008  * KP2[0S88888<08 0|<s0s00* KuPn2[=3S񟗡(848@8L8X8202P0Pn0n00>:=:>:<: p-LM 0@SSP) SS S S p K>P1[<C40`K 3P![9 S0 (P1[x    KP1[00 -LM @RR R R00R0SR 0 KP1[ 02  KP1[? -LM4`KP@ # 0S T0S4 X0S h( KP@L VP@4Ґ-MP@* FP@3,?P@廐"[6P@X ( KP@ &P@t墐-P@&Kp @T#2[92K"[)"K"[08P@#X3,P@v"[P@00*K, KP@2[S{6K8 K5P@u0S/ X\n3[1Sk&K  p=P@`bC  208P@#&0[pWWd`X:K0X0i P@B 3[1S&Kp @T2[92K"[08P@#X00>:[/ N5 -LM@Q 0S0K HP1[L'S  R  dP ^P p-LM @0BRS`Pp0 S S S  KPVI0 S S; S/ 1[01K![0P0S S p KP1[01K![P p KP1[01K![ P p0P0.\1[01K![P p<S/S S0 S S$ S 1[01K![P KNP1[01K![P0P0.\1[01K![P p0.,Pq K"Pl p p-LM0@ S`PpSi  KPV<0S/ 1[01K![P0S S p KP1[01K![vP p KP1[01K![fP p0P0.\0S 1[01K![OP KP1[01K![@P0P0.\0.,P 0-LM0 S@!K S 0 KP 0 PPK ~P1[<1K![P P iP1[;1K![P![ p-LM`P@0!, ,0@T:p 0-0LP,,@ 0,,0 50@ T T 0 0 -(LM8" , 0 #Pp 1 R Z,`K)C 0b8#Z4 *@ 0  8#H T 0 0 !,0"+\08#Z:40S @4 T04'070 8#H T 0 0 !"+,0\0  @0 !8 "+,Z,  0  8#H T 0 080"+,0\0j0c 8(#" p-LMP0`0@0D 8#H T0a0@ 1!"+\0 ,08#HT:p -LM0@,, 0,\ -LM0@D ,0 S P RT[ p-L MH @0$H 0K KP!K!K`AK\ 0 pK\ K~\PP *0 0R:0` -L@0SP``0SP <0pR` `W0 IAMT p-LM\0PSp0 ,8S@ p`V P0P ,0@0 @,T p XT[0[ -LM PP@ !P@ P@`pK z@T Ss@THN1[0S w0F8#h q P@h P@_,P@V P@ P@`  5@T .@T4 1[30F8#h@BP -LM40 S@ 0, 0 \ -LM40 S@ 0, 0 \ 0-40LSP2N 00 ,0d ݋@T 0T 0-0L0CSP @0 ,0 @T0T 0S 0崋屋a p-LM0@SdPg:SS |型p0 ,gg0D ,0PUpU' 0-`0LS@00S( 3P 0 ,0 0l \0\ , 2RPU 0U 0!P P[ -LM`0X S@0,0S  0 \P[ 0-0#SLP@ 0T00< ,0 @TTP[ -LM0H S@ 0, 0 \P[ -LQh 0 Q\ 7 0,00,@ T[ X -0LS:S< S 0,T[ 0-40LS@P1 S 0U[,?0Q[,\0 , 8 \0, ?00[,\40 0-0LS@dP 00,,0 0,\0,, JPU0U -LM0,S@ 0, 0,\ -LM 0@S K0 0S1[<1K![0 -LM 0@S K0 0S1[<1K![w0 -L M`K @ȠH 00 <4, 0 ႐kP@" PP*Q0* K 0pS0  P@0[008#X U:r -(L!x"h@9PP0S P*P0 S 0P0 :LP -LM0P (@ p`0 8@#8 X  0 (@ 0` ]}VW  08#8 Xp 08#8 Xp -LM0` p( 008#8 PX0 (0@PU:0S -pBS00W0LMSP@`Q$ 5430:hP@ -0( @ 0 0 X0  0\}P@  0(0` S0 ,X00 X -BLM8Z`P#x@4bWQ$ 5430:㖈P@ 80(0 @ 00 X0  0\V0 0\}'P@ 0(0 S -L0KM@c 6P0[0 -LM@ p`d8 P%K %0[ S , Pd%cUdU 0 m0 8#8 f -L M0, P (0<@00  S: S 800 p W3`cP@ ,0( 008#8 X,0 c#@$4 0\tP@ 0S00p` W@0( X@B 0-LM 0PKS@  00S1[<#1K![0S ~0S1[:1K![ -PLMU`!p&**K@ 0@PH$HU,0K PUPU ["[%P 08#x W: p-LM 0`S p0( ,@) P0 ,PLd(1UT 0 ,0L0 \0,,@ p0d ,X%X@ 0,,$@! qP(!: -L M`4p0!P,10d> Ά+ 0P h>0 KN @Pc0S$K% 0 Rh>$$dhΖ 0@$ ` (0SXl>PMTDM@MMd> e eu<vh.l, -L)LPv< -L#Lv<R0S 0 Qq -LM`P8@0NM[R@ 1 \0!0@4<T 14 `PD 0< 4 _p   \  W  < ` @ 000` u80\ L0 40Q (ir'; e e1d: - 0L0P岀 p1"b!X`,o0P@g 00 000 0 0 ` 0<0$ t1 p!,00  20X0S 0P7  00CS10Z8Z8Z8Z8Z8Z8Z8Y8Z8Y8Z8Z8Z8Z8Z80Z80Z8Z8Z8Z8Z8Z8Z8Z80Z8Z80Z80<0  048 0\0 l0X0@@@a0<00,0[8[8D\8pp8<0S8<0q0@-0@Pl UM,Ѝ0@Ѝ0- 4.0,04   0S 00 0 000@00 0S,0 -LMp0P@`& 0K  KK`K}@T0 T0q`8 p-LMP4`@T P0< ph0<0 2$00$0 R 0-PJ@L10  000>0 80 -L M@` p4PK 0g1`V00 0TT0S 4 00rcp`S㫁ꩁ00"c1a  >: -L M1@Ϡ PNlpa4PKV8\0p  h!8 n /T40s 4!,!?L3cS 08T0S$ ,0S0\ ]1W< <10<0  ?B3cS!3$0J0$008 b$10 {<H1*U U080S:T gMb 0-LM0@(()0K[ S 0K )q(^ PU 00++ 0KK]$0 0(()KP[\0K  )PD( 0- @L aP,00 0dS0@00@00 0 T0 0a8 -0P2c1RL@,p ` (HJD 0,0T (0 0S0T00T0v 0!0 0T  00 #(0 0 00   |0000@00 `d 00 (00000d(0Qc(00@0I\0SdX D(0XS 000<|$2Sy<\;Tq8$y<`80y<@yZJJJJJJJJJJJJJJJJJJ }J xJ sJ nJ iJ dJ _J ZJ UJ PJKJFJAJ=Q:Q:Q:Q:Q:Q:Q}:Qx:Qs:Qn:Qi:Qd:Q_:QZ:QU:QP:QK:QF: QA: Q<: Q7: Q2: Q-: Q(: Q#: Q: Q: Q:Q:Q :Q:QA ? QA ? QA > QA > QA = QA = QA < QA < QA ; QA ; QA : QA : QA 9 QA 9 QA 8 QA 8 QA 7 QA 7 QA 6 QA 6 QA 5 QA 5 QA 4 QA 4 QA 3 QA 3 QA 2 QA 2 QA 1 QA 1 QA 0 QA 0 \aBC`B0QA 0  0-LBP|@ 0S L| 0SPeT 0S \00LS `00000S  0SbQ1QR0@-P@ 0bàR? B0QQ000-P@P@0Q0-P@P%@ 0Q1Q3:P: R0P0QcP  R0-P@P@0! !Q@-: R (2 R R -PPPP RrPP B PP R  R00 B R000Ѥ000l\000Ѥ000 R \6 R B0-.40P<$DL%T \,Ġ̌8 R0 .Ġ̌ RA R B0-.80P8$HH%X X,ȠȌ8 R0 .ȠȌ RA R B0-.<0P4$LD%\ T,̠Č8 R0 .̠Č RA R'0 R- RP1P P1P RrP1P  B P1P B  R010 1  B R0q0`0q0`0q0`\0q0`0q0`0q0` R 0\6 R B0-81, Ġ%̌T$\D#L0P  R0 Ġ01#̌  R R B0-81, Ƞ%ȌX$XH#H0P  R0 Ƞ01#Ȍ  R R B0-81, ̠%Č\$TL#D0P  R0 ̠01#Č  R@-@08#8S  0   @:` `! R0-P@ 0bR03 B00X!e``0 B`3`1`1c11c!0"b2c3c0acP@X!e_ NR- R 0S0 \R000Sa@\0S S0S0S  S 0S R  0R P0Qc\R0@-P@0 A@P `R00\00Sa@ 0zR @R00Q00S ZR 0 PP ^0b0Q%2K} }}}%}2> > >>> > > >>4x5x7r x@t xxxx4x5xxxxx6x 7xT8 t4j 5l@`@`7j @`6j@`4z`884t5r@`X@`PP``XXP``@4zhh5~~4|X4zhh5~~X4|r\jr]jr^jr_j\rj]rj^rj_rj|`@`H@`@@@`HHxx5r6r           xxxx(C|z8R:LR:`R:R:R:R:R:R:R:S: $S: DS: \S: \S: \S:\S:pS:pS:pS:S:S:S:S:S:S:S:S:S:S:S:S:pS:pS: pS:!S:"S:#S:$S:%S:&S:'S:0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z- $0H`l    $0H`l!?$,dbEaL 8pP-%!T1;? 8#2!U#4@\ 0HP#+ "#P'()`5689:=`>K #(-2>'()*+,-./@ABCF'()*+,-./@ABCF'()*+,-./@ABCF/@ABCDEFGHIJKNMNO`abcdefghik&''(())**++,,-*++,,--../-@@AMNO`abcd e f g h ik$%b(&b,'b0(b4)b8*b<+b@,bd"h"l"p"t"x"|""" " ")$+$-$/$ $0H`l    $0H`l@02D0H0L0\0;51.`0,***|00 0 l(000400000#0  00 `4H< 4s"$4D#(444!0 8  "%')`56<=>KVXZcfk3 3 3 3 3 3 3 3  3  3  3  3  3 3 $3 f`(3 h`,3 i`03 j`43 k`83 l`<3 n`@3 o`d3 h3 l3 p3 t3 x3 |3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3  3  3  3  3  3 3 $5 `(4 `,4 `04 `44 `84 `<4 `@4 `d5 &h5 (l5 *p5 ,t5 .x4 |4 4 4 4 4 4 4 5 B5 D5 F 88888 9 7 6 97 5 9 423 9 2 9 1 0 9 9 \/|\/O|/-| "&*.26:>ACEGIKMOQSUWY[]_abcdefghijklmnoppqDqrDrsDstDtuDuvDvwDwxDxxy$ydyyz$zdzz{${d{{|$|d||||}}4}T}t}}}}~~4~T~t~~~~~~~~ ,<L\l|||||||||||||||||||||||||||||||||<<<<<<<<\܆\܅\܄\܃lL, ̂lL, ́tdTD4$ԀĀxph`XPH@80(   !"#$%&'()*+,-./02468:<>AEIMS[gjkhinolmbc`afgdeu@ut@tw@wv@vq@qp@ps@sr@r*."&:>26 UWQS]_Y[EGACMOIK~~~~~~~~~(~8~~~h~x~H~X(8hxHXzzz z`{{{ {`xxx x`yyy y`}P}p}}0}}}}|P|p||0||||@@@@@@@@XHxh8(؁ȁ聘XHxh8(؀Ȁ耘` ` ` ` Ђ0pPЃ0pP****++++(((())))....////,,,,----""""#### !!!!&&&&''''$$$$%%%%::;;8899>>??<<==2233001166774455   jnbfzrJZ镗 n;AvXaM ְdx x#L#T##<#D##P###h#D%#Copyright (c) 1982, 1986, 1989, 1991, 1993 The Regents of the University of California. All rights reserved. Copyright (c) 1995-2006 OpenBSD. All rights reserved. http://www.OpenBSD.org  $:7;:h::::@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@netconnetclsnetionetlck!#$%&'()-0123456789@ABCDEFGHIJKLMNOPQRSTUVWXYZ^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{}~Ͼ󨷵ǎԐѥ噞᷵ǎԐѥ???????????????????????????????? !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~?Ѫ?????????????????????????????յݯ????  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~U(H$(P$($(D%D%(&(D%T'('(`'D%'(d n;0&AvQkkXaM+ B+0C+lD+ccƄ||ww{{ kkֱooTőP00`gg}++Vb׵櫫MvvEʏ@ɉ}}YYGG 쭭AgԳ_꯯E#Srr[·uᮓ=j&&LZ66lA??~Õ\44hQ4qqsثS11b?* RǕe##F^Ý(07 / 6$=&i''NͲuu t,,X.4-6nnZZ[RRM;;vaַγ}{))R>q//^SShѹ,` @ȱy[[jjFˍپgK99rJJLLXXJυkл*媪OCCMMU33fEEPPD<KKܽa ppB>>|ĵqffHHaa_55jWWйiX':'8볘+3"iip٩3-"< I·UUx((PzߥY  ڿe1BBhhAA)w--Z˰{TTֻm:,ccƥ||ww{{ kkֽooޱőT00`PggΩ++V}׵bMvvʏEɉ@}}YYGG AԳg_Eꜜ#Srr[u=&&Lj66lZ??~ÃO44h\Q4qqثs11bS*? ǕR##FeÝ^0(7 / $6=&''Niuu ,,Xt4.6-nnܲZZ[RR;;vMַa}))R{>//^qSSѹh, @`y[[jjԾˍFg99rKJJLLXXυJлk*OCCMM33fUEEPP<!KKݽa܋ pp>>|Bqff̪HHaa£55j_WWiІX:''8+"3iiһ٩p3-<" ·IUU((PxߥzY e1BBhhиAAÙ)--Zw{TTm,:cƥc||ww{{ kֽkoޱoőT0`P0gΩg+V}+׵b׫MvvʏEʂɉ@}}YYGG AԳgԢ_Eꯜ#Srr[u·=&Lj&6lZ6?~A?̃O4h\4Q4qqثs1bS1*? ǕR#Fe#Ý^0(7 / $6=&'Ni'Ͳuu  ,Xt,4.6-nܲnZZ[RR;vM;ַaֳ}γ)R{)>/^q/SSѹh, @` yȱ[[jԾjˍF˾gپ9rK9JJLLXXυJлk*OCCMM3fU3EEPP!KKaܽ pp>|B>qĵf̪fHHa£a5j_5WWiйX:''8+"3iһi٩pَ3-<" ·IUU(Px(ߥzߌY  eڿ1BBhиhAA)-Zw-{˰TTmֻ,:ƥcc||ww{{ ֽkkޱooT`P00ΩggV}++bM櫫vvE@}}YYGG A쭭g_E꯯#Srr[u·=Lj&&lZ66~A??Oh\44Q4qqsbS11*? RFe##^0(7 / $6=&Ni''Ͳuu Xt,,4.6-ܲnnZZ[RRvM;;a}γR{))>^q//SSh,@` yȱ[[ԾjjFgپrK99JJLLXXJϻk*O媪CCMMfU33EEPPxD<<%K㨨QQ]@@?!pH88c߼wuBc!! 0mҁL &5/__5DD.9WU~~zG==Ȭdd]]2+ss``OODf""T~**; FF)kӸ(<y޼^^ v;dV22tN:: II Hl$$\\]½nCשּׁĦbb917yy2CnY77ڷmmd՜NNI੩شllVV%ʯeezzG鮮oպxxJo%%\r..8$WsǴQ#|tt>!KKaܽ pp|B>>qĵ̪ffHH£aaj_55WWiйX:''8+"3һiip3-<" IΪUUPx((zY  eڿ1BBиhhAA)Zw--{˰TTmֻ,:cccc||||wwww{{{{kkkkoooo0000gggg++++׫vvvvʂ}}}}YYYYGGGG𭭭Ԣrrrr&&&&6666????4444qqqq1111####''''uuuu ,,,,nnnnZZZZRRRR;;;;ֳ))))////SSSS [[[[jjjj˾9999JJJJLLLLXXXX着CCCCMMMM3333EEEEPPPP<<<>>>ffffHHHHaaaa5555WWWWiiiiَUUUU((((ߌ BBBBhhhhAAAA----TTTTPQSeA~ä^':k;EXKU0 mvv̈%LO*ŀD5&bIZg%E]u/LFk_zmYR-!tX)iIDɎjuxyk>Xq'Of ɴ:}Jc1`3QESbwdk+XhHpElޔ{R#sKrW*Uf(µ/{ņ7(0#j\+ϊyiNeվb4ъĝS.4U2u9 `@q^Qn!>=ݖ>FMT]qoP`$C@wgB谈8[yG |B| H+2pNrZlV8ծ='9-6d !\hT[:.6$g WҖO aiKwZ *C"< Nj򹨶-ȩWLuݙ`&r\;fD4~[v)C#hc1cB@" Ƅ}$J=2m)K/0R wl+pH"dGČ?,}V3"NI8ʌ6 Ԙρ(z&ڤ?:, xP_jbF~Tؐ^9.Â]|i-o%;ȧ}nc{; x&Yn쨚Oen~ϼ!ٛ6oJ |)11#?*0f57NtʂАا3JAP/MvMCTMўjL,QeF^]5st.A ZgRے3VGmaךz 7Y<'5ah,4$8_@r %⼋I<(A q9޳ ؐVda{p2t\lHBWЧQPeA~S^':k;EXK0 Umvv̈L%O*D5&bZI%gE]u/LFk_眒zmYRڃ-!tXiI)ɎDujyx>Xkq'Oᾶ f:}Jc13Q`SbEwdk+hHpXElޔ{Rs#KrWUf*(µ/{ņ7ӥ(0#j\ϊ+yiNe;b4ĊS.4U2u 9`@q^nQ!>ݖ=>ݮMFT]qoP`$֗C@̞gwB谽[8y |GB| +2HprZlN8Vծ=9-6' d\h!T[.6$:g WґO aKwZi *"4$8,@_r% I<( A9q ؜Vd{a2p\lHtWBQPA~Seä':^;kEXK0 Uvm̈v%LO*5&DbIZ%gE]/uLFk_mzRY-tX!I)iɎDujxyXk>'qᾶO f}:cJ1Q`3SbEdwk+HpXhEޔl{Rs#KrWUf*(/ņ{7ӥ(0#j\ϊ+yiNeվ4bĊ.4SU2u 9`@q^nQ!>ݖ=>ݮMFTq]oP`$֗@Cgw谽B8[y|G B| +2HpZlNrV8=-6'9 d\h![T6$:. gWҖOa wZiK *"$8,4_@r %<(I A9q ޳؜Vd{a2plHt\BWQP~SeAä:^';kEXK U0mvv%LO*&D5bIZ%gE]u/LFk_zmYR-X!tI)iDujxyk>X'qOf }:cJ1`3QbESwdk+pXhHElR{#srKWf*U(/µ{ӥ70(#j\+ϧyNieվb4Ċ4S.U2ኤu 9@`^qQn>!=ݮ>MF摵Tq]o`P$֗齉C@gwٰB8[yȡG ||B 2H+plNrZV8=ծ6'9- dh!\T[$:.6 g WҖOa ZiKw *h8,4$_@r %(I>>>KKKKyyyy xxxxZZZZݨ33331111YYYY''''____````QQQQJJJJ ----zzzzɜ;;;;MMMM****뻻<<<m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxqg jgrn<:ORQhك["(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDl؞]|6*)bp0ZY9Y/1 g&3gXhJd . ۤOHGɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~[ 1Ѭߘr/Ḗ~&jE|,G$l iciNWqX~=t XrX͋qJT{YZ90`*#`(yA8۸y:`l>w'K1/x`\`U%U攫UbHW@cj9U*4\̴ATr|*oc]ũ+1t>\3֯\$lS2zw(H;Kkē!(f a!`|H2]]]u#&܈e>#Ŭom9BD . Ji^Bh!la gӫҠQjh/T(3Ql n;zP;*~ev9>YfCoEå}^;uos D@jVbNw?6r=B$7H ۛIrS{y%P;LylO`@ž\^c$johSl>9oR;Qm,0DE ^J3(fK.WtE9_ ӹyU 2`yr,@%g̣饎"2u<kaP/R=2`#H{1S>W\o.ViB~(2gsUO'[iXʻ]=!lJ[-ySeEIҐK3~ˤAb Lw6~д+MەqՓkю%ǯ/[{AI~-%^q h"W6d$ cUYCxSZ٢[} Źv&ϕbhAJsN-GJ{RQ)S?Wƛv`+t恵oWk *!ec.4dV]-SGjnpzKD). u#&İn}ߧI`fqilRdVឱ¥6)L u@Y>:䚘T?eB[k?ҡ08-M]% L&pc^?kh >\D}W7: P tAu8/;21>8TNmO Bo ,y|$ryVw.?rU$qk.P̈́GXzt}K:zfC cdG27;C$CMQe*P:qUN1w_V5kǣ;< $Y,n<pEㆱo ^*>Zw=Ne)։>%fRxL.jxS<- N=+6&9`y#RnfE{7(2åZl!Xeh;/ۭ}*/n[(!pa)uGa0a4c\s9pL ު˼,b`\ndi#PZe2Zh@*<1! T_~}=b7w-_h)5ǡޖXxWcr"ÃF T0.SHُ(1mX4a(s<|J]d]B> EꫪOlOBBǵj;Oe!AyMjGKPb=bF&[$ti GV[ Htb#*BXU >ap?#r3A~_;"lY7|`t˧@n2w΄PU5ai Z .zD4Egɞs͈Uy_g@Cge48>q(= m!>J=+hZ=@&L4)i Av.khq$j 3ԷCaP.9FE$tO!@MpE/f m1'A9UG%ښ ʫ%xP()Sچ, mbhiHפh'?Oz|Ϊ_7әxB*k@5 ٫9N;VmK1f&tn:2C[Ah xN جV@E'H::SU kKмgUXc)3VJ*%1?~^|1)p/'\,(H"m?H܆AyG@n]Q_2Տd5A4x{%`*`lc´2Of#k>3b $;" r(-Exb}doITH}'>AcG t.no:7`L knU{7,gm;e' )̒9 i{f} ϑ^و/$[Qy{;v.97yY̗&-1.Bh;+jLu.x7BjQ满PcKkؽ%=YBD n *Ngd_ڈ鿾dW{x`M``FѰ8Ew63kBqA_^;Z4ٷ,Q+:Ֆ}}>(-}|%rZLZq)GW;()f(.y_xU`uD^mm%adâW<'*:m?!cf&(3uU4V<wQ( gQ̫_QM08bX7 z{>d!Q2Ow~㶨F=)iSHd$m-if! FEdlX [@X̻k~jEY:D 5>ʹrdfGof,ҏ"W##v215VbuZ6ns҈bIPLVq z2E{Sb%ҽ5iq"|˶+v>S@`8G% 8vFšw``u N˅؍芰z~L\HjiԐ\-% ?2aN[wߏWr:j?$.Dsp"8 1).lN!(Ew8fTl 4)P|ɵՄ? Gy@0 /kz%?/?!M@`Iɟ'Կ@uИcnafŽ"o;h(Yy#P_w@CV/|-ҢɡHl4ma/T"2*kT:V"AӢ@f/9/Mҹ-?JDvR7,YQoz Zh{.T"5Y/mKdPIf-徐"3;䎴]4K@E?1.eUʱծ-mԢP @"8On ׿r[O/LVSTIiFXEŅc]ՊSW9j7=T*_}x:vbj Bz)^'rgP8ƌDŽZ*'JkѢ*V`C u\B&Ʉq-ls5&5 M{n0f&%HVV^c ϲc|E pPr(pH# yM;-AB G&LjMG\^ |Y#јr8S#/nqFnEV 9q +A|iCHy}B{BIZݿe\ [ ~iC?9zaz UQry吝5rNcZպ60ę _}֡{/6Y DYD̃Aѱ* ;{ B[A%zzӤ0XޘN?wiy{$[Ĭ%5P_aT1bcKU !h]Yfsc=4·~!+g\ab906;Wd/`:5F- 'zy㠌l0^7%oo;j tE'4:NiOM>dY58EfCr3c%N? (Υ'R¦սTUdpfM w&ۄgC!`X0TroSUGڿ]bVhkʃ;n-Ӧ\= wL3{9+^S_aodC x^c"&gI{ڷ"%-U^7rRyL H[k0 cq/޹ S E!5(T<)c)A|-nRPf4,0P1`sY&D\dwR3A+ٺ|o!PaH?ek«dv&4{^% ;MM1$~I,;jx`]sVz\/1Co0TyXR^/2zj0>՚1B°I #ڸ(0q_`ɣaM/Ǚ."płNؼ40y;'ƸaiH?;(ZC/v7ܱӧßn>ƼB7Q(heRwj-K'5.n\ )^XOX{iT̨g&H`K`8# ~8lI `s5GƱVL>#8d^BFzk Od^AE#\;]>rC|m~ll9`qpsv#E@]%=`GK6DήPQH<p}}d^(O= &g.yr?U+HԼ?^!@WNFRWs3NɷdŸW1O g_?@k{C=K۵cUȗn-J(JqoCCl< _P/~׿PZG.Q>pX.0_|r *,]I鎸P'WIoyR}}Yr@EEt]>uOiVA#. '`vteyvvwHNma}/ 4H<0(Ow Vܒ M"7)}V'|@|硴f^aÝ <є`AFv\;x,WGl"}NC~8<=Q8d{h'فI]j~vh]9K9 ;#Im<Eub'z\aBΒ~Brrp }ȡ[(Ob<51)BSjO[}m(Ki\j#MŌ?,-ҖXRg[HJI \EkӉ7`:SRqDIK @sg4|~q6UO/Т`?mPьGnU?墼38Wg} =3{r3O̫]ňv{{uWBdBc+ri/n+_mazgaq%9̸L!gуb>ܷν8\ =Dmn`I:T`H'W+8$ ږ%Eh;}E `P/(b4 ٠m+1+dZ0RXBA\1>26F3S75 {s{OJWdCQz(~c5_ yCdcdJ$_(͸O@C " 0 O7-{$MgQLq_-_d !S^>'_aB%rqK=;&o~~TLmDl߫I&Ǡ36~?Pa w8Pr.PwWFgOT3ɏ1 i5M\=fȦ[]oڑo/"F}F9mOCCN!и  ?X(>nH&p׋wt|% - y#;(8itb߷@!{7Ȋ@ YVvO@/{U MVi35'#WȯVeka^u˅nwU2?-ɿ[%;з$;mc fÀ(82 Tɪס2Zb,gTzuw11&o6F HjyZVLj~CRv/ t,t* M|k .TA5B=!&|,aRe1i%& !\1cr ^Iy p1 d>>̶Ոî 0rlqn/kءDVÈ9/ű1(x⤣2}o~X$Ū{s0a!-!)۳*)e\,0?Б\,ԩT _w:^VxV޾\!uQųåҶw#)Ei/z毲p[v F98/gsD)k)/Ifingӛ/~p%Q^$Slj>!DYܷ)eyCy9A+MWN )zkS< ~U3rŅ?~  ~tn,fy3jXDD1Zs"*ˁc8:$zi HIĀ@8HުL H_%A@N$A UeQr% 9jyMc@hV 틕Z Vqק)N-fcqw*7 5Wa"ɠBր[t!h!hl iwW~@PճMװx QV$AV ʔUWnྵa$ XK'aU{whkldMDfd~i/IO70j5,s@IvM;B(HDLns) _ɋ}oaOw.+rץ<}+FYYEEهTNoHm| ǥcs_DVj͈prͳ]ny` E`1©\1BN"r\,rN@%/N2g@#x\n܃"ukMxnXO DH?{vw#Vu*F_( +8=6 JRft;QZylu eX&hJpFS(l\v0k)h76*g$ k%ֿh,DUueI40" WIbuU~bڨv^FESGml,gHL|3ەCh\SU2` ߝWc9^28aI37~^b<#NygCHKJf-ۄoH Ja)Yfc(` 0qt&@3/C~A^ l( ؒ0~of˜os*`ژ46K-%#= %IH6Jo8C@TzWOpA:Z„TU|5YŗZ:G:%Sj~=eI&TwQ[P]vlDȨ!帊iX`[ŗY)L;]J5ULkD$5鰽bעT/I18T(q)9H[/u@g+3-fVo*ɛ`( ')dMP˲,\26K_A !PNhذy\CPIMAC8wn\e0Rԋ@+>`xT7}02m-yyS"wuXȃoxkcZ\3]ùzv٣Byqj3ƚ`'PC=+mvN%ύHf6AN( aϩI=߹_d: }+p?PO+Zbbyj.H@,Z@"ғ-ES4n)olIIBr~V>olbfLTq*+9)XLVRf.S9v.i硦>iFt+LVvuOx39]O#2]2=&K/~~<O^?vf)o=E4ӷ+4grN=U"g`k8=ü0}8QcÐӝXyTGָaYwSW-XVcNx.F~eyUڑ0@5㶼P?!@=LXI6QpӱڍyKoqK 0ݻ맕d5w$,ϩ/ tцB*v:-7ޚ, )p@ :$7ѴyN] h1 HZ޻Bf1畏?r 3uQB}\cmd!@ WS1zݨ]3CoFq"8ԚέiGb[UgfN G[oLĎnrWxzdD]Ջ` l_9 ]c2֋~ pIPӻߘ)* mS~H~X.t;/RG'~[!<8zvOB9`55'{ɸ6g {pqT3^-ZId, =4pBwbO&Ҹ$d%FN`7>͕xE_{ ۫v"{.1ן%$r_m L=mPO%os#(ĴyI%4aĘnzn|l6AT޾'VAJJ{` ,8I%vK$%Gv XY f 0NndQ& #Phꃢ H!x-ML.RN8D( `hz=Skc|j9{Б/Uڅ?AZX_f ؐ53eiEVmv° GJBnI[#Q")yq~ ruo7ӎbwO$26󦻬^lW%㽨:Y*F                              A@@@A@@A@@@@A@@@A@@@@@@AAA@@@@@@@@@@@@@A@@A@@A@@@A@A@@A@@A@@A@@@@A@A@@A@AA@AA@@AA@@@AAA@A@A@A@A@                              @@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@                                  ##%%&&))**,,//1122447788;;==>>@@CCEEFFIIJJLLOOQQRRTTWWXX[[]]^^aabbddgghhkkmmnnppssuuvvyyzz||        0 0 0  0 0  0 0  0           0  0 0 0 0  0  0  0          $$  $ $ $$  $ $             $$  $ $ $$  $ $                  0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0                            ((  ((  ((  ((  ((  ((  ((  ((          """"   " " " " ((((((((    """" ( ( ( ("("("("(?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@$,<-,<-<--H--0-l- -< -=- -<--<-<--------=-vmmapbsyBUSYWANTEDTABLEDCLEANCLEANCHKRELEASEDFAKERDONLY ZERO PAGER1FREEINACTIVEACTIVELAUNDRYANONAOBJ00%$;:(;:4;:8;: ^<^< <;^<@;D; L;P;X;`;h;`;p;`;x;`;p ;;p 0;;p `;;p p;;P ;;P ;;P @;;P P;; ;;;;;;;;;`c<;`c<;`c<;`c<;`c<;`c<  ,3;;,3;;;;@;;;;  ;;  ;;/;pP;o; ;0/8;pP;p $;o: ,;,; 4;,; @8;,; `<;,; :,; @;,; D;,; H;,; L;P; 0T;P; @X;P; `\;P; `;,; d;h; l;,; p;h;t;x;;x; ;x;0;x;@;x;P;x;`;x;p;x;;x;;x;;x;;x;;x;;x;;;;; `<;0;;@;;P@u:;`;;p;;;;;;;;;;;;;;;; ;; ;;;;;; ;;0 ;;@$;;P(;;,;0;8;0;<;0;D;0;L;T;X;T;\;T;d;T;h;p;t;p;x;; ;;;; ;;eqnecsccmiplvsvchilsgeltgtlenvdaiadbibedeafdfalsllsrasrrorpmzsdep0.01.02.03.04.05.00.510.000@%;;;;;;;;;;; ;(;0;8;@;;H;P;X;`;;;;;;; ;(;0;8;@;;h;p;;;;;;x;;;(;0;8;@;;;;;;;;;;;; ;(;0;8;@;;;;;(;<;T;h;;;; ;(;0;8;@;;|;;;;;;;;;; ;(;0;8;@;;;;;;;;;;;; ;(;0;8;@;;;;;;;;;;;; ;(;0;8;@;;|;;;;;;;;;; ;(;0;8;@;;;;;;;;;;;; ;(;0;8;@;;|;;;;;;;;;; ;(;0;8;@;;;;;;;;;;;; ;(;0;8;@;VAP;,h9PVAd;,h9VAp;,h9VA;,h9VA;,h9 VA;,h9pA;,h9qA;,h9qA;,h9qA;,h9qA;,h9qA;,h9rA;,h9tA;,h9tA(;,h9A@;,h9AH;,h9 AP;,h9AX;,h9`A `;,h9`A l;,h9`A l;,h9PTx;,h9A ;,h9 A ;,h9D ;lh9D ;h9i ;h9 i ;,i9 i ;li9 $i ;i90$i ;i9 ,i ;i90,i ;i9 .i ;i90.i ;i9!i ;,j9 !i ;,j9)i ;,j9 )i ;,j9-i ;,j9Ai ;j9 -i ;,j9Ai ;j9Ai ,;j9Ai <;j9e:P;L;X;`;p;l;|;x;;;;;;;;;;;;;;;;;;; ;0;@;P;`;p;;;;;;;"1;0$1;"1;0$1;$1;8;$1P;p;$1;;$1;;$1;;$10;P;@````` ```$-;D-;X-;|-;-;-;-;-; .;(.;T.;.;D1;.;.;.;.;/;8/;X/;p/;/;/;/;/;0;00;h0;0;0;0;,1;\1; 1; 1; 1; 82;x2;2;2;3;03;X3;|3;3;3;3; 4; ,4; D4; X4; p4; 4; 4; 4; 4; 4; 4; (5; P5; x5; 5; 5; 5; 6; 6; @6; d6; 6; 6; 6; 7; ,7; P7; t7; 7;7;7;7; 8; 8;88;P8;l8;8;8;8;8;9; 9; 09; D9; t9; 9;9;9;:;,:;L:;h:;:;:;:;:;;;0;;H;;`;;;;;;;;;;<;@<;`<;<;<;<;<;,=;H=;t=;=;=;=;,>;`>; >;>;>;$?;L?;h?;?;?;?;?;@;,@;H@;l@;@;@;@;@;@;A;(A;@A; `A; A; A; A; A; $B; 0B; `B; B; B; B; C;!$C;!HC;!`C;"|C;$C;$C;$$B;$$B;$C;$C;$D;$,D;%LD;&hD;&D;&D;&D;&D;&E;& E;&dR;>R;>R;>R;>R;? S;?8S;?PS;?pS;?S;?S;?S;?S;?T;? $T;? 4T;? TT;? hT;? T;?T;?T;?T;?T;@U;A$U;BLU;C W;DU;EU;FU;GU;GU;GV;G0V;GXV;GV;GV;HV;IW;JW;K0W;KDW;KpW;KW;KW;KW;KW;LW;NW;PX;P0X;PLX;QpX;QX;RX;SX;SX;SX;TY;U8Y;UPY;UdY;UY;UY;UY;UY;W Z;X0Z;YLZ;Z`Z;ZZ;ZZ;ZZ;[Z;[Z;[[;[,[;\H[;\\[;\t[;][;][;][;]\;]L\;]\;]\;]\;]$];]X];]];]];]];]$^;]X^;]^;]^;] ^;]!0_;]"h_;]#_;]$_;]%`;]&D`;]'|`;](`;])`;]*a;]+La;],a;]0a;]1a;]24b;]3lb;]4b;]5b;]6c;]7Pc;]8c;]9c;]:c;];(d;]<\d;]@d;]Ad;]Be;]C8e;]Dle;]Ee;]Fe;]Gf;]H0f;]I\f;]Jf;]Kf;]Lf;]P g;]QXg;]Rg;]Sg;]Tg;]U(h;]VXh;]Wh;]Xh;]Yh;]Z i;][Pi;]\i;]`i;]ai;]b(j;]c\j;]dj;]ej;]fj;]g0k;]h`k;]ik;]jk;]kk;]l(l;]dl;^l;^l;^l;^l;^m;^ADm;^Bdm;^Cm;^Em;^Gm;`m;am;a n;a$n;b4n;cPn;c|n;dn;dn;en;fn;fo;f,o;fXo;go;go;go;go;g p;g,p;gLp;gpp;gp;g p;g p;hp;i q;i(q;iHq;j`q;k|q;kq;kq;lq;mq;n r;o,r;olr;or;or;os;oHs;qs;rs;rs;rs;rt;rLt;rxt;st;st;st;st;su;s8u;sTu;z;z;z;z;z;0!;\w;hw;0!;|w;w;w;w;w;0!;w;w;0!;w;w;0!;w;w;0!;w;w;0!;0!;w;0!;w;w;0!;x;x;0!; x;(x;0!;0x;8x;Dx;Lx;Px;0!;w;Xx;0!;`x;lx;x;x;x;x;x;x;x;x;x;x;x;0!;y; y;0!;y; y;0!;0y;8y;0!;@y;Dy;0!;Py;Xy;0!;hy;Xy;0!;py;xy;0!;y;y;0!;y;y;0!;hy;y;0!;hy;y;0!;y;y;0!; z;z;0!;$z;,z;0!;8z; 0!;0!;0!;0!;0!;0!;t|;0!;0!;0!;0!;0!;0!;0!;0!;0!;0!;0!;0!;0!;0!;0!;0!;0!;0!;0!;0!;|J2K2L2(L20L2$L2hv8pv8xv8 z8v8v8v8{8w8w8w8L}8v8v8v8z8w88w8`w8||8x8(x8Px8~8P~8~8~8~8 8x8x888x8X88;; ; ;Ă;ABCDEFGHIJKLMNOPQRSTUVWXYZT222\2h;|;;;;;;Ē;В;ؒ;;;;;; ;(;4;<;H;XBBp@m@m@m@ f(  pt""(4I@@@@1` #U4QFb '               >@<`0303$938393l:3<3<3uaudio_identify_acp z3z3$|3{3`3h3`33LP3d333t3l33t3333x3      3333h33 33p3abcde f g h i jklmnopqrstuvwxyz1!2@ 3#!4$"5%#6^$7&%8*&9('0)( ) *!+ , --_.=+/[{0]}1\|2\|3;:4'"5`~6,<7.>8/?9:;<=>?@ABC D E FG HIJK,L!MN-OPQRS T/U*V-W+X Y1Z2[3\4]5^6_7`8a9b0c.e mMqQ@zy2" 3#6&$7/{%8([&9)]'0=}-?\./0+*1#'2#'345 6,;7.:8-_d<>| .'`0+*~5^2"@ 3#!4$#6&$7/{%8([&9)]'0=}-+?.|/01'*2'*3456,;7.:8-_d<>\ .'`|0^~-+?\0345d<>| .'`|0^~.\0345|d<>.\`0^~q,?azw&12~ "3#!'4{"(5[#-6|$7`%_8\&9^'0@-)].=+}/0$1*2*3m4%56;.7:/8!d<> bBeE hH iI jJkKlL|,?nN~aArR,sSzZyY2 "3!'4"(5{[#6$7%!8&9%!8'0-)}].-_/0$*2`@#3mM4%5@#7:/\8=+g= 2" 3"5%#6&$7/%8(&9)'0=-'?.^/{[0+*}]123@4#5\|6,;7.:8-_d<> 1!2" 3!4$"5%#6^$7&%8*&9('0)--_.=+1#~2#~4'@5``d\|2"#6&$7'%8(&9)'0--=.^~/@`0[{1]}2]}3;+4:*5\_\|1!|2"@ 3#!4$~#6&$7/%8(&9)'0=-'?./[0+*]1}2}34{5\6,;7.:8-_d<> eE !1@-2_ /3#!;4$":5#,6^$.7&%=8*&[9(']0), -?+'.xX%/{0wW}1qQ|2qQ|34"5`~67fF8\ q,?azw&1|2@ "3#!'4"(5#6^$7%!8&9{'0}-).-_/[0$*]1`2`3m4%56;.7:/8=+~d<>\ xje.> u i d c htnbrl'"poygk,<qf;:-[{.]}//?0=+3s4-_6w7v8z9: ;<=>?@ABCD E aAbBcCdDeE fF gG hH iI jJkKlLmMnNoOpPqQrRsStTuUvVwWxXyYzZ#6^6,$7&7./[{0]}3;:4'"6,<7.>8/? aAbBcCdDeE fF gG hH iI jJkKlLmMnNoOpPqQrRsStTuUvVwWxXyYzZ#6^6,$7&7.--_.=+/[{0]}1\|2\|3;:4'"5`~6,<7.>8/? eEzy1+|2"@ 3*#!4#6&$7/%8(&9)'0=-'?./[0!]1$}2$}34{5 6,;7.:8-_d<>\ -'?.^`~0!]/[34{2"@ 3##6&$7/{%8([&9)]'0=}-'?.<>/+*012345\|6,;7.:8-_d<> .+*/2\|4qQ@1!2" 3##6&$7/%8(&9)'0=-'?\./0+*~1}]2}]34{[5|6,;7.:8-_d<> 1!2@ 3#!4$"5%#6.=+/0[{1]}2]}345'"8;:c.d\|/? IqQ@2' 3^#!4+$"5%#6&$7/{%8([&9)]'0=}-*?\.-_/0~1,;2,;34i5"678.:d<>| /1,;`2,;`3'aAcCeElLnNoOsSxXzZ bB{cC& fF[ gG] iI jJnN}qQ\vV@wW|xX#zZyY>1'~2" 3+^!4!"5%#6/$7=`%8(&9)'-./QP01qp2qp3$4506,?;7.:8-_*d< bB{ fF[ gG]kKlLmMnN}qQ\vV@wW|zZyY1!~2" 3#^!4$"5%#6&$7/`%8(&9)'0=-'?.+*/0123456,;7.:8-_d<> mMoOpP1!2"@ 3/!4$"5%#6?$7&%8*&9('0)--_.=+/[0']1<>}2<>}3;:~4{5#|\6,'7..8d /^^[0]4``{8aAcCeE gG iIkKlLnNoOsSuUzZ  9R9 >9]d99IR99JT9R979 9  9 09 T9K.9ĕ9@#Ε9ĕ9ĕ9ĕ9 ĕ9ĕ9H@ĕ9 N9 _p99x9\9 ƙ9 ޙ9 ƙ9E9 ~9m9K9A,9[9d909 99j9ԟ9?9 3T3H3<\333h3t33d4L44t4 44D4444D44(  v      W 1 Q `  4@  0 2 A@ A   @  @ @   P0 P  A   h }  } } } @  85   4  L+ L D!4L2 D   O  {!4o  A AZPZPZPP8'4'4()4*4fG---0000 0@0P010`0p0aLfLLLLi d0404T5444D74 848494F  @@@ @ @AA@:F:FP 43W  !      @ @ @ @ A n n@n @nn@0Df @  Q k k"k"k"k"k @^z BF |9 8DD4D4|H4|I4 B  w W  1b0{&"=F@n a-<@c4c4 h4Xi4T~4~4D44@ 'W W@ @EEE }WQ  k"BFFeeeZZ Z 04̗44X42V{%1" `s%t4H44 4$44444x44t4$4X4X4p4@@9WP P Q@url_int_miibus_readregurl_int_miibus_writereg85 5<5 5P55455G W WnPnPA  ! 4Xhp9{#{{{S&@'ah 33.U 1(Ex$ lL550 5 50    h(5p(5H+5+5   `,1515P4545  l! e P ` cX<5<5?5<@5  BDK #(-2>'()*+,-./@ABCF'()*+,-./@ABCF'()*+,-./@ABCF/@ABCDEFGHIJKNMNO`abcdefghik*++,,--../-@@A&''(())**++,,-MNO`abcd e f g h ik$%b(&b,'b0(b4)b8*b<+b@,bd"h"l"p"t"x"|""" " ")$+$-$/$L 5t55<5!A  !@@@@5\55;`5l5 5Q`$;<5H5h5@;2T;3h;d5p5h5;5;,6L65 ; ; ; ;CP;CP;CP;CP;CP;CP;CP!;CP";CP ;(6 56 6 6h5 ;Ð;66066 5060;D;l6 5h5` `;6 5h5|;666};};};<6H6h5;; ;P6\6h59,;6 5h5"6%6)6+6,6-6;;6 ;!(;(<;3T;h;2;06@3666;;;;.; 8;X;x;;;4;;;58;X;6x; 22  ##   * #  * #hh   1 @=6>6h5n`;@`;n`;n` ;;A6B6h5!;(;<;(E6F6h5urlphy_attachurlphy_serviceurlphy_statusxI6pL6T6L;2;XU6 X6HY6; ;!;!;.;8><ԣ;,4<;;;;4<;;;;;<;;;;8><;8<;d;\v:; ;;;;; ;$'<\<(;3<C<8;8D<@;H; `; ;l;t;;;<;;8m<;;;;;;;;;{;;;;;; ;$;,;4; <;0D;@T;`;l;`4<p;4'<`;;;; ;;;;;; ;!;;4<\v:;(;;;;$;,;@;P; ;\;9h;9x;9;9;89D(;9;9;L9;9 : 9; `9|{; 9; 9; h9;9;9A:(9;X9;)g;:g ;%h;2h,;6h<;rhT;3ih;rix;q;q;q;#r;;;;';;(;30;58;E@;UPH;WP\;WQd;WRp;Y|;PY;QY;RY;`;`;U`;V`;`e;be$;ceU<de0;ee<;FvP;pw\;t;|;;;;; ;P;Q;U;V(;X<;ZT;h;|;;;;;;;;; ;;$; 0; <;H;P;X;`; h;==p;==x;==;==;==;==;==;== ;== ;;;;;;(;8;H;X;Ph;Et;HX;;;Q ;BX;;;;; ;;; ;0;@(;P4;@;P;X;3@ `;3@`h;3@pp;%5x;E;I;Q;a;;;;!;#;1;3;5;A;C(;c4;u@;!L;1X;Dd;Gp;|;; 3;R;R;)R;7R;9R;CR;FR;GR;IR;KR$;LR0;MR<;aRH;cRT;R`;Rl;Rx;R;QT;UT;WT;aT;q; ; ;;;;;x;x!;`8$;xP0;xU<;YH;YX;u`h;x`t;xa;xp;xq;xr;xs;xt;x;x;x;x;x;x;i;x ;,;<;L;\;l;|;;P;Q;_;;;;;;P;;(;4;d@;eH;dT;d;t;;;;;;;;;;;;(;<;D;L;#\;%h;'t;2;5;.B;0B;B"d;B$d;;;;;;;;;; ;";",;"@;"P;" `;" t;" ;"@ ;" ;" ;" ;" ;" ;" ;" ;" ;"0;"p ;"p,;" p8;" p@;"pL;"pT;"t`;"th;"tp;"t|;"t;" t;" t;" t;"t;"t;"t;"t;"t;"@t;"At;"Ct;"Et;"Ft ;"Ht;"It$;"Pt,;"Qt8;"TtL;"Ut`;"Xtl;"Ytx;"`t;"dt;"ht;"it;"jt;"kt;"mt;`;;`;5;(;D/8;T!L;kT;k\;k`;kh;kt;k;k;k;k`4;k?;k@;kA;kB;kC;kE;kF;kG;kH;kI;kK;kL;kO;kP;kQ ;kR;kS(;kT(;kU(;kV4;kWL;kXP;kYX;kf`;kgp;khp;ki;kj;kk;kE;8;8;`4<푠;홠;;;; ;0;` ;p;$; 0;0<;`H;pT;`;l;x;;;[;Cu;P1;T1;P>;p>;DA;PA;QA ;RA0;SA@;XAL;dAT;pAh;qA|;rA;sA;BB;6C;7C;AC;BC;EC;GC;HC;IC;LC ;MC0;SC@;TCL;XCX;aCd;cCp;iC;nC;pC;qC;rC;sC;tC;uC;vC;wC;xC;yC;zC;{C ;C;C;C(;C4;CD;CP;C`;Cl;Cl;Cl;Cl;Cl;Cx;C;C;TE;BG;DG;IG;LG;MG;NG;OG;PG;QG ;RG;SG ;TG,;UG8;VGD;WGP;XG\;YGh;ZGt;fI;nI;BL;DL;EL;FL;GL;IL;ML;NL;PL;QL;RL;SL ;WL,;YLD;ZL\;fLt;FM;LM;DN;EN;JN;HN;PN;dN;hN ;DP4;FPD;RPP;DQ\;EQh;FQt;GQ;LQ;MQ;NQ;OQ;WQ;YQ;ZQ;^Q;lQ;ER;FR ;GR,;KR8;LRD;HSP;KS\;LSh;MSt;NS;FT;LT;RT;`T;RV;SV;TV;UV;VV ;0X;1X(;2X8;3XH;5X`;8X|;@Y;AY;PY;QY;TY;UY;`Y;aY;bY;dY;tY;uY;4Z$;6Z0;7Z0;8Z$;?Z0;AZ;BZ;aZ;bZ;`[<;b[H;c[\;d[h;p[x;r[;s[;t[;a\;c\;D];O];o];p,;p8; qD;IqT;qt;ʌ;ʘ;ʤ;PG;C;;;;;;;; ;4;H;\;x;x; ;;;;#;#;@#;@#;@@;P!;D;D ;D ;D;`(; `0;<;D;L;X;V`;h;p;D;E;F|;G;H;I;J;L;M;S;T;X;Y;];^;h;i ;j;k ;n,;r8;sD;vP;wX;x`;yh;zt;{|;|;};~;;;;;;;;;;; ;;$;0;8;@;L;X; d; p;x;C;C;C;C;C; C;!C;"C;$C;%C;3C;DC;D;X;X;X; X;!X;"X;#X ;P;Q;n$;o,;x4;y@;tL;K@X;K@h;K0t;tcsg;};?;%;,;,;,;,;,;,;,;,;,0 ;8;; ;;$;0;<;H;T;`;l;x;;;;;`;`;`;`;`;@;@;B$;C,;F4;G<;HD;IL;PT;p`;sh;p;1x;1;$1;21;5;qNC; ;\<$'<; ;20;30;40;@;p@;@;@$;@4;@H;@X;@h;@x;@;@;F; p`4<;$'<;;;)$'<+;2;3(;48;5L;@d;C|;i$'<l3<m3<;;0;`;x;;;0 ;P;(; 0;D;3P;6P;<<C$`;/l;x|;t;r;q;;;;;;;;Y ;Y$;Y<;H;X;l;;;;;@T;p;p;p;p;8; ;4;@;T;`;t;;;<;x;x;x;x;x;x;x;x; ;;;2$;,;<;D;L;\; d; l;t;|;;;;;!;";#;$;% ;&;F,;eD;(P;(\;(h;(h;(t;(\;( ;( \;( ;( ;(;(;(;(;(;(;(\;(h;(\;(\;(\;(\;(!\;( ; `;`(;0;<;D;@L;aX;3d;@l;Cx;K;K;L;D;D;D'B;$;$%;$;$;$;$ ;$!$;$"4;tqD;tPP;tX\;]d;]ht;]i;]x;];];];];];](;]8(;](;$;8;L;8\;?h;?p;?|;?Ā|;?Ȁ|;?;?;';';;6;;;;FP;p;;<;<$;<4;< D;<(T;<)l;<0;<1;<H;<T;<;<;<;<;< ;<) ;<*,;<.4;<H;<2`;<2t;<2;<2t;<2t;<2t;< 2;<"2;<#2;<%2;<02;<12;<22;<32;<42;<52;<62;<72;<82;<92;<:2;<;2;<<2;;;;;;(;0;8;@; H;3X;3$'<3DJ<T;X;h; x;;;;; T;";.;6;>;W;p;;;; ;$ ;4;OI"P;Ph;`|;;;; !; ";I;;9; ; ;&T<'T<);*;,;0<2<5<@0<@(%<P%<Q%<R&<S&<T$&<U$&<V4&<W4&<Y@&<ZP&<[P&<\\&<]l&<^|&<`&<d&<e&<f&<g&<h&<j&<k&<l&<m&<n&<~ '<'<('<<'<L'<X'<h'<|'<'<L'<'<'<'<'<'<(<(< (<4(<D(<L(<\(<L'<h(<h(<t(<(<4(<L'<(<(<(<(<(<(<L'<)<)<()<<)<(<P)<d)<t)<)<)<)<)<)<)<@)<A)<B)<D)<F)<P)<Q *<R*<S(*<a4*<eD*<gT*<pd*<qt*<r*<t*<u*<v*<x*<y*<z*<{+<|+< +<4+<L+<d+<x+<+<+<+<+<+<+<+<+<+<,<,<,<,,<8,<H,<T,<`,<l,<x,<,<,<,<,<,<,<,<,<,<,<,<@,<A,<B,<P -<Q -<S4-<XH-<YX-<[h-<`x-<d-<e-<f-<g-<h-<i-<k-<l-<m-<n-<o-<p-<q-<r.<~.<.<4-< .<4.<4.<4.<4.<4.<4.<4.<4.<.<.<.<@.<@.<@.<.<.<L.<d.<t.<.<.<.<!.<".<$.<&/<'/<(.<).<+ /<,4/<-H/<0\/<1t/<3/<C/<G/<H/<`/<c/<h/<l/<m/<n/<i/<j/<l/<m/<p0<q0<r$0<s$0<t00<u00<v00<w00<x00<z/<~<0<<0<H0<T0<d0<d0<p0<|0<|0<0<0<d0<d0<p0<p0<@0<D0<E0<F0<H0<I0<J0<K0<L0<M0<N0<O0<P0<Q0<R0<S0<T1<U1<V1<W1<X1<Y1<Z1<\ 1<] 1<^ 1<_ 1<9U ><9b><9b$><9c,><9c4><9%c<><9&cD><90cP><9p\><9pl><9px><9p><9p><9p><9p><9u><><><><?<D3HN<I3`O<B@K<8BLK<XBXK<YBlO<iBL<B|K<CK<8RxO<a`;r@K<rO<8rLK<XrXK<YrO<irL<r|K<sK<1O<5O<O<O<O<O<O<P<P<8P<,P<8P<DP<PP<h`P<lP<xP<8P<8P<8P<8P<%tqP<P<P<P<P<P<P<P<P<P< Q< Q< Q< Q< Q<(Q<4Q<@Q<LQ<XQ<dQ<pQ<|Q<Q<Q<Q<Q<Q<Q<Q<Q< Q<!Q<"R<# R<$R<%$R<60R<7R<?R<fR<gR<hR<iR<jR<kR<mR<nR<oS<S< S<,S<8S<DS<PS<\S<hS<tS<S<`S<aS<S<S<S<S<S<S<S< S< S<T< T<T<T<$T<,T<4T<DT< TT<`T<hT<pT<|T<T<1T<1T<2T<BT<T<JxA > > >  >> ! >> >  @DHL  @DHL     &(`& 0&0 0 `"0 0  JtT4$   rq! 2r!qq! 0  S1B1SSA1B1B11qw!! RSQQP@064a2]G4" w! 6"606.6v6p6q646q6ʄ6$6!$6J$6K$6$6$6$6$6$6$6$6$6%6%6%6&6o&6S&6Q&6R&6'6'6'6'6'6'6'6 (6!(6"(6$(6%(6)(6*(6&6 t6t6At6it6@6C46F46H46I4661P65P6@P61P6qܧ6qܧ6d1ܧ6I1,6I2,6,6I3,6@6U6,6,6,6066)RP6666663ML68ML60 L60ML6hML6hbL6iML6ibL6uL6uRL6urL63737q37u37v37w37s37r37=757=757w57q57u=7t57p57s=7p/7p/7p/7p/7 p/7< 7< 7< 7< 7< 7@`&7A`&7B`&7J`&7K`&7467e467467467467S4675467e467n467467H467,6,6,6T,6U,66,6>,6f,6g,6~,6,6,6,6,6\,6],6^,6_,6;7;7ICl?7iCl?7vCl?7Cl?7nCP6yCP6zCP683:,"H5:x5: 5:D6:9P6: 6:6:6:<8:fx8: Z6:8:L::d::222CC @ @  "2"]G4" w! 6higYCW xv|w   &'(yz{u^_`}~IJKLM (((((((((2222222<<<<<<<<<FFFFFFPPPPPPZZZZZZZZZddddddddddddddnnnnnnnnnnnnnnnnnnxxxxxxxxxx   #&) !%),036:=#(,159=ADHKOR(-38=BFKOSW[^beh<BHMRW\`dhloruwySY_dimqtwz|hmrvy|rrrrqqqq  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abc  !"#$%&'()0123456789@ABCDEFGHIPQRSTUVWXY`abcdefghipqrstuvwxy0123456789abcdefghijklmnopqrstuvwxyzOpenBSD4.0RAMDISK#35 @(#)OpenBSD 4.0 (RAMDISK) #35: Sun Sep 17 22:06:09 GMT 2006 OpenBSD 4.0 (RAMDISK) #35: Sun Sep 17 22:06:09 GMT 2006 deraadt@armish.openbsd.org:/usr/src/sys/arch/armish/compile/RAMDISK dackirqtargetlunsizewidthxintchanneldriveconsolemuxconfigurationvendorproductreleaseportnoreportidphydevfunctioncryptobiohotplugloopbpfilterdrive at %s channel %d drive %datapiscsi at %s channel %dwdcspl%s channel %d: reset failed for drive 1 drive 0atapi type: %s c_bcount: %d c_skip: %d missing untimeoutwdc_probe_caps%s(%s:%d:%d): using PIO mode %d, Ultra-DMA mode %d, DMA mode %d using BIOS timings%s: transfer error, downgrading to PIO mode %d %s: transfer error, downgrading to DMA mode %d %s: transfer error, downgrading to Ultra-DMA mode %d wdccmdwdccommandwdccommandext%s:%d: %s %s(%s:%d:%d): %s physio split wd ioctl request... cannot proceed user_strat: No ioctl tagged DT %s: target %d now using %s%s%d bit 80.0 MHz %d REQ/ACK offset xfers 40.020.013.310.06.675.0??3.33async siop: can't find my sync parameters%s: unable to allocate script DMA memory, error = %d %s: unable to map script DMA memory, error = %d %s: unable to create script DMA map, error = %d %s: unable to load script DMA map, error = %d %s: rejecting invalid wide negotiation from target %d (%d) %s: rejecting invalid PPR negotiation from target %d %s: ppr negotiation for target %d: offset (%d) or sync (%d) out of range %s: ppr negotiation for target %d: transfer width (%d) incompatible with dt %s: ppr negotiation for target %d: sync (%d) incompatible with adapter %s: ppr negotiation for target %d: no DT option %s: bad offset in siop_sdp (%d) clear fifo failed %s: timeout waiting for DIFFSENSE to stabilise %s: invalid SCSI mode 0x%x %s: switching to differential mode %s: switching to LVD mode %s: switching to single-ended mode siop%s: can't alloc lunsw for target %d %s: unexpected phase mismatch %d %s: selection timeout without command %s: unexpected disconnect without command != NULL%s: siop_intr() - we should not be here! istat = 0x%x, dstat = 0x%x, sist = 0x%x, sstat1 = 0x%x need_reset = %x, irqcode = %x, siop_cmd %s %s: script interrupt (0x%x) with invalid DSA !!! unknown irqcode %x unhandled message 0x%x %s: scsi message reject, extended message sent was 0x%x scsi message reject, message sent was 0x%x our reject message was rejected %s: done without command, DSA=0x%lx invalid retval from siop_wdtr_neg()invalid retval from siop_sdtr_neg()MSG_IGN_WIDE_RESIDUE: bad len %d invalid retval from siop_iwr()%s: extended message too big (%d) %s: target %d lun %d tag %d reselect without command %s: target %d reselect with invalid lun %d %s: reselect with invalid target %d %s: reselect with invalid target error, DSP=0x%x reselect failed %s: reselect with invalid tag %s: command with invalid status (IRQ code 0x%x current status %d) ! %s: unhandled scsi interrupt, sist=0x%x sstat1=0x%x DSA=0x%x DSP=0x%x parity error %s:%s: phase mismatch without command scsi gross error %s: DMA IRQ: DMA fifo empty, DSP=0x%x DSA=0x%x: last msg_in=0x%x status=0x%x current DSA invalid parity bus fault illegal instructionsingle step dsp 0x%08x dsa 0x08%x INTRF %s: unable to load data DMA map (for SENSE): %d %s: request sense failed %s: untagged command already running for target %d lun %d (status %d) %s: scsi bus reset cmd %p added to reset list from urgent list cmd %p added to reset list from ready list cmd %p (status %d) reset with status %d, xs->error %d cmd %p (tag %d) added to reset list %s: unable to load data DMA map: %d %s: can't alloc siop_lun for target %d lun %d %s: can't malloc memory for target %d siop_start: bad statustimeout on SCSI command 0x%x %s: unable to allocate cbd DMA memory, error = %d %s: unable to load cbd DMA map, error = %d %s: unable to create data DMA map for cbd: error %d %s: unable to create cbd DMA map, error = %d %s: unable to map cbd DMA memory, error = %d %s: can't allocate memory for command descriptors %s: can't allocate memory for command descriptors head siop: resel switch fullsiop_stat_intr %d siop_stat_intr_shortxfer %d siop_stat_intr_xferdisc %d siop_stat_intr_sdp %d siop_stat_intr_saveoffset %d siop_stat_intr_done %d siop_stat_intr_lunresel %d siop_stat_intr_qfull %d IBSSLucent WaveLAN/IEEESony WaveLAN/IEEELucent Embedded WaveLAN/IEEEPRISM2 HFA3841(EVB2)PRISM2 HWB3763 rev.BPRISM2 HWB3163 rev.APRISM2 HWB3163 rev.BPRISM2 HFA3842(EVB3)PRISM1 HWB1153PRISM2 HWB3163 SST-flashPRISM2 HWB3163(EVB2) SST-flashPRISM2 HFA3842(EVAL)PRISM2.5 ISL3873PRISM2.5 USBPRISM2.5 ISL3874A(Mini-PCI)PRISM2.5 ISL3874A(PCI-bridge)PRISM3 ISL37300PPRISM3 ISL37300P(PCI)PRISM3 (USB): unable to read station address wi_attachaddress %sWaveLAN/IEEE node%s: received packet on invalid port (wi_status=0x%x) %s: received packet of unknown type on port 7 %s: Error decrypting incoming packet. %s: oversized packet received (wi_dat_len=%d, wi_status=0x%x) %s: oversized mgmt packet received in hostap mode (wi_dat_len=%d, wi_status=0x%x) wihap: failed to copy header %s: wi_cmd failed with %d %s: timeout in wi_cmd 0x%04x; event status 0x%04x %s: wi_cmd_io: busy bit won't clear %s: init failed %s: invalid data path: %x %s: failed to allocate %d bytes on NIC %s: unsupported crypto algorithm %d wiscan%s: wi_scan_timeout: %d tries %s: mgmt. buffer allocation failed %s: tx buffer allocation failed wi_do_hostencryptwi_do_hostdecrypt%s: wi_do_hostdecrypt: iv mismatch: 0x%02x%02x%02x%02x vs. 0x%x %s: wi_start: dropping unassoc dst %s %s: wi_start: xmit failed %s: host encrypt not implemented for 802.3 %s: wi_mgmt_xmit: xmit failed %s: device timeout Unknown PRISM2 chipSymbol %s: %s%s (0x%04x), Firmware %d.%d.%d (primary), %d.%d.%d (station), %s: Firmware %d.%02d variant %d, %s: %u (%d dBm) put_rateswihap_init: sc=%p whi=%p Sending disassoc to sta %s Sending deauth to sta %s wihap_shutdown: FREE(sta=%p) wihap_shutdown: sc=%p whi=%p wihap_timeout: disassoc due to inactivity: %s wihap_timeout: deauth due to inactivity: %s wihap_auth_req: station %s short request wihap_auth_req: returns status=0x%x wihap_auth_req: algorithm unsupported: 0x%x challenge: 0x%x 0x%x ... wihap_auth_req: new station wihap_auth_req: station %s algo=0x%x seq=0x%x wihap_assoc_reqwihap_assoc_req: bad ssid: '%.*s' != '%.*s' wihap_assoc_req: capinfo: not ESS: capinfo=0x%x wihap_assoc_req: returns status=0x%x wihap_assoc_req: already assoc'ed? wihap_assoc_req: polling not supported: capinfo=0x%x wihap_assoc_req: WEP flag mismatch: capinfo=0x%x wihap_assoc_req: rates mismatch. wihap_assoc_req: from station %s wihap_deauth_req: unknown station: %s wihap_disassoc_req: unknown station: %s wihap_data_input: no TODS src=%s, fctl=0x%x wihap_data_input: incorrect bss: %s wihap_data_input: dropping unassoc src %s wihap_ioctl: i shouldn't get other ioctls! wihap_ioctlwihap_mgmt_input: len=%d MGMT: unknown (stype=0x%x) assoc resp: assoc req: probe req: reassoc resp: reassoc req: ann traf ind beacon: deauth: auth: disassociation: probe resp: ftype=0x%x (ctl=0x%x) %s: PHY read failed %s: PHY write failed %s: bad phy register %s: reset never completed! , address %s %s: no PHY found! %s: can't create DMA map for RX %s: can't load rx list, error = %d %s: can't create rx list map, error = %d %s: can't map rx list, error = %d %s: can't allocate rx listnseg, error = %d %s: can't create DMA map for TX %s: can't load tx list, error = %d %s: can't create tx list map, error = %d %s: can't map tx list, error = %d %s: can't allocate tx listseg, error = %d %s: can't map mbuf (error %d) %s: watchdog timeout %s: %d silo overflow%s, %d ibuf overflow%s comprmcomstartcomcninit: mapping failed: unknown uart %s: console : ns8250, no fifo : ns16450, no fifo : ns16550, no working fifo : ns16550a, %d byte fifo : st16650, no working fifo : st16650, %d byte fifo : ti16750, 64 byte fifo comattach: bad fifo type%s: can't establish soft interrupt%s: probed fifo depth: %d bytes %s: MAC/BBP RT2560 (rev 0x%02x), RF %s %s: WARNING: unable to establish power hook %s: WARNING: unable to establish shutdown hook %s: could not allocate Rx ring %s: could not allocate Beacon ring %s: could not allocate Prio ring %s: could not allocate ATIM ring %s: could not allocate Tx ring %s: could not create desc DMA map %s: could not allocate DMA memory %s: could not map desc DMA memory %s: could not load desc DMA map %s: could not create DMA map %s: could not allocate soft data %s: could not load rx buf DMA map%s: could not allocate rx mbuf cluster %s: could not allocate rx mbuf %s: could not allocate beacon %s: sending data frame failed 0x%08x %s: sending mgt frame failed 0x%08x rt2560_decryption_intr%s: could not load old rx mbuf%s: could not map mbuf (error %d) rt2560_tx_mgt%s: could not allocate RTS frame rt2560_tx_data%s: could not write to BBP %s: could not read from BBP %s: could not write to RF RT2522RT2523RT2524RT2525RT2525eRT2526unknownRT5222%s: timeout waiting for BBP %s: could not enable device ral%s: MAC/BBP RT%X, RF %s %s: could not allocate Mgt ring %s: could not allocate Tx ring %d %s: timeout waiting for NIC to initialize rt2661_rx_intrrt2661_tx_mgtrt2661_tx_dataRT5225RT5325 (MIMO XR)RT2527RT2529 (MIMO XR)ral-rt2561ral-rt2561s%s: could not load 8051 microcode %s: could not read microcode %s ral-rt2661timeout waiting for MCU to initialize %s: could not allocate beacon frame uhciuhci_allocm%s: host controller halted %s: host controller process error %s: host system error %s: interrupt while not operating ignored %s: controller did not reset startstop%s: cannot %s uhci_alloc_std_chain: maxp=0 uhci_abort_xfer: not in process contextuhciabuhci_device_isoc_enter: xfer=%p in frame list uhci_device_isoc_close: %p not found uhci_device_setintr: 0 interval UHCI root hub version %d.%d%s %s: unsupported OHCI revision %s: reset timeout %s: SMM does not respond, resetting ohci,, legacy support%s: blocking intrs 0x%x %s: unrecoverable error, controller halted %s: resume detect %s: %u scheduling overruns ohci_add_done: addr 0x%08lx not foundohci_rem_ed: ED not foundohci_abort_xfer: not in process contextohciabohci_root_ctrl_startOHCI root hubohci_setintr: 0 interval %s: isoc TD alloc failed ohci_device_isoc_abort: early return ehciehcidb%s: run timeout ehci_check_intr: sqtdstart=NULL %s: config timeout ehci_open: bad device speed %d%s: *** WARNING: opening low/full speed isochronous device, this does not work yet. ehcidiehci_root_ctrl_start%s: port reset timeout EHCI root hubehci_abort_xfer: not in process contextehciawehciabradioradio at %srd%drdattach: device name too long RAM diskfictitiousrd_idlebioioctlhotplug_device_attachhotplug_device_detachhotplug: event lost, queue full hotplugclosehtplevhotplugreadAll breakpoints used. Already set. Too many breakpoints. Not set. No breakpoints set Map Count Address %s%p %5d %-12sdb_commandCount missing Bad modifier Ambiguous No such command Malloc debugging not enabled. the kernel did not panic procscalloutallbreaksextentsmallocobjectpanicpoolprocuvmexpvnodewatchescrashhaltpoweroffmachineexaminesearchdeletebreakdwatchwatchstepcontinueuntilnextmatchtracecallshowboothelphangmandmesgddb> Bad function %#n Argument missing Too many arguments ELF[ %s symbol table has bad start address %p ] ELFbad magic[ %s ELF symbol table not valid: %s ] bad e_machine.strtab.symtabsymtab unaligned[ using %lu bytes of %s ELF symbol table ] symtab corrupted= 0x%lx %c\%03o%-*ld%-*lo%-*lr%-*lu%-*lx%-*lz: %*d%*o%*r%*u%*x%*zAddress missing Value missing Syntax error Symbol not found Divide by 0 Negative shift amount ^R String too long Bad escape Bad character Bad character in number End of stack trace. --db_more-- -%*lo-%#*lo-%*lu-%#*lu-%*lx-%#*lxFaulted in traceback, aborting... Starting stack trace... %-12s%#*ln %s+%#lr[after %6d] bsd[ no symbol table formats found ] No slots left for %s symbol tableUnable to find symbol table slot for %s.invalid symbol table name%s %s%s Sifting table %s: db_printsym [%s:%d]+%sBreakpoint at Stopped at RUN AT LEAST 'trace' AND 'ps' AND INCLUDE OUTPUT WHEN REPORTING THIS PANIC! DO NOT EVEN BOTHER REPORTING THIS WITHOUT INCLUDING THAT INFORMATION! After %d instructions (%d loads, %d stores), radixmaxoffmaxwidthtabstopslineslogUnknown variable No value All watchpoints used. No map. Too many watchpoints. No watchpoints set Map Address Size %s%p %8lx %lx Unknown size %#8n = %#8n Nothing written. () Score: %lu/%lu db_hangmanmiccdspeakerheadphonesaudioaudio: could not allocate play buffer audio: could not allocate record buffer audioattachrecordmonitorsourceauddetaudiodetach: %s didn't detach au_portofoplaudioprint: unknown type %d%s at %smpuaud_draud_hraud_rdaudio_silence_copyoutaud_wrau_set_gainau_get_gainau_set_portau_get_portaudiosetinfoaudiogetinfooutputsmutewskbd_get_mixerdevwskbd_set_mixervolume/etc/firmware/%smidimid_rdmid_wrmid_clmid_dr: <%s> midi at %sunconfiguredarc4_stirextract_entropyrndrdRRIP without PX field? RRIP with incorrect flags?RRIP with incorrect NM flags? IEEE_P1282RRIP_1991AIEEE_1282SPcd9660_mountroot: can't setup bdevvp'scd9660root_deviceCD001%/@%/C%/Eisoinodefhtovp: directory crosses block boundary %d[off=%d/len=%d] fhtovp: bread error %d fhtovp: crosses block boundary %d fhtovp: lbn exceed volume space %d cd9660_strategy: spectag VT_ISOFS, isofs vnode elf32_load_fileOpenBSD#!/dev/fd/%dswapperfork initcfpendcannot mount rootcannot find root vnodepagedaemonfork pagedaemonreaperfork reapercleanerfork cleanerupdatefork updateaiodonedfork aiodoned/sbin/init/sbin/oinit/sbin/init.bak/dev/consolewarning: /dev/console does not exist warning: /dev/console error %d initexecinit: couldn't allocate argument spaceexec %s: error %d init: not found no initinitclocks: unable to register softclock intrfileplfdescpldup2: fdallocfdlockclosefkqeueplknoteplkqreaduser mapping failed kernel mapping failed %d init died (signal %d, exit %d)waitppwaitWARNING: thread `%s' (%d) exits with status %d unable to allocate kthread_qlockmgr: make up your mindlockmgr: not holding exclusive locklockmgr: unknown locktype request %dlockmgr: non-zero exclusive countlockmgr: locking against myselflockmgr: upgrade exclusive locklockmgr: processor %lu, not exclusive lock holder %lu unlockinglockmgr: pid %d, not exclusive lock holder %d unlockinglockmgr: draining against myself lock type %s: EXCL (count %d) by processor %lupid %d with %d pending not locked lock type %s: SHARED (count %d)malloc: allocation too largemalloc: out of space in kmem_map%d,physbufphysio%-16s %-8s %18p %s %5d %5d %5d %d %#10x %-9.9s %-16s COMMANDSTRUCT PROC *UAREA * PID %-10s %18s %18s %18s VMSPACE/VM_MAP PID %-16s %-8s %18s %s EMULWAIT-CHANNELWAIT-MSGFLAGSWAITPPIDPGRPUID PID %5s %5s %5s S %10s %-9s %-16s usage: show all procs [/a] [/n] [/w] /a == show process address info /n == show normal process info [default] /w == show process wait/emul info procinit: mallocprocplzombieplucredplpgrpplsessionplpcredplchgproccnt: procs < 0idlezombiedeadonprocADVLOCKCTTYINMEMNOCLDSTOPPPWAITPROFILSELECTSINTR SUGID SYSTEM TIMEOUT TRACED WAITEDWEXITEXECPWEUPCSSTEPSUGIDEXECNOCLDWAITNOZOMBIEINEXECSYSTRACECONTINUEDSWAPINBIGLOCKTHREADIGNEXITRVSOFTDEPPROC (%s) pid=%d stat=%s flags=%b pri=%u, usrpri=%u, nice=%d forw=%p, back=%p, list=%p,%p user=%p, vmspace=%p estcpu=%u, cpticks=%d, pctcpu=%u.%u%, swtime=%u user=%llu, sys=%llu, intr=%llu mawn%c%5d %-10.10s %18p %18p %18p plimitplsensorsensorssensors kthreadsigaplpauseissignal coredump%s.corehashinit: bad cntsysctlsysctl_disklockkern_sysctl%s,denied attempt to set clock forward to %ld denied attempt to set clock back %ld seconds nanosleep?%9d %2d/%-4d %8x %s ticks now: %d ticks wheel arg func smashed stack in %spreempt: cpu_preempt not yet implementedsetrunnable not configured unsupported >>> %s probe returned %d >>> probing for %s* mapply: no match function for '%s' device>>> %s probe won >>> no winning probe root device %s not configured %s (root)config_make_softcconfig_make_softc: allocation for device softc failed%s%dconfig_make_softc: duplicate %sexpandcreatconfig_make_softc: %sing dev arrayconfig_make_softc: device name too longconfig_detach%s detached config_detach: forced detach of %s failed (%d)config_defer: can't defer config of a root deviceconfig_defer: can't allocate defer structurewrit%s%d%c: %s %sing fsbn %d of %d-%d (%s%d bn %d; cn %d tn %d sn %d)disk_attach: can't allocate storage for disklabeldisk_detach: disk_count < 0disk_unbusy: %s: dk_busy < 0 rootdev=0x%x rrootdev=0x%x rawdev=0x%x cannot open disk, 0x%x/0x%x, error %dfilesystem type %d not known.. assuming ffs dk_mountrootcannot read disk label, 0x%x/0x%x, error %droot filesystem has size 0bufq_default_alloc: no memoryintrextentplextntextent_free: start 0x%lx, end 0x%lx extent_free: region not foundFLWANTEDWANTEDNOCOALESCEFIXEDextent `%s' (0x%lx - 0x%lx), flags=%b 0x%lx - 0x%lx extent_print: NULL extentklogmtx_enter: ipl not implementedphpoolpcgpoolpool_init: too much uptimepool_get: %s: page emptypool_put: %s: page header missing page %p, nmissing %d, time %lu,%lu POOL %s: size %u, align %u, ioff %u, roflags 0x%08x alloc %p minitems %u, minpages %u, maxpages %u, npages %u itemsperpage %u, nitems %u, nout %u, hardlimit %u nget %lu, nfail %lu, nput %lu npagealloc %lu, npagefree %lu, hiwat %u, nidle %lu empty page list: full page list: partial-page list: no current page cache %p: allocfrom %p freeto %p hits %lu misses %lu ngroups %lu nitems %lu group %p: avail %d %p no log curpage %p FailReleasesPgreqPgrelNpageHiwatMinpgMaxpgIdleNameSizeRequests%-10s%4s%9s%5s%9s%6s%6s%6s%6s%6s%6s%5s db_show_all_pools%-*s %*u %*lu %*d %*s %*lu inf%-10s %18p %18p %-10s %18s %18s Allocatorusage: show all pools [/a] pool(%p:%s): page inconsistency: page %p; at page head addr %p (p %p) pool(%p:%s): page inconsistency: page %p; item ordinal %d; addr %p (p %p) kernel %sassertion "%s" failed: file "%s", line %d%s: table is full panic: splassert: %s: want %d have %d spl assertion failure in %slogprikprintf%llx%lld%llobug in kprintf: bad base0123456789ABCDEF(null)0123456789abcdefaddchangeddbdisableenableexitfindlistquittimezoneverbosev--- more --- 0x%x0%o*UNKNOWN**FOUND*%3d free slot (for add) Unknown devno (max is %d) %3d at disable %s flags 0x%x ???%3d %s count %d (pseudo device) %s [] ? Unknown argument %3d can't change free slot change (y/n) ?%3d %s changed flags changed out of memory. already disabled Error unknown state %3d can't disable free slot %3d %s can't disable pseudo device %3d can't enable free slot %3d %s can't enable pseudo device command args description [count] number of lines before more enter ddbdev add a device8|10|16 base on large numbersdevno|dev change devicesattr val|devno|dev disable devicesattr val|devno|dev enable devicesdevno|dev find devices this message list configuration leave UKC[attr [val]] show attributes (or devices with an attribute)[mins [dst]] set timezone/dst don't know toggle verbose bootingUnknown routine /%c/ Unknown attribute Unknown pseudo routine /%c/ Value missing for attribute %s ? Not same device type No more space for new devices. No device of this type exists. Clone Device (DevNo, 'q' or '?')Insert before Device (DevNo, 'q' or '?')Device not complete number or * is missing Argument expected Dev expected 8|10|16 expected DevNo or Dev expected Attr, DevNo or Dev expected timezone = %d, dst = %d Unknown command disautoconf verbose %sabled Unknown command, try help User Kernel Config UKC> Continuing... sys_ioctlselectpipelkpiperdpipewrpipeclpipeplttckoutqttwritettyrub: would panic c = %d, val = %d load: %d.%02d not a controlling terminal no foreground process group runningrunnableiowait cmd: %s %d [%s] %ld.%02ldu %ld.%02lds %d%% %ldk empty foreground process group putc: required clalloc b_to_q: required clalloc WARNING: mclpool limit reached; increase kern.maxclustersmbplmclplm_copym0: null mbufm_copym0: m == NULL and not COPYALLm_copym0: off %d, len %dm_copydata: off %d < 0m_copydata: null mbuf in skipm_copydata: null mbufm_copydata: len %d < 0m_apply: len %d < 0m_apply: null mbuf in skipm_apply: null mbufm_apply: off %d < 0m == NULL in m_pulldown()unixsockplsoclose: NOFDREFsoaccept: !NOFDREFsbappendaddrsbappendcontrolsemi-panic: sbcompresssbdropsbcreatecontrol: message too large %d acceptuipc 1uipc 2uipc 4piusrrequnp_attachunp_bindunp_connect2unp_disconnectbremfree: lost tailbufplgetblkallocbuf: buffer larger than MAXBSIZE requestedgetnewbufbiowaitbiodone alreadynchplcluster_read: DONE bpcluster_callback: too little memoryClustered Block: %d addr %x bufsize: %ld Child Block: %d addr: %x Clustered write to wrong blocksvop_generic_revokealloperation %s not listed in %s. vfs_op_descsvfs_opv_init: bad operationvfs_opv_init: operation vector without default routine.nameilockfpllf_findoverlap: defaultrelookup: null namerelookup: lookup on dot-dotvnodesvfslock%s_mountroot failed: %d vgetvclean: deadlockvclean: cannot reclaimvclean: not cleanvgonemissing bdevvgonel: not cleanmissing aliaskinfo: vp changed WARNING: some file systems would not unmount retrying unmount of %s failed with error %d syncing disks... giving up done %d softdep vwakeup: neg numoutputvinvalbufvinvalbuf: flush failedvinvalbuf: dirty bufsvflushbufvflushbuf: not dirtybgetvp: not freebrelvp: NULLAGENEEDCOMMITASYNCBADBUSYCACHECALLDELWRI DIRTY DONE EINTR ERROR GATHEREDINVALLOCKEDNOCACHEPAGETPGINPHYSRAWREADTAPEUAREAWANTEDWRITEINPROGXXXDEFERREDSCANNEDPDAEMON vp %p lblkno 0x%x blkno 0x%x dev 0x%x proc %p error %d flags %b bufsize 0x%lx bcount 0x%lx resid 0x%zx sync 0x%x data %p saveaddr %p dep %p iodone %p dirty {off 0x%x end 0x%x} valid {off 0x%x end 0x%x} VNONVREGVDIRVBLKVCHRVLNKVSOCKVFIFOVBADNONUFSNFSMFSMSDOSFSLFSLOFSFDESCPORTALKERNFSPROCFSAFSISOFSADOSFSEXT2FSNCPFSVFSXFSNTFSUDFtag %s(%d) type %s(%d) mount %p typedata %p data %p usecount %d writecount %ld holdcnt %ld numoutput %d clean bufs: bp %p dirty bufs: RDONLYSYNCHRONOUSNOEXECNOSUIDNODEVASYNCEXRDONLY EXPORTED DEFEXPORTED EXPORTANON EXKERB LOCALQUOTAROOTFSflags %b vnodecovered %p syncer %p data %p vfsconf: ops %p name "%s" num %d ref %d flags 0x%x statvfs cache: bsize %x iosize %x blocks %u free %u avail %u files %u ffiles %u f_fsidx {0x%x, 0x%x} owner %u ctime 0x%x syncwrites %lu asyncwrites = %lu fstype "%s" mnton "%s" mntfrom "%s" locked vnodes: %p %p, %pall vnodes: %p, %p,syncersyncer vnode sys_mountmount: lost mountunmount: dangling vnodesys_statfssys_fstatfssys_getfsstatsys_getfhsys_fhopensys_fhstatsys_fhstatfsvn_lockvop_islockedvop_lookupvop_createvop_mknodvop_openvop_closevop_accessvop_getattrvop_setattrvop_readvop_writevop_leasevop_ioctlvop_pollvop_kqfiltervop_revokevop_fsyncvop_removevop_linkvop_renamevop_mkdirvop_rmdirvop_symlinkvop_readdirvop_readlinkvop_abortopvop_inactivevop_reclaimvop_lockvop_unlockvop_bmapvop_printvop_pathconfvop_advlockvop_reallocblksvop_strategyvop_bwritedead_read: lockdead_write: locktag VT_NON, dead vnode dead_badop calledchkvnlockfifowfifortag VT_NON, fifo with %ld readers and %ld writersfifo_badop calledspec_read typespec_write typespec_ioctlspec_fsyncspec_fsync: not dirtyspec_close: not specialtag VT_NON, dev %d, %d spec_badop calledspec_open_clone(): cloning device (%d, %d) for pid %u spec_open_clone(): new minor for cloned device is %d spec_close_clone(): freeing minor %d of dev %d for pid %u dos2unixtime(): month value out of range (%ld) denodedeget(): pcbmap returned %d detrunc(): can't truncate root directory, clust %ld, offset %ld deextend: file too largeextendfile(): attempt to extend root directory extendfile: pcbmapmsdosfs_lookup. .. doscheckpath(): .. not a directory? RRaArrAamsdosfs_sync: rofs mod dev %d, %d, %s msdosfs_createmsdosfs_write(): bad file typemsdosfs_renamemsdosfs_rename: lost to startdirmsdosfs_rename: lost from startdirmsdosfs_rename: updating .. in root directory?msdosfs_mkdirmsdosfs_readdir.msdosfs_strategy: spectag VT_MSDOSFS, startcluster %ld, dircluster %ld, diroffset %ld (LOCKED)bpf_detachd: descriptor not in listbpf: ifpromisc failedbpfbpfwritebpf_mcopybpfattachtoo many interfacesif_attachhead: mallocif_attach: mallocif_clone_listifioctlifconfif_getgroupif_getgroupmembersegressif_group_egress_buildifpromisc%s: can't handle af%d lo%dlooutput: no header mbufifmedia_add: can't malloc entryifmedia_set: no match for 0x%x/0x%x ifmedia_set failedfile errorstream errordata errorinsufficient memorybuffer errorunknown compression methodinvalid window sizeinvalid reserved bitincorrect header checkincorrect data checkinvalid block typeinvalid stored block lengthsinvalid bit length repeattoo many length or distance symbolsincomplete dynamic bit lengths treeoversubscribed dynamic bit lengths treeoversubscribed literal/length treeincomplete literal/length treeinvalid literal/length codeinvalid distance code0.95Pstream endrn_addmask: mask impossibly already in tree Mask for route not entered Non-unique normal route, mask not entered rn_delete: inconsistent annotation rn_delete: couldn't find our annotation rn_delete: couldn't find us %s %p at %p rn_delete: Orphaned Maskrn_init: radix functions require max_keylen be set rn_initrn_init 2raw_usrreqrtentplroute_init rtable_addrtfreertfree: %p not freed (neg refs) rtfree 2ifafreertrequest deletertinit: wrong ifa (%p) was (%p) rttmrplrt_timer_init: already initializedrt_timer_queue_destroy: rtq_count reached 0 rt_timer_remove_all: rtq_count reached 0 rt_timer_add: rtq_count reached 0 rt_timer_timer: rtq_count reached 0 route_outputsysctl_dumpentryroute%s: bad channel ignored; freq %u flags %x number %u %s: invalid channel freq %u flags %x %s: invalid channel (NULL) ieee80211_media_initUnexpected mode %uBad IBSS channel %u ieee80211_wep_crypt%s: %sassociation failed (reason %d) for %s %s: station %s deauthenticated by peer (reason %d) %s: station %s disassociated by peer (reason %d) %s: received %s from %s rssi %d %s: got power save probe from %s %s: power save mode off for %s %s: power save mode on for %s null mode%s: open authentication failed (reason %d) for %s newly%s: station %s %s authenticated (open) %s: station %s sent bogus aid %x %s: station %s aid %x doesn't match pspoll aid %x %s: enqueued power saving packet for station %s %s: station %s sent pspoll, but no packets are saved %s: station %s sent bogus power save poll ieee80211_ibss_merge%s: rates mismatch, BSSID %s %s: sync BSSID %s -> (from %s) %s: ieee80211_ibss_merge: bssid mismatch %s %s: my tsft %llu beacon tsft %llu %s: sync TSF with %s -%s: tsft offset %s%llu ieee80211_ioctl80211scan%s: no memory for AID bitmap! unable to setup inital BSS node%s: begin %s scan passiveactive%s: creating ibss %s: end %s scan ieee80211_end_scanieee80211_find_nodefreeing bss nodenot in ap mode, mode %u%s: failed to queue raw tx frame %s: sending %s to %s on channel %u null node%s: no node for dst %s, discard raw tx frame %s: npkt %d firstlen %d lastlen0 %d lastlen %d fraglen %d overlen %d len %d rate %d flags %08x 802.11 packet too large: %u%s: station %s deauthenticate (reason %d) %s: station %s disassociate (reason %d) %s: station %s power save queue overflow of size %d drops %d %s preamble %s slot time%s %s: bogus xmit rate %u setup assoc_reqassoc_respreassoc_reqreassoc_respprobe_reqprobe_respreserved#6reserved#7beaconatimdisassocdeauthreserved#13reserved#14reserved#15INITSCANAUTHASSOCRUN0x"NODS %s->%s(%s) type#%d %dM +%d WEP dataTODS %sFRDS %sDSDS %s(%s->%s)%s: no recent beacons from %s; rescanning associatedsynchronized%s: %s with %s ssid channel %d start %uMbshortlong protection enabledAPL1APL1AAPL1_ETSICAPL1_FCCAAPL1WAPL2APL2CAPL2DAPL2_ETSICAPL2WAPL3APL3WAPL4APL4WAPL5APL5WAPLDAPLDEBUGETSI1ETSI1WETSI2ETSI2WETSI3ETSI3AETSI3W,ETSI4ETSI4CETSI4WETSI5ETSI5WETSI6ETSI6WETSIAETSIBETSICETSIEU1WFCC1FCC1AFCC1WFCC2FCC2CFCC2AFCC2WFCC3FCC3AFCCAFRANCEMKK1MKK1_FCCAMKK1AMKK1A1MKK1A2MKK1BMKK2MKK2AMKKANONEWOR01WWOR02WWOR0WWOR1WWOR2WWOR3WWOR4WWOR5_ETSICWOR9WWORAWWORLDaearazbgbhbnbrbybzcacncocrczdkdodzegf2fifofrgrgthkhnhuidiliqisj1j2j3j4j5jmjojpk2kpkrkwkzlblilvmcmkmomxmyninlnzpapkprqarusasgsisvtntttwuaukuyvnyezazwarp_rtrequest: bad gateway value arp_rtrequest: malloc failed arprequestarpresolve: can't allocate llinfo arpintrarp: attempt to add entry for %s on %s by %s on %s in_arpinputarp: attempt to overwrite entry for %s on %s by %s on %s arp info overwritten for %s by %s on %s arp: attempt to overwrite permanent entry for %s by %s on %s duplicate IP address %s sent from ethernet address %s arp: ether address is broadcast for IP address %s! arptfreearplookup: unable to enter address for %s revarprequestrevarp[NULL][ ifa_addr= ifa_dsta= ifa_mask= flags=0x%x, refcnt=%d, metric=%d la_rt=%p la_hold=%p, la_asked=0x%lx rtentry=%p flags=0x%x refcnt=%d use=%ld expire=%ld key= mask= gw= ifp=%p ifa=%p genmask= gwroute=%p llinfo=%p (NULL)Route tree for AF_INET (not initialized) in_controlinvalid argument to in_lifaddr_ioctlin_ifinitin_addmultiin_delmultiin_pcbinit: hashinit failedin_pcbinit: hashinit failed for lportinpcbplIPv6 pcb passed into in_pcbconnectinterneticmp_erroricmp lenicmp_reflecticmp_mtudisc_timeouticmp_mtudisc_timeout: bad route to timeouticmp_redirect_timeout: bad route to timeout%d.%d.%d.%dipqeplaeshmac-sha1deflateip_initip_savecontrolip_outputip_setmoptionsrip_attachrip_detachrip_usrreqtcp_inputm_pulldown malfunctiontcp_pulloutofbandsynpltcp_outputtcp_output REXMTtcpcbpltcpqepltcp_inittcp_respondtcp_ctlinputtcp6_mtudisc_callbacktcp_timer_rexmttcp_usrreqtcp_identudp_inputudp6_ctlinputudp_usrreqipip_input: should never reach hereetherip_inputMD5FinalRMD160FinalSHA1Finallibdes v 3.21 - 95/11/21 - eaycryptopcryptodesccrypto_waitcryptof_ioctlcrydevcuio_copydata: off %d < 0iov_copydata: empty in skipcuio_copydata: emptycuio_copydata: len %d < 0cuio_copyback: off %d < 0cuio_copyback: empty in skipuio_copyback: emptycuio_copyback: len %d < 0cuio_apply: len %d < 0cui_apply: ind %d >= uio_iovcnt %d for offcui_apply: ind %d >= uio_iovcnt %d for lencuio_apply: off %d < 0swcr_encdecswcr_authcomputeSoftware crypto device cannot initialize!DES3DESBlowfishCAST-128SkipjackRijndael-128/AESAES-CTRARC4HMAC-MD5HMAC-SHA1HMAC-RIPEMD-160HMAC-SHA2-256HMAC-SHA2-384HMAC-SHA2-512Keyed MD5Keyed SHA1MD5SHA1DeflateLZSaes_ctr_cryptmichael_finalfile system fulluid %u on %s: %s %s: write failed, file system is full ffs_realloccg: bad blockno%s: optimization changed from SPACE to TIME dev = 0x%x, optim = %d, fs = %s ffs_realloccg: bad optim%s: optimization changed from TIME to SPACE dev = 0x%x, bsize = %d, bprev = %d, fs = %s ffs_realloccg: bad bprevmode = 0%o, inum = %d, fs = %s ffs_valloc: dup allocfree inode %s/%d had %d blocks out of inodes %s: create/symlink failed, no inodes free ffs_clusteralloc: lost blockffs_nodealloccg: block not in mapcg = %d, irotor = %d, fs = %s ffs_nodealloccg: map corrupteddev = 0x%x, bsize = %d, size = %ld, fs = %s ffs_blkfree: bad sizebad block %d, ino %u bad blockdev = 0x%x, block = %d, fs = %s ffs_blkfree: freeing free fragffs_blkfree: freeing free blockdev = 0x%x, ino = %u, fs = %s ffs_freefile: range: dev = 0x%x, ino = %d, fs = %sffs_freefile: freeing free inodebno = %d, fs = %s ffs_alloccg: block not in mapstart = %d, len = %d, fs = %s ffs_alloccg: map corruptedffs1_balloc: blk too bigCould not unwind indirect block, error %dffs_update: bad link cntffs_truncate: newspaceffs_indirtrunc: bad buffer sizesoftdep_flushfiles calledffs_mountroot: can't setup bdevvp's ffsWARNING: %s was not properly unmounted WARNING: R/W mount of %s denied. Filesystem is not clean - run fsck WARNING: soft updates isn't compiled in ffs_reload: dirty2ffs_reload: dirty1ffs_mountfs(): obsolete rotational table format, please use fsck_ffs(8) -c 1 ffs_mountfs(): Sorry, no UFS2 support (yet) ffs_statfsupdate: rofs modffsinodino1pl%s: typeffs_write%s: nonsync dir writeffs_fsyncffs_fsync: not dirtyi_ffs_size too smallmangled entry%s: bad dir ino %d at offset %d: %s bad dirFirst bad Second bad ufs_direnter: newblkufs_direnter: compact1ufs_direnter: compact2checkpath: .. not a directory chown: lost quotaufs_linkufs_renameufs_rename: lost to startdirrename: EXDEVufs_rename: same fileufs_rename: lost dir entryufs_rename: lost from startdirufs_mkdirufs_readdir: lost in spaceufs_strategy: specufs_makeinodemode = 0%o, nlinks %d, inum = %d, fs = %s ext2fs_valloc: dup allocext2fs_nodealloccg: block not in mapcg = %d, ipref = %d, fs = %s ext2fs_nodealloccg: map corruptedbad block %d, ino %d dev = 0x%x, ino = %d, fs = %s ifree: range: dev = 0x%x, ino = %d, fs = %sifree: freeing free inodeext2fs_mapsearch: block not in mapext2fs_alloccg: map corrupteduid %d on %s: %s ext2fs_indirtrunc: bad buffer sizeext2fs_readdiri_size too smallrec_len is smaller than minimalrec_len % 4 != 0reclen is too small for name_lendirectory entry across blocksinode out of boundsbad directory entry: %s offset=%d, inode=%lu, rec_len=%d, name_len=%d ext2fs_dirbadentryext2fs_direnter: newblkext2fs_direnterext2fs_direnter: frag sizecheckpathext2fs_writeext2inoplext2dinoplext2fs_mountroot: can't setup bdevvp'sext2fs%s: file system not clean; please fsck(8) ext2fs_reload: dirty2ext2fs_reload: dirty1ext2fs_statfsExt2 fs: unsupported inode size Ext2 fs: unsupported optional feature ext2fs_rename: lost to startdirrename: linked directoryext2fs_rename: lost dir entryext2fs_rename: mangled dirext2fs_rename: lost from startdirext2fs_mkdir: blksizeamap_lookup: offset out of rangeamap_lookups: offset out of rangeamap_add: offset out of rangeamap_add: replacing null anonamap_add: slot in useamap_unadd: offset out of rangeamap_unadd: nothing thereamapplamap_wipeout: corrupt amapcownowpagecownowamap_cow_now: non-resident wired page in anon %pamap_splitref: split at zero offsetamap_splitref: map size check failedamap_pp_adjref: overshot targetamap_pp_adjref: negative reference countuvm_anon_add: can not allocate %d anons uvm_anon_adduao_set_swslot: uobj = %p uao_set_swslot: attempt to set a slot on a NOSWAP objectuao_create: kernel object already allocateduao_create: hashinit swhash faileduao_create: malloc swslots faileduao_create: asked to enable swap on kernel objectuaoeltplaobjpluao_flush: strange, got an out of range flush (fixed) uao_flush: weird flagsuao_getuao_getpageudv_attachudv_detachudv_faultfltamapcopyanonget1anonget2flt_noram1flt_pmfail1flt_noram3flt_noram2flt_pmfail2flt_noram4flt_noram5fltagain2uvm_fault_unwire_locked: address not in mapuvm_fork: uvm_fault_wire failed: %duvm_swapin: uvm_fault_wire failed: %dschedpwaitscheduleruvm_init: page size not setuvm_km_init: could not reserve space for kerneluvm_km_suballoc: unable to allocate space in parent mapuvm_km_suballoc: submap allocation faileduvm_km_suballoc: unable to create submapkm_getwait2km_allockm_alloc1wuvm_km_alloc1: non-released pagevallocwaitkmthreadkmallocvmmaplkuvm_mapent_alloc: out of static map entries uvm_mapent_alloc: cannot allocate map entry# uvm_map() successful calls# uvm_map() back merges# uvm_map() missed forward# map lookup calls# map lookup hint hitsvmspplvmmpeplvmmpekpluvm_map_clean: weird flagsfork: encountered a submap during fork (illegal)fork: non-copy_on_write map entry marked needs_copy (illegal)MAP %p: [0x%lx->0x%lx] #ent=%d, sz=%u, ref=%d, version=%u, flags=0x%x pmap=%p(resident=%d) - %p: 0x%lx->0x%lx: obj=%p/0x%llx, amap=%p/%d submap=%c, cow=%c, nc=%c, prot(max)=%d/%d, inh=%d, wc=%d, adv=%d OBJECT %p: locked=%d, pgops=%p, npages=%d, refs= PAGES : <%p,0x%llx> refs=%d PAGE %p: %b flags=%s, pqflags=%s, vers=%d, wire_count=%d, pa=0x%llx uobject=%p, uanon=%p, offset=0x%llx loan_count=%d [page ownership tracking disabled] >>> ANON DOES NOT POINT HERE <<< (%p) checking pageq list >>> PAGE NOT FOUND ON PAGEQ LIST! <<< uvm_page_printit page found on pageq list anon backpointer is OK checking object list >>> PAGE NOT FOUND ON OBJECT LIST! <<< page found on object list uvm_page_bootstrap: no memory pre-allocateduvm_page_init: lost %ld page(s) in init uvm_page_inituvm_setpagesize: page size not a power of twouvm_pageboot_alloc: out of virtual spaceuvm_pageboot_alloc: out of memoryuvm_pageboot_alloc: pmap_growkernel() faileduvm_page_physget: called _after_ bootstrapuvm_page_physget: out of memory!uvm_page_physload: page size not set!uvm_page_physload: start >= enduvm_page_physload: tried to add RAM after vm_mem_inituvm_page_physload: unable to load physical memory segment %d segments allocated, ignoring 0x%llx -> 0x%llx increase VM_PHYSSEG_MAX uvm_page_physload: bad free list %duvm_page_physrehash: WARNING: could not grow page hash table rehash: physical memory config [segs=%d of %d]: 0x%llx->0x%llx [0x%llx->0x%llx] STRATEGY = RANDOM number of buckets = %d uvm_pagealloc_strat: bad strat %demergvapager_mappagedaemon: deadlock detected! pgdaemon%s = %d Current UVM status: pagesize=%d (0x%x), pagemask=0x%x, pageshift=%d %d VM pages: %d active, %d inactive, %d wired, %d free min %d%% (%d) anon, %d%% (%d) vnode, %d%% (%d) vtext pages %d anon, %d vnode, %d vtext freemin=%d, free-target=%d, inactive-target=%d, wired-max=%d faults=%d, traps=%d, intrs=%d, ctxswitch=%d softint=%d, syscalls=%d, swapins=%d, swapouts=%d, kmapent=%d fault counts: noram=%d, noanon=%d, pgwait=%d, pgrele=%d ok relocks(total)=%d(%d), anget(retries)=%d(%d), amapcopy=%d neighbor anon/obj pg=%d/%d, gets(lock/unlock)=%d/%d cases: anon=%d, anoncow=%d, obj=%d, prcopy=%d, przero=%d daemon and swap counts: woke=%d, revs=%d, scans=%d, obscans=%d, anscans=%d busy=%d, freed=%d, reactivate=%d, deactivate=%d pageouts=%d, pending=%d, nswget=%d nswapdev=%d, nanon=%d, nanonneeded=%d nfreeanon=%d swpages=%d, swpginuse=%d, swpgonly=%d paging=%d kernel pointers: objs(kern/kmem)=%p/%p swapsysuvm_swap_init: can't get vnode for swap deviceswapmapswp vnxswp vnduvm_swap_init: extent_create failedswapdrum_addsys_swapctlswapctl: copystrswapctl: miniroot copy failedswap0x%04xswap_on: miniroot larger than swap?Preserved %d pages of miniroot leaving %d pages of swap swap_on: unable to preserve minirootdisklabel regionswap_off: swapdev not in listswstrategy: vnode type 0x%xsw_reg_strategy: swap to sparse filewarning: resource shortage: %d pages of swap lost swapmount: no device swapmount: no device 2 swap_deviceswapmount: copystrsbrk: grow %ld failed, error = %d uvm_coredump: user process with submap?uvm_deallocate with null mapuvnsyncuvn_attach: blocked at %p flags 0x%x uvn_attachuvn_termuvm_vnp_terminate: io sync wanted bit setuvn_releasepg: kill flag set on referenced object!uvn_flush: obj=%p, offset=0x%llx. error during pageout. uvn_flush: WARNING: changes to page may be lost! uvn_flushuvn_cluster: offset out of rangeuvn_getuvn_getpageuvn_iosyncrd%d: fixed, %d blocks NULL pointer passed to ip_ecn_ingressNULL pointer passed to ip_ecn_egressNULL pointer passed to ip6_ecn_ingressNULL pointer passed to ip6_ecn_egressin6_pcbconnectin6_pcbnotifyin6_ifloop_requestADDDELETEin6_ifloop_request: %s operation failed for %s (errno=%d) in6_controlnd6_prelist_add succeeded but no prefix prefix ioctls are now invalidated. please use ifconfig. in6_update_ifain6_update_ifa: addmulti failed for %s on %s (errno=%d) in6_update_ifa: failed to remove a route to the old destination: %s in6_update_ifa: the prefix length of an existing (%s) address should not be changed in6_update_ifa: valid lifetime is 0 for %s in6_update_ifa: prefixlen should be 128 when dstaddr is specified in6_update_ifa: a destination can be specified for a p2p or a loopback IF only in6_purgeaddr: failed to remove a route to the p2p destination: %s on %s, errno=%d Couldn't unlink in6_ifaddr from in6_ifaddr in6_unlink_ifa: autoconf'ed address %p has no prefix invalid argument to in6_lifaddr_ioctlin6_savemkludge: no kludge spacein6_addmultiin6_delmultiin6_are_prefix_equal: invalid prefix length(%d) in6_prefixlen2mask: invalid prefix length(%d) in6_prefixlen2maskin6_ifawithscope: output interface is not specified get_rand_ifid%s: interface identifier generated by random number %s: ifid: %02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x %s: failed to get interface identifier %s: borrow interface identifier from %s %s: got interface identifier from %s %s: got interface identifier from itself in6_ifattach_linklocalin6_ifattach_linklocal: failed to configure a link-local address on %s (errno=%d) %s: no ifid available in6_ifattach_loopbackin6_ifattach_loopback: failed to configure the loopback address on %s (errno=%d) in6_nigroupin6_ifattach: %s has too small MTU, IPv6 not enabled in6_ifattachin6_ifattach: %s is not multicast capable, IPv6 not enabled in6_ifdetach%s: didn't unlink in6ifaddr from list in6_cksum: mbuf len (%d) < off+len (%d+%d)in6_cksum: out of datainternet6icmp6_mtudisc_callback_registerENOBUFS in icmp6_error %d icmp6_input: unknown type %d(src=%s, dst=%s, ifid=%d) ICMP6 checksum error(%d|%x) %s icmp6_notify_erroricmp6_notify_error: in6_embedscope failed icmp6_mtudisc_updateni6_inputicmp6_rip6_inputicmp6_reflecticmp6_reflect: source can't be determined: dst=%s, error=%d /usr/src/sys/netinet6/icmp6.csanity fail: off=%lx, sizeof(ip6)=%lx in %s:%d (src=%s dst=%s tgt=%s)icmp6_redirect_inputICMP6 redirect sent from %s rejected; must be from linklocal ICMP6 redirect sent from %s rejected; hlim=%d (must be 255) ICMP6 redirect rejected; no route with inet6 gateway found for redirect dst: %s ICMP6 redirect rejected; neither router case nor onlink case: %s icmp6_redirect_input: lladdrlen mismatch for %s (if %d, icmp6 packet %d): %s icmp6_redirect_input: invalid ND option, rejected: %s ICMP6 redirect rejected; redirect dst must be unicast: %s ICMP6 redirect rejected; not equal to gw-for-src=%s (must be same): %s ICMP6 redirect rejected; no route found for redirect dst: %s icmp6_redirect_outputicmp6_mtudisc_timeout: bad route to timeouticmp6_redirect_timeout: bad route to timeoutip6_initip6_input: packet to an unready address %s->%s ip6_savecontrolip6_nexthdrip6_nexthdr: m == NULLOpenBSD-currentcannot forward from %s to %s nxt %d received on %s cannot forward src %s, dst %s, nxt %d, rcvif %s, outif %s ip6_outputassumption failed: hdr not splitip6_setmoptionsip6_setpktoptionsip6_rthdr0nd6_init called more than once(ignored) nd6_setmtu0: new link MTU on %s (%lu) is too small for IPv6 ndopts == NULL in nd6_optionuninitialized ndopts in nd6_optionndopts == NULL in nd6_optionsduplicated ND6 option found (type=%d) too many loop in nd opt nd6_options: unsupported option %d - option ignored uninitialized ndopts in nd6_optionsln->ln_rt == NULLln->ln_rt->rt_ifp == NULLrt_llinfo(%p) is not equal to ln(%p)dst=0 in nd6_timer(ln=%p)nd6_lookupunspecnd6_lookup: failed to lookup %s (if = %s) nd6_freend6_rtrequestnd6_rtrequest: bad gateway value: %s %s: failed to join %s (errno=%d) nd6_rtrequest: malloc failed nd6_ioctla router(%s) advertises a prefix with non-link local address default router list contains a non-linklocal address(%s) ifp == NULL in nd6_cache_lladdrfrom == NULL in nd6_cache_lladdrnd6_output: can't allocate llinfo for %s (ln=%p, rt=%p) nd6_storelladdr: something odd happens nd6_storelladdr: sdl_alen == 0, dst=%s, if=%s scope error in prefix list (%s) nd6_ns_inputnd6_ns_input: src=%s nd6_ns_input: dst=%s nd6_ns_input: tgt=%s nd6_ns_input: invalid hlim (%d) from %s to %s on %s nd6_ns_input: bad DAD packet (wrong ip6 dst) nd6_ns_input: lladdrlen mismatch for %s (if %d, NS packet %d) nd6_ns_input: duplicate IP6 address %s nd6_ns_input: bad DAD packet (link-layer address option) nd6_ns_input: invalid ND option, ignored nd6_ns_input: bad NS target (multicast) nd6_ns_outputnd6_ns_output: source can't be determined: dst=%s, error=%d nd6_na_inputnd6_na_input: invalid hlim (%d) from %s to %s on %s nd6_na_input: duplicate IP6 address %s nd6_na_input: lladdrlen mismatch for %s (if %d, NA packet %d) nd6_na_input: invalid ND option, ignored nd6_na_input: a solicited adv is multicasted nd6_na_input: invalid target address %s nd6_na_outputnd6_na_output: source can't be determined: dst=%s, error=%d %s: starting DAD for %s nd6_dad_start: memory allocation failed for %s(%s) ???nd6_dad_start: called with non-tentative address %s(%s) nd6_dad_start: ifa->ifa_ifp == NULLnd6_dad_timer: called with null parameter %s: DAD complete for %s - no duplicates found %s: could not run DAD, driver problem? nd6_dad_timer: called with non-tentative address %s(%s) nd6_dad_timer: called with duplicated address %s(%s) nd6_dad_timer: DAD structure not found nd6_dad_duplicated: DAD structure not found %s: DAD detected duplicate IPv6 address %s: NS in/out=%d/%d, NA in=%d %s: DAD complete for %s - duplicate found %s: manual intervention required nd6_dad_ns_input: ignoring DAD NS packet for address %s(%s) ifa == NULL in nd6_dad_ns_inputifa == NULL in nd6_dad_na_inputnd6_rs_inputnd6_rs_input: invalid hlim (%d) from %s to %s on %s nd6_rs_input: lladdrlen mismatch for %s (if %d, RS packet %d) nd6_rs_input: invalid ND option, ignored nd6_ra_inputnd6_ra_input: invalid hlim (%d) from %s to %s on %s nd6_ra_input: src %s is not link-local nd6_ra_input: lladdrlen mismatch for %s (if %d, RA packet %d) nd6_ra_input: bogus mtu mtu=%lu sent from %s; exceeds maxmtu %lu, ignoring nd6_ra_input: bogus mtu option mtu=%lu sent from %s, ignoring nd6_ra_input: invalid option len %d for prefix information option, ignored nd6_ra_input: invalid prefix len %d for prefix information option, ignored nd6_ra_input: invalid prefixlen %d for rfc2374 prefix %s, ignored nd6_ra_input: invalid prefix %s, ignored nd6_ra_input: invalid ND option, ignored defrouter_addreqdefrouter_delreqdefrouter_select: called unexpectedly (forwarding=%d, accept_rtadv=%d) defrouter_select: more than one router is installed nd6_prelist_add: failed to make the prefix %s/%d on-link on %s (errno=%d) prelist_remove: failed to make %s/%d offlink on %s, errno=%d prelist_update: failed to make the prefix %s/%d on-link on %s (errno=%d) prelist_update: nd6_prelist_add failed for %s/%d on %s errno=%d, returnpr=%p pfxlist_onlink_check: failed to make %s/%d offlink, errno=%d nd6_prefix_onlinknd6_prefix_onlink: failed to add route for a prefix (%s/%d) on %s, gw=%s, mask=%s, flags=%lx errno = %d nd6_prefix_onlink: failed to find any ifaddr to add route for a prefix(%s/%d) on %s nd6_prefix_onlink: %s/%d is already on-link nd6_prefix_offlinknd6_prefix_offlink: failed to recover a prefix %s/%d from %s to %s (errno = %d) nd6_prefix_offlink: failed to delete route: %s/%d on %s (errno = %d) nd6_prefix_offlink: %s/%d is already off-link in6_ifaddin6_ifadd: failed to make ifaddr %s on %s (errno=%d) in6_ifadd: wrong prefixlen for %s (prefix=%d ifid=%d) in6_init_prefix_ltimes: preferred lifetime(%d) is greater than valid lifetime(%d) rip6_inputrip6_outputrip6_attachrip6_usrreqrip6_detachudp6_outputspsrr1r2r3r4r5r6r7r8r9r10r11r12usr_spusr_lrsvc_spsvc_lrpcund_spabt_spirq_spFaulted in DDB; continuing... address %p is invalid address 0x%08lx not a valid page framedb_fetch_reg: botchbranch_taken: botchscp=0x%08x rlv=0x%08x ( rsp=0x%08x rfp=0x%08xBad frame pointer: %p Bad user frame pointer: %p %sr%d=0x%08xtrace: pid %d not found swapped out at %p frame address = %08x frame address must be specified spsr=%08x r0 =%08x r1 =%08x r2 =%08x r3 =%08x r4 =%08x r5 =%08x r6 =%08x r7 =%08x r8 =%08x r9 =%08x r10=%08x r11=%08x r12=%08x r13=%08x r14=%08x r15=%08x slr=%08x mainbusmainbus_bs_alloc(): Help!mainbus_bs_free(): Help!cpu%s, #0x%03ximbimbrangeswiblxblmulSnmsmlaSnmsdumullSdnmssmullumlalsmlalstrtdaWldrtstrbtldrbtstrldrstrbldrbstmYnWlldmXnWlldrsbldrhstrhldrshswpdmoswpbmrsdpmsrpFmpF2bxclzdmbkptSdn2eorsubrsbadcsbcrsctstDn2teqcmpcmnorrmovSd2bicmvnadfPRfghmufsufrsfdvfrdfpowrpwrmffmlfdvfrdpolfpbopmvfPRfhmnfrndsqtlgnexpsincostanasnacsatnfpuopstfQLvldffltPRgdfixPRdhwfsrfswfcrfccmfPRghcnfcmfecnfemcr2#zmcrmrc2mrccdp2#ycdpldc2L#vldcstc2stcund%s %08x %s%s#0x%08xp%d_f%d#%s[r%d]cpsr[%c - unknown]%d, c%d, c%d, c%d, %dr%d, c%d, c%d, %d, rrx, %s r%d, %s #%d{r%d-r%d}^[r%d#0x%02xf%d, c%d, No support for this CPU type (%08x) in kernelcpu.branchpredictcpu.cachecpu.nocachexscale.branchpredictxscale.cachexscale.icachexscale.dcacheUndefined instruction in kernel WARNING: not updating battery clock Warning IRQ's disabled during boot() real mem = %u (%uK) %uMB cpu_startup: system table size inconsistencycpu_startup: cannot allocate UVM space for buffersavail mem = %lu (%uK) using %d buffers containing %u bytes (%uK) of memory cpu_startup: not enough memory for buffer cachecpu_startup: no room for system tables; %d bytes required_bus_dmamap_load_raw: not implemented_bus_dmamap_sync: mix PRE and POSTunknown buffer type %d _bus_dmamap_sync_bus_dmamap_sync: ARM32_BUFTYPE_INVALID_bus_dmamap_sync: ARM32_BUFTYPE_RAW_bus_dmamem_map: size botch%s: SA-110 with bugged STM^ instruction rev 0rev 1rev 2rev 3rev 4rev 5rev 6rev 7rev 8rev 9rev 10rev 11rev 12rev 13rev 14rev 15step Jstep Kstep Sstep Tstep Bstep Cstep Dstep Erev 10step Gstep A-0step B-0step B-1step B-2step B-3step B-4step B-5(IXP1200 step A)(IXP1200 step B)(IXP1200 step C)(IXP1200 step D)(IXP1240/1250 step A)(IXP1240 step B)(IXP1250 step B)step A-1step C-0step D-0step ?step C-5step 0ARM600ARM610ARM620ARM700ARM710ARM7500ARM710aARM7500FEARM710TARM720TARM740T (8 KB cache)ARM740T (4 KB cache)ARM810ARM920TARM922TARM940TARM946E-SARM966E-STI ARM925TARM1020EARM1022E-SSA-110SA-1100SA-1110IXP1200i80200i80321 400MHzi80321 600MHzi80219 400MHzi80219 600MHzPXA250PXA210PXA27xIXP425 533MHzIXP425 400MHzIXP425 266MHzCPU_ARM2ARM2asCPU_ARM250CPU_ARM3CPU_ARM6CPU_ARM7CPU_ARM7TDMICPU_ARM8ARM9TDMIARM9E-SARM10ECPU_ARM10SA-1CPU_SA110XScaleCPU_XSCALE_...wr-thruwr-back**unknown 3****unknown 4**wr-back-lockwr-back-lock-Awr-back-lock-B**unknown 8****unknown 9****unknown 10****unknown 11****unknown 12****unknown 13****unknown 14****unknown 15** IDC disabled IDC enabled WB disabled WB enabled LABT EABT%s: %dKB/%dB %d-way %s unified cache %s: %s does not fully support this CPU. %s: This kernel does not fully support this CPU. %s: Recompile with "options %s" to correct this. %s: %dKB(%db/l,%dway) I-cache, %dKB(%db/l,%dway) %s D-cache branch prediction enabled DC disabled DC enabled IC disabled IC enabledunknown CPU (ID = 0x%x)%s %s (%s core)Processor failed probe - no CPU ID Vector ExceptionAlignment Fault 1Terminal ExceptionAlignment Fault 3External Linefetch Abort (S)Translation Fault (S)External Linefetch Abort (P)Translation Fault (P)External Non-Linefetch Abort (S)Domain Fault (S)External Non-Linefetch Abort (P)Domain Fault (P)External Translation Abort (L1)Permission Fault (S)External Translation Abort (L2)Permission Fault (P) uvm_fault(%p, %lx, %x, 0) -> %x UVM: pid %d (%s), uid %d killed: out of swap Non-emulated page fault with intr_depth > 0 data_abort_fault: Misaligned Kernel-mode Program Counter kerneluserFatal %s mode data abort: '%s' trapframe: %p FSR=%08x, FAR=r0 =%08x, r1 =%08x, r2 =%08x, r3 =%08x r4 =%08x, r5 =%08x, r6 =%08x, r7 =%08x r8 =%08x, r9 =%08x, r10=%08x, r11=%08x r12=%08x, usp=%08x, ulr=%08xssp=%08x, slr=%08x, pc =%08x Fatal abortInvalid, Fatal %s mode prefetch abort at 0x%08x trapframe: %p, spsr=%08x badaddr: invalid size (%lu)mmrwpmap_enter: no pv entriespmap_enter: failed to allocate L2 bucketpmap_init_l1: can't get PA of L1 at %ppmapplpvepll2dtblpll2ptpplpmap_bootstrap: WARNING! wrong cache mode for primary L1 @ 0x%lx pmap_bootstrap: WARNING! wrong cache mode for L2 pte @ %p pmap_bootstrap: No L2 for va 0x%x, pa 0x%lxpmap_bootstrap: out of static L2spmap_bootstrap: No L2 for L2 @ va %ppmap_alloc_specials: no l2b for 0x%lxCannot allocate L1 KVMCannot allocate L1 physical pagespmap_map_entry: no L2 table for VA 0x%08lxpmap_map_entry: can't find L2 table for VA 0x%08lxpmap_map_chunk: no L2 table for VA 0x%08lxpmap_map_chunk: can't find L2 table for VA0x%08lxpmap_map_chunk: no L1 table providedxscale_setup_minidata: can't find L2 table for VA 0x%08lxuser pmap (%p): pmap_kernel (%p): domain %d, l1 at %p %08lx: %c |0000 |8000 |10000 |18000 |20000 |28000 |30000 |38000 pa 0x%08lx: krw %d kro %d urw %d uro %d %c va 0x%08lx, flags 0x%x dumpconf: bad dumpdev=0x%x dumping to dev %u,%u offset %ld dump device bad aborted from console i/o error device not ready succeeded area improper area unavailable dump to dev %u,%u not possible pagemove: size=%08lxvmapbufvunmapbufrebooting... The operating system has halted. Please press any key to reboot. WARNING: powerdown failed! cpu not recognized! OpenBSD/armish booting ... initarm: Configuring system ... physmemory: %d pages at 0x%08lx -> 0x%08lx initarm: Failed to align the kernel page directorykernelsize text %x total %x end %xesym %x physical_freestart %x end %x initarm: out of memoryunknown option `%c' can't init serial console @%lxwdsduse one of: reboot %s[a-p]parsediskrootconf: device name too longboot device: lookup '%s' failed. root device (default %s%c)swap device can't figure root, hope your kernel is right rootconfroot on %s%c boot device not knownboot device: %s. invalid geometrydos partition I/O errordisk label I/O errorno disk labeldisk label corrupted%sCheck Condition (error %#x) on opcode 0x%x AT BLOCK #: %d (decimal) SENSE KEY: %s off INFO: 0x%x (VALID flag %s) SKSV: %s FRU CODE: 0x%x ASC/ASCQ: %s COMMAND INFO: 0x%x %c Incorrect Length Indicator Set%c EOM Detected%c Filemark Detectedscxsplgetxscannot allocate scsi xs only the first 4,294,967,295 sectors will be used. scsicmdscsi_execute_xs: invalid return code (%#x)unknown error category (0x%x) from scsi driver scbusyprobe%s(%s:%d:%d): No Additional SenseSoft ErrorNot ReadyMedia ErrorHardware ErrorIllegal RequestUnit AttentionWrite ProtectedBlank CheckVendor UniqueCopy AbortedAborted CommandEqual ErrorVolume OverflowMiscompare ErrorReservedNo Additional Sense InformationFilemark DetectedEnd-Of-Partition/Medium DetectedSetmark DetectedBeginning-Of-Partition/Medium DetectedEnd-Of-Data DetectedI/O Process TerminatedAudio Play Operation In ProgressAudio Play Operation PausedAudio Play Operation Successfully CompletedAudio Play Operation Stopped Due to ErrorNo Current Audio Status To ReturnCleaning RequestedErase Operation In ProgressLocate Operation In ProgressRewind Operation In ProgressSet Capacity Operation In ProgressVerify Operation In ProgressNo Index/Sector SignalNo Seek CompletePeripheral Device Write FaultNo Write CurrentExcessive Write ErrorsLogical Unit Not Ready, Cause Not ReportableLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Initialization Command RequiredLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Format In ProgressLogical Unit Not Ready, Rebuild In ProgressLogical Unit Not Ready, Recalculation In ProgressLogical Unit Not Ready, Operation In ProgressLogical Unit Not Ready, Long Write In ProgressLogical Unit Not Ready, Self-Test In ProgressLogical Unit Not Accessible, Asymmetric Access State TransitionLogical Unit Not Accessible, Target Port In Standby StateLogical Unit Not Accessible, Target Port In Unavailable StateLogical Unit Not Ready, Auxiliary Memory Not AccessibleLogical Unit Not Ready, Notify (Enable Spinup) RequiredLogical Unit Does Not Respond To SelectionNo Reference Position FoundMultiple Peripheral Devices SelectedLogical Unit Communication FailureLogical Unit Communication TimeoutLogical Unit Communication Parity ErrorLogical Unit Communication CRC Error (ULTRA-DMA/32)Unreachable Copy TargetTrack Following ErrorTracking Servo FailureFocus Servo FailureSpindle Servo FailureHead Select FaultError Log OverflowWarningWarning - Specified Temperature ExceededWarning - Enclosure DegradedWrite ErrorWrite Error Recovered with Auto ReallocationWrite Error - Auto Reallocate FailedWrite Error - Recommend ReassignmentCompression Check Miscompare ErrorData Expansion Occurred During CompressionBlock Not CompressibleWrite Error - Recovery NeededWrite Error - Recovery FailedWrite Error - Loss Of StreamingWrite Error - Padding Blocks AddedAuxiliary Memory Write ErrorWrite Error - Unexpected Unsolicited DataWrite Error - Not Enough Unsolicited DataError Detected By Third Party Temporary InitiatorThird Party Device FailureCopy Target Device Not ReachableIncorrect Copy Target Device TypeCopy Target Device Data UnderrunCopy Target Device Data OverrunInvalid Information UnitInformation Unit Too ShortInformation Unit Too LongID CRC Or ECC ErrorUnrecovered Read ErrorRead Retries ExhaustedError Too Long To CorrectMultiple Read ErrorsUnrecovered Read Error - Auto Reallocate FailedL-EC Uncorrectable ErrorCIRC Unrecovered ErrorData Resynchronization ErrorIncomplete Block ReadNo Gap FoundMiscorrected ErrorUncorrected Read Error - Recommend ReassignmentUncorrected Read Error - Recommend Rewrite The DataDe-Compression CRC ErrorCannot Decompress Using Declared AlgorithmError Reading UPC/EAN NumberError Reading ISRC NumberRead Error - Loss Of StreamingAuxiliary Memory Read ErrorRead Error - Failed Retransmission RequestAddress Mark Not Found for ID FieldAddress Mark Not Found for Data FieldRecorded Entity Not FoundRecord Not FoundFilemark or Setmark Not FoundEnd-Of-Data Not FoundBlock Sequence ErrorRecord Not Found - Recommend ReassignmentRecord Not Found - Data Auto-ReallocatedLocate Operation FailureRandom Positioning ErrorMechanical Positioning ErrorPositioning Error Detected By Read of MediumData Synchronization Mark ErrorData Sync Error - Data RewrittenData Sync Error - Recommend RewriteData Sync Error - Data Auto-ReallocatedData Sync Error - Recommend ReassignmentRecovered Data With No Error Correction AppliedRecovered Data With RetriesRecovered Data With Positive Head OffsetRecovered Data With Negative Head OffsetRecovered Data With Retries and/or CIRC AppliedRecovered Data Using Previous Sector IDRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Recommend RewriteRecovered Data Without ECC - Data RewrittenRecovered Data With Error Correction AppliedRecovered Data With Error Correction & Retries AppliedRecovered Data - Data Auto-ReallocatedRecovered Data With CIRCRecovered Data With L-ECRecovered Data - Recommend ReassignmentRecovered Data - Recommend RewriteRecovered Data With ECC - Data RewrittenRecovered Data With LinkingDefect List ErrorDefect List Not AvailableDefect List Error in Primary ListDefect List Error in Grown ListParameter List Length ErrorSynchronous Data Transfer ErrorPrimary Defect List Not FoundGrown Defect List Not FoundMiscompare During Verify OperationRecovered ID with ECCPartial Defect List TransferInvalid Command Operation CodeAccess Denied - Initiator Pending-EnrolledAccess Denied - No Access rightsAccess Denied - Invalid Mgmt ID KeyIllegal Command While In Write Capable StateObsoleteIllegal Command While In Explicit Address ModeIllegal Command While In Implicit Address ModeAccess Denied - Enrollment ConflictAccess Denied - Invalid LU IdentifierAccess Denied - Invalid Proxy TokenAccess Denied - ACL LUN ConflictLogical Block Address Out of RangeInvalid Element AddressInvalid Address For WriteIllegal Function (Should 20 00, 24 00, or 26 00)Illegal Field in CDBCDB Decryption ErrorSecurity Audit Value FrozenSecurity Working Key FrozenNonce Not UniqueNonce Timestamp Out Of RangeLogical Unit Not SupportedInvalid Field In Parameter ListParameter Not SupportedParameter Value InvalidThreshold Parameters Not SupportedInvalid Release Of Persistent ReservationData Decryption ErrorToo Many Target DescriptorsUnsupported Target Descriptor Type CodeToo Many Segment DescriptorsUnsupported Segment Descriptor Type CodeUnexpected Inexact SegmentInline Data Length ExceededInvalid Operation For Copy Source Or DestinationCopy Segment Granularity ViolationInvalid Parameter While Port Is EnabledHardware Write ProtectedLogical Unit Software Write ProtectedAssociated Write ProtectPersistent Write ProtectPermanent Write ProtectConditional Write ProtectNot Ready To Ready Transition (Medium May Have Changed)Import Or Export Element AccessedPower On, Reset, or Bus Device Reset OccurredPower On OccurredSCSI Bus Reset OccurredBus Device Reset Function OccurredDevice Internal ResetTransceiver Mode Changed to Single EndedTransceiver Mode Changed to LVDI_T Nexus Loss OccurredMode Parameters ChangedLog Parameters ChangedReservations PreemptedReservations ReleasedRegistrations PreemptedAsymmetric Access State ChangedImplicit Asymmetric Access State Transition FailedCopy Cannot Execute Since Host Cannot DisconnectCommand Sequence ErrorToo Many Windows SpecifiedInvalid Combination of Windows SpecifiedCurrent Program Area Is Not EmptyCurrent Program Area Is EmptyIllegal Power Condition RequestPersistent Prevent ConflictPrevious Busy StatusPrevious Task Set Full StatusPrevious Reservation Conflict StatusPartition Or Collection Contains User ObjectsOverwrite Error On Update In PlaceInsufficient Time For OperationCommands Cleared By Another InitiatorIncompatible Medium InstalledCannot Read Medium - Unknown FormatCannot Read Medium - Incompatible FormatCleaning Cartridge InstalledCannot Write Medium - Unknown FormatCannot Write Medium - Incompatible FormatCannot Format Medium - Incompatible MediumCleaning FailureCannot Write - Application Code MismatchCurrent Session Not Fixated For AppendCleaning Request RejectedMedium Not FormattedMedium Format CorruptedFormat Command FailedNo Defect Spare Location AvailableDefect List Update FailureTape Length ErrorEnclosure FailureEnclosure Services FailureUnsupported Enclosure FunctionEnclosure Services UnavailableEnclosure Services Transfer FailureEnclosure Services Transfer RefusedRibbon, Ink, or Toner FailureRounded ParameterEvent Status NotificationESN - Power Management Class EventESN - Media Class EventESN - Device Busy Class EventSaving Parameters Not SupportedMedium Not PresentMedium Not Present - Tray ClosedMedium Not Present - Tray OpenMedium Not Present - LoadableMedium Not Present - Medium Auxiliary Memory AccessibleSequential Positioning ErrorTape Position Error At Beginning-of-MediumTape Position Error At End-of-MediumTape or Electronic Vertical Forms Unit Not ReadySlew FailurePaper JamFailed To Sense Top-Of-FormFailed To Sense Bottom-Of-FormReposition ErrorRead Past End Of MediumRead Past Beginning Of MediumPosition Past End Of MediumPosition Past Beginning Of MediumMedium Destination Element FullMedium Source Element EmptyEnd Of Medium ReachedMedium Magazine Not AccessibleMedium Magazine RemovedMedium Magazine InsertedMedium Magazine LockedMedium Magazine UnlockedMechanical Positioning Or Changer ErrorInvalid Bits In IDENTIFY MessageLogical Unit Has Not Self-Configured YetLogical Unit FailureTimeout On Logical UnitLogical Unit Failed Self-TestLogical Unit Unable To Update Self-Test LogTarget Operating Conditions Have ChangedMicrocode Has ChangedChanged Operating DefinitionINQUIRY Data Has Changedcomponent Device AttachedDevice Identifier ChangedRedundancy Group Created Or ModifiedRedundancy Group DeletedSpare Created Or ModifiedSpare DeletedVolume Set Created Or ModifiedVolume Set DeletedVolume Set DeassignedVolume Set ReassignedReported LUNs Data Has ChangedEcho Buffer OverwrittenMedium LoadableMedium Auxiliary Memory AccessibleRAM FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)Power-On or Self-Test FAILURE (Should Use 40 NN)Internal Target FailureSelect Or Reselect FailureUnsuccessful Soft ResetSCSI Parity ErrorData Phase CRC Error DetectedSCSI Parity Error Detected During ST Data PhaseInformation Unit iuCRC Error DetectedAsynchronous Information Protection Error DetectedProtocol Service CRC ErrorSome Commands Cleared By iSCSI Protocol EventInitiator Detected Error Message ReceivedInvalid Message ErrorCommand Phase ErrorData Phase ErrorInvalid Target Port Transfer Tag ReceivedToo Much Write DataACK/NAK TimeoutNAK ReceivedData Offset ErrorInitiator Response TimeoutLogical Unit Failed Self-ConfigurationOverlapped Commands AttemptedWrite Append ErrorWrite Append Position ErrorPosition Error Related To TimingErase FailureErase Failure - Incomplete Erase Operation DetectedCartridge FaultMedia Load or Eject FailedUnload Tape FailureMedium Removal PreventedSCSI To Host System Interface FailureSystem Resource FailureSystem Buffer FullInsufficient Reservation ResourcesInsufficient ResourcesInsufficient Registration ResourcesInsufficient Access Control ResourcesAuxiliary Memory Out Of SpaceUnable To Recover Table-Of-ContentsGeneration Does Not ExistUpdated Block ReadOperator Request or State Change InputOperator Medium Removal RequestedOperator Selected Write ProtectOperator Selected Write PermitLog ExceptionThreshold Condition MetLog Counter At MaximumLog List Codes ExhaustedRPL Status ChangeSpindles SynchronizedSpindles Not SynchronizedFailure Prediction Threshold ExceededMedia Failure Prediction Threshold ExceededLogical Unit Failure Prediction Threshold ExceededSpare Area Exhaustion Prediction Threshold ExceededHardware Impending Failure General Hard Drive FailureHardware Impending Failure Drive Error Rate Too HighHardware Impending Failure Data Error Rate Too HighHardware Impending Failure Seek Error Rate Too HighHardware Impending Failure Too Many Block ReassignsHardware Impending Failure Access Times Too HighHardware Impending Failure Start Unit Times Too HighHardware Impending Failure Channel ParametricsHardware Impending Failure Controller DetectedHardware Impending Failure Throughput PerformanceHardware Impending Failure Seek Time PerformanceHardware Impending Failure Spin-Up Retry CountHardware Impending Failure Drive Calibration Retry CountController Impending Failure General Hard Drive FailureController Impending Failure Drive Error Rate Too HighController Impending Failure Data Error Rate Too HighController Impending Failure Seek Error Rate Too HighController Impending Failure Too Many Block ReassignsController Impending Failure Access Times Too HighController Impending Failure Start Unit Times Too HighController Impending Failure Channel ParametricsController Impending Failure Controller DetectedController Impending Failure Throughput PerformanceController Impending Failure Seek Time PerformanceController Impending Failure Spin-Up Retry CountController Impending Failure Drive Calibration Retry CountData Channel Impending Failure General Hard Drive FailureData Channel Impending Failure Drive Error Rate Too HighData Channel Impending Failure Data Error Rate Too HighData Channel Impending Failure Seek Error Rate Too HighData Channel Impending Failure Too Many Block ReassignsData Channel Impending Failure Access Times Too HighData Channel Impending Failure Start Unit Times Too HighData Channel Impending Failure Channel ParametricsData Channel Impending Failure Controller DetectedData Channel Impending Failure Throughput PerformanceData Channel Impending Failure Seek Time PerformanceData Channel Impending Failure Spin-Up Retry CountData Channel Impending Failure Drive Calibration Retry CountServo Impending Failure General Hard Drive FailureServo Impending Failure Drive Error Rate Too HighServo Impending Failure Data Error Rate Too HighServo Impending Failure Seek Error Rate Too HighServo Impending Failure Too Many Block ReassignsServo Impending Failure Access Times Too HighServo Impending Failure Start Unit Times Too HighServo Impending Failure Channel ParametricsServo Impending Failure Controller DetectedServo Impending Failure Throughput PerformanceServo Impending Failure Seek Time PerformanceServo Impending Failure Spin-Up Retry CountServo Impending Failure Drive Calibration Retry CountSpindle Impending Failure General Hard Drive FailureSpindle Impending Failure Drive Error Rate Too HighSpindle Impending Failure Data Error Rate Too HighSpindle Impending Failure Seek Error Rate Too HighSpindle Impending Failure Too Many Block ReassignsSpindle Impending Failure Access Times Too HighSpindle Impending Failure Start Unit Times Too HighSpindle Impending Failure Channel ParametricsSpindle Impending Failure Controller DetectedSpindle Impending Failure Throughput PerformanceSpindle Impending Failure Seek Time PerformanceSpindle Impending Failure Spin-Up Retry CountSpindle Impending Failure Drive Calibration Retry CountFirmware Impending Failure General Hard Drive FailureFirmware Impending Failure Drive Error Rate Too HighFirmware Impending Failure Data Error Rate Too HighFirmware Impending Failure Seek Error Rate Too HighFirmware Impending Failure Too Many Block ReassignsFirmware Impending Failure Access Times Too HighFirmware Impending Failure Start Unit Times Too HighFirmware Impending Failure Channel ParametricsFirmware Impending Failure Controller DetectedFirmware Impending Failure Throughput PerformanceFirmware Impending Failure Seek Time PerformanceFirmware Impending Failure Spin-Up Retry CountFirmware Impending Failure Drive Calibration Retry CountFailure Prediction Threshold Exceeded (false)Low Power Condition OnIdle Condition Activated By TimerStandby Condition Activated By TimerIdle Condition Activated By CommandStandby Condition Activated By CommandPower State Change To ActivePower State Change To IdlePower State Change To StandbyPower State Change To SleepPower State Change To Device ControlLamp FailureVideo Acquisition ErrorUnable To Acquire VideoOut Of FocusScan Head Positioning ErrorEnd Of User Area Encountered On This TrackPacket Does Not Fit In Available SpaceIllegal Mode For This TrackInvalid Packet SizeVoltage FaultAutomatic Document Feeder Cover UpAutomatic Document Feeder Lift UpDocument Jam In Automatic Document FeederDocument Miss Feed Automatic In Document FeederConfiguration FailureConfiguration Of Incapable Logical Units FailedAdd Logical Unit FailedModification Of Logical Unit FailedExchange Of Logical Unit FailedRemove Of Logical Unit FailedAttachment Of Logical Unit FailedCreation Of Logical Unit FailedAssign Failure OccurredMultiply Assigned Logical UnitSet Target Port Groups Command FailedLogical Unit Not ConfiguredData Loss On Logical UnitMultiple Logical Unit FailuresParity/Data MismatchInformational, Refer To LogState Change Has OccurredRedundancy Level Got BetterRedundancy Level Got WorseRebuild Failure OccurredRecalculate Failure OccurredCommand To Logical Unit FailedCopy Protection Key Exchange Failure - Authentication FailureCopy Protection Key Exchange Failure - Key Not PresentCopy Protection Key Exchange Failure - Key Not EstablishedRead Of Scrambled Sector Without AuthenticationMedia Region Code Is Mismatched To Logical Unit RegionDrive Region Must Be Permanent/Region Reset Count ErrorDecompression Exception Long Algorithm IDSession Fixation ErrorSession Fixation Error Writing Lead-InSession Fixation Error Writing Lead-OutSession Fixation Error - Incomplete Track In SessionEmpty Or Partially Written Reserved TrackNo More Track Reservations AllowedCD Control ErrorPower Calibration Area Almost FullPower Calibration Area Is FullPower Calibration Area ErrorProgram Memory Area Update FailureProgram Memory Area Is FullRMA/PMA Is Almost FullDEFERRED CDBParametersError in %s, Offset %d, bit %dProgress Indicator: %dActual Retry Count: %dASC 0x%02x ASCQ 0x%02xDiagnostic Failure on Component 0x%02xDecompression Exception Short Algorithm ID OF 0x%02xTagged Overlapped Commands (0x%02x = TASK TAG)host adapter code inconsistency unknown error category (0x%x) from host adapter code User command with no ioctl User command with no buf scistrcmdlen too big physio split the request.. cannot proceed DEC RZ55 (C) DECEMULEX MD21/S2 ESDIA00IBMRAID 0662SIBM 0663HIBM0664H3171-S2KZ-CDFRSS2FQUANTUM ELS85S iomegajaz 1GBMICROP4421-07SEAGATEST150176LW0002HPC3725SDCASSONY SDT-5000 3.WangDAT Model 1300 02.4Model 2600 01.7Model 3200 02.2ALPS ELECTRIC CO.,LTD. DC544CSW03DCR-2801TE1.07CREATIVECD3630EAC101FX320Sq01GCD-R580B1.00MATSHITA CR-5741.021.06Memorex CRW-26421.0gNEC CD-ROM DRIVE:2734.21SANYO CRD-256PSANYO CRD-254PSANYO CRD-S54P1.08CD-ROM CDR-S11.70CD-ROM CDR-N161.25UJDCD87301.14scsibusscsibus at %s: %d targets scsibusattach: can't allocate target linksscsibusattach: can't allocate lun linksPLEXTORCD-ROM PX-40TS1.01MICROP 1588-15MBSUN0669vendor-uniqueremovablefixed targ %d lun %d: <%s, %s, %s> SCSI%d %d/%s %s%sscsibusprintdirectsequentialprinterprocessorwormcdromscanneropticalchangercommunicationenclosure servicessimplified directscsibusprint: device type T_NODEVICE offlinescsibusprint: qualifier == SID_QUAL_BAD_LUscsibusprint: qualifier == SID_QUAL_RSVDNEC CD-ROM DRIVE:260%s: not queuedcdioctlATAPI CD-ROMSCSI CD-ROMdvd_authdvd_read_physicaldvd_read_copyrightdvd_read_bcadrive offline%luMB, %lu cyl, %lu head, %lu sec, %lu bytes/sec, %lu sec total%s: not queued, error %d SCSI opticalSCSI disk%s %ssdgetdisklabel%s: WARNING: cache synchronization failed /usr/src/sys/arch/arm/arm/softintr.csoftnet_intrhand != NULLsoftintr_establish: unknown soft IPL %diic"%s" at %s addr 0x%xlm75alm75lm77xeontempmax1617it8712it8712f-aadm1026gl518smasb100f75375as99127fw83l785ts-lw83l785rw83l784rw83781dw83627hfw83782dw83791dw83783sw83791sdw83792dgl523smlm90lm89-1lm89lm86max6642max6657max6646max6690g781-1g781adm1032adm1023adm1021adt7461adt7516lm81lm93lm96000lm85adt7476adm1033adm1022adm1028adm1024adm1025adm1031adm1030adt7467adt7460adm1027adt7470adm9240lm8747m192ds1780ne1619emc6d100sch5017emc6w201thmc50ricohrtc: RICOH RS5C372[AB] Real-time Clock %s: ricohrtc_reg_write: failed to write reg%d %s: ricohrtc_clock_read: failed to read rtc %s: ricohrtc_clock_write: failed to write rtc fintek: F75375 rev %d.%dVCCVolt1Volt2Volt3Temp1Temp2Fan1Fan2, unable to register update task unable to read reg %d pcaled: PCA9532 LED controller gpioi80321_io_bs_alloc(): not implementedi80321_io_bs_free(): not implementedi80321_mem_bs_alloc(): not implementedi80321_mem_bs_free(): not implementediopaauiopiiciopmuiopwdogpcii80321intci80321_intr_establish: IRQ %d out of rangeclock: hz= %d stathz = %d clockstatWARNING: CHECK AND RESET THE DATE! WARNING: preposterous clock chip time lostgainedWARNING: clock %s %ld days WARNING: preposterous time in file system resettodr: failed to set time : I2C controller iopiiclk%s: unable to subregion registers, error = %d iopxs%s: unable to map VERDE registers%s: unable to subregion MCU registers%s: unable to subregion ATU registers%s: unable to map IOW registers: i80321 I/O Processor %s: unable to map PLD registersattempting reset PCI I/O memory spacePCI I/O port space--------------------------[%3d devices bogus] [%s]----------------------- device vendor product register space address size -------------------------------------------- PCIBIOS fixup stageSystem BIOS SettingWARNING: unknown PCI device header. NGOK [%s] %02xh %s 0x%08x 0x%08x mem No available resources. fixup failed fixup failed. (new address=%#lx) new address 0x%08lx pci_addr_fixup: Resource conflict. %03d:%02d:%d %04x:%04x Thecus Nx100I/O Data HDL-GCertance CP3100: %sboard id failed iq80321_pci_intr_map: no mapping for %d/%d/%d (%d, %d, %d) irq %d addr 0x%08lx intr %dobio_bs_alloc(): not implementedobio_bs_free(): not implementedcom_obio: failed to map registers: %d %s: unable to establish interrupt at CPLD irq %d %s: %d-sector PIO, LBA, %lluMB, %llu sectors %s: freeze lock command didn't complete wdattach CHS, %lluMB, %d cyl, %d head, %d sec, %llu sectors LBA48, %lluMB, %llu sectors %s: IDENTIFY failed __wdstart: bad return code from wdc_ata_bio()wddone%s: soft error (corrected) , retrying device faultdevice timeoutST506/MFM/RLLESDI/IDE disk%s: %s wddumpwddump: try againwddump: device timed outwddump: unknown error typewddump: %swddump: drive faultwddump: DMA errorwddump: polled command has been queuedwd_get_params: bad return code from ata_get_paramsST506%s: flush cache command didn't complete %s: flush cache command: drive fault %s: flush cache command timeout wdc%s:%d:%d: not ready, st=0x%b, err=0x%02x BSYDRDYDWFDSCDRQCORRIDXERR%s:%d:%d: timeout waiting for DRQ, st=0x%b, err=0x%02x %s:%d:%d: bad state %d in _wdc_ata_bio_start _wdc_ata_bio_start: bad state%s:%d:%d: intr with DRQ (st=0x%b) %s:%d:%d: read intr before drq %s:%d:%d: device timeout, c_bcount=%d, c_skip%d %s:%d:%d: bad state %d in wdc_ata_bio_intr wdc_ata_bio_intr: bad statewdc_ata_ctrl_intr: state==RECALrecal%s:%d:%d: %s drive fault error (%x) %s:%d:%d: %s timed out piomodedmamodeno media/write protectedinterface CRC erroraddress mark not foundtrack 0 not foundaborted commandmedia change requestedid not foundmedia changeduncorrectable data errorbad block detectederror not notifiedwsevent_readwskbdwskbd at %s: console keyboardcannot load keymapwskdetwskbd_detach: %s didn't detach %s: event queue overflow wskbd_get_mapentry: %d(%d): bad entrywskbd_load_keymap: %d(%d): bad entrywskbd_load_keymap: %d: recursion too deepwsmousewsmouse at %swsmdetwsmouse_detach: %s didn't detach pre 1.01.12.0usb: USB revision %s, not supported usb_attach%s: can't register softintr %s: root device is not a hub %s: root hub problem, error=%d usbtaskunable to create task thread usb_create_event_thread task%s: unable to create event thread for usb_create_event_threadusbevtusbtskusb at %susbreausbreadusbd_add_dev_eventusbd_add_drv_eventusb_add_eventusb_detachusbdet%s: event thread didn't die usbsynusbd_transfer: not doneusbd_start_next: error=%d usb_desc_iter_next: descriptor length = 0 usb_desc_iter_next: descriptor length too large usb_desc_iter_next: bad descriptor usb_detach_wait: %s didn't detach NORMAL_COMPLETIONIN_PROGRESSPENDING_REQUESTSNOT_STARTEDINVALNOMEMCANCELLEDBAD_ADDRESSIN_USENO_ADDRSET_ADDR_FAILEDNO_POWERTOO_DEEPIOERRORNOT_CONFIGUREDTIMEOUTSHORT_XFERSTALLEDINTERRUPTEDXXXvendor 0x%04x%x.%02x, class %d/%d, rev /, addr %dusbd_devinfousbdly0 lengthout of datausbd_fill_iface_data: bad descriptor(s): %s iface descusbd_set_config_index%s: device addr %d (config %d) exceeds power budget, %d mA > %d mA %s: port %d, set config at addr %d failed %s: No free USB addresses, new device ignored. usbd_new_device: cannot find HS portusbd_print%s, %s configuration %d interface %d port %d%s: at %s (addr %d) disconnected %s: %d port%s with %d removable, %s poweredmultiplesingle, %s transaction translator%s%s: bus powered hub connected to bus powered hub, ignored %s: no interface handle %s: no endpoint descriptor %s: bad interrupt endpoint %s: port %d power on failed, %s %s: cannot open interrupt pipe %s: no ports, hub ignored uhub%s: hub depth (%d) exceeded, hub ignored uhub_attach%s: port %d reset failed %s: device problem, disabling port %d %s: strange, connected port %d has no power %s: illegal enable change, port %d %s: port error, giving up port %d %s: port error, restarting port %d sel%d-uaudio_add_selectoruaudio%s: audio descriptors make no sense, error=%d %s: audio rev %d.%02x, %d mixer controls%s: alt %d missing AS interface(s) %s: failed to get configuration descriptor ulinearmulawalawslinearslinear_leulinear_leslinear_beulinear_beuaudio_mixer_add_ctl: no memory i%duaudio_get_cluster: bad data volumemix%d-%suaudio_add_mixermixeroutdacphonelfeauxvideofmsynthuaudio_add_feature%s.%sbassmidtrebleagc4 msdelaybassboostloudnessuaudio_add_processing_updownpro%d-modeuaudio_add_processingpro%d.%d-enableuaudio_add_extensionext%d-enableuaudio_merge_terminal_list: no memory uaudio_io_terminaltype: no memory uaudio_add_alt: no memory %s: ignored setting with type %d format %s: ignored setting with precision %d %s: ignored setting with format %d %s: non sync-pipe endpoint but multiple endpoints %s: ignored output endpoint of type async %s: ignored input endpoint of type adaptive %s: ignored audio interface with %d endpoints %s: no usable endpoint found uaudio_identify_ac: skip desc type=0x%02x uaudio_identify_ac: unexpected AC header uaudio_identify_ac: bad AC desc subtype=0x%02x %s: no memory inputsequalizationumidi %s: %s %s: out=%d, in=%d %s: disabled. USB MIDI I/F%s: illegal endpoint(in:%d) %s: illegal endpoint(out:%d) Fixed EndpointYamaha Specific((genuine USB-MIDI) ucom, %sucomlkucomopen%s: read start failed %s: lost %d chars ucom at %s portno %dugen%s: setting configuration index 0 failed %s: setting configuration %d failed ugen_do_readugenriugenrbugenwiugen_do_writeugenwbhid_start_parsedefault bType=%d Local bTag=%d Main bTag=%d Global bTag=%d BAD LENGTH %d uhidev%s: %s, iclass %d/%d %s: no report descriptor %s: %d report ids %s: no input interrupt endpoint %s: unexpected endpoint %s: could not read endpoint descriptor uhid at %s reportid %duhidev_intr: bad repid %d uhidev_set_report_asyncuhidevwiuhid: input=%d, output=%d, feature=%d uhid_do_readuhidreauhid_do_ioctlukbd %s: attach failed, %s %s: was console keyboard This port is broken, it does not call cnpollc() before calling cngetc(). This should be fixed, but it will work anyway (for now). too many modifier keysbad modifier sizemultiple key code arrays key codes not on byte boundarytoo many key codeskey code size != 8 and Z dir.: %d button%s%s %s: mouse has no Y report ums %s: mouse has no X report %s: X report 0x%04x not supported %s: Y report 0x%04x not supported ulpt%s: setting alternate interface failed bi%s: using %s-directional mode uni%s: could not find bulk out endpoint %s: couldn't get ep %d ulptop%s: offline %s: out of paper %s: output error ulptwrumassCBIBulk-OnlyRBC%s: using %s over %s %s: bus attach failed %s: command protocol=0x%x not supported %s: isdata not configured %s: unable to get Max Lun: %s SCSIATAPIUFIISD-ATACBI with CCI%s: got polled xfer %p, but %p already pending %s: BBB bulk-%s stall clear failed, %s %s: Invalid CSW: sig 0x%08x should be 0x%08x %s: Invalid CSW: tag %d should be %d %s: Invalid CSW: status %d > %d %s: Phase Error, residue = %d %s: BBB reset failed, %s %s: BBB bulk-in clear stall failed, %s %s: BBB bulk-out clear stall failed, %s %s: transferred %d bytes instead of %d bytes%s: Unknown state %d%s: CBI bulk-in/out stall clear failed, %s %s: CBI intr-in stall clear failed, %s %s: CBI reset failed, %s %s: CBI bulk-in stall clear failed, %s %s: CBI bulk-out stall clear failed, %s %s: Get Max Lun failed: %s umass_cmd: large datalen, %d %s: Unknown status %d in umass_scsi_cburio%s: setting config no failed %s: getting interface handle failed %s: missing endpoint uriorsuriowruvisorGeneric%s: no proper endpoints for port %d (%d,%d) DebuggerHotSyncRemote File System%s: init failed, %s %s: device is neither visor nor palm %s: failed to get interface, err=%s %s: failed to set configuration, err=%s udsbr%s: request failed err=%d aue%s: EEPROM read timed out %s: MII read timed out %s: reset failed auemii%s: address %s %s: couldn't get endpoint descriptor %d %s: no memory for rx list -- packet dropped! %s: %u usb errors on intr: %s %s: %u usb errors on rx: %s %s: usb error on tx: %s %s: aue_send error=%s %s: tx list init failed %s: rx list init failed %s: open intr pipe failed: %s %s: open tx pipe failed: %s %s: open rx pipe failed: %s %s: close intr pipe failed: %s %s: abort intr pipe failed: %s %s: close tx pipe failed: %s %s: abort tx pipe failed: %s %s: close rx pipe failed: %s %s: abort rx pipe failed: %s axeaxe%d: read PHY failed axe%d: write PHY failed %s: media change failed axe_setmultiaxemiiaxe%d: getting interface handle failed %s: %s, AX88172, AX88772, AX88178 couldn't get ep %d %s: usb errors on rx: %s axe%d: usb error on tx: %s axe%d: rx list init failed axe%d: open rx pipe failed: %s axe%d: open tx pipe failed: %s axe%d: tx list init failed axe%d: watchdog timeout axe%d: close intr pipe failed: %s axe%d: abort intr pipe failed: %s axe%d: close tx pipe failed: %s axe%d: abort tx pipe failed: %s axe%d: close rx pipe failed: %s axe%d: abort rx pipe failed: %s cue%s: read MAC address failed %s: cue_send error=%s kue%s: warm boot, no firmware download %s: failed loadfirmware of file %s: errno %d %s: cold boot, downloading firmware %s: failed to load trigger segment: %s %s: failed to load fixup segment: %s %s: failed to load code segment: %s %s: loading firmware failed %s: could not read Ethernet descriptor %s: no memory for multicast filter buffer %s: kue_send error=%s cdce%s: no data interface %s: could not find data bulk in %s: could not find data bulk out %s: no union descriptor %s: too many errors, disabling %s: usb error on rx: %s udav, setting config no failed udavmii, read MAC address failed , missing endpoint , couldn't get endpoint %d , failed to get interface, err=%s udav_setmulti%s: udav_send error=%s upl%s: upl_send error=%s urlurlmii%s: couldn't get endpoint %d %s: failed to get interface, err=%s %s: url_send error=%s %s: %s: bad register %04x no %s: data interface %d, has %sCM over data, has %sbreak %s: Could not find data bulk in %s: Could not find data bulk out %s: status change notification available %s: could not set data multiplex mode %s: no endpoint descriptor for %d umodem%s: no pointer to data interface %s: close notify pipe failed: %s %s: abort notify pipe failed: %s %s: abnormal status: %s %s: Invalid notification length! (%d) uftdiuftdi_openuplcom%s: failed to get device descriptor %s: Could not find interrupt in %s: reset failed, %s %s: failed to get second interface, err=%s %s: close interrupt pipe failed: %s %s: abort interrupt pipe failed: %s umctuvscom%s: failed to set configuration, err=%s %s: uvscom_readstat: %s %s: uvscom_shutdown: %s %s: uvscom_set_line: %s %s: uvscom_set_line_coding: %s uvsop%s: cannot open interrupt pipe (addr %d) %s: uvscom_intr: abnormal status: %s ubsa%s: failed to get interface: %s %s: failed to set configuration: %s %s: ubsa_request: %s uipaq%s: no proper endpoints found (%d,%d) %s: unhandled set request: reg=%x onoff=%x umsm%s: could not set configuration no %s: could not get interface handle %s: no endpoint descriptor found for %d uscanner%s: bulk-in and/or bulk-out endpoint not found %s: could not get interface descriptor, err=%d,id=%p %s: cannot open bulk-out pipe (addr %d) %s: cannot open bulk-in pipe (addr %d) uscnrbuscnwbusscanner%s: open in pipe failed, err=%d %s: open intr pipe failed, err=%d %s: open out pipe failed, err=%d %s: alloc cmd xfer failed, err=%d %s: alloc cmd buffer failed, err=%d %s: alloc intr xfer failed, err=%d %s: alloc data xfer failed, err=%d %s: alloc data buffer failed, err=%d wi_usb%s: open pipes failed %s: already detached %s:%s: invalid packet id sent %x invalid packet len: %x memsz %x max %x %s: %s: error=%s write_record buf size err %x %x wiTXsync%s: %s error=%s UGH RX UGH TX wi_usb: received USB_BUFAVAIL packet wi_usb: received USB_ERROR packet wiIDLwitxlwiusbthratuatu-rfmd-intatu-rfmd-extatu-rfmd2958-intatu-rfmd2958-extatu-rfmd2958smc-intatu-rfmd2958smc-extatu-intersil-intatu-intersil-extatu-at76c503-i3863-intatu-at76c503-i3863-extatu-at76c503-rfmd-acc-intatu-at76c503-rfmd-acc-extatu-at76c505-rfmd-intatu-at76c505-rfmd-extatu_send_mibatu_start_scanatu_initial_configatu_joinunknown-device%s: %s loadfirmware error %d %s: reattaching after firmware upload atu_get_card_config %s: could not get card cfg! atu_rxeofatu_tx_startural%s: MAC/BBP RT%04x (rev 0x%02x), RF %s, address %s %s: no endpoint descriptor for iface %d %s: could not allocate tx buffer %s: could not allocate tx xfer %s: could not allocate rx buffer %s: could not allocate rx xfer %s: could not transmit beacon %s: could not transmit buffer: %s ural_rxeofural_tx_data%s: could not read EEPROM: %s %s: could not read MAC register: %s %s: could not write MAC register: %s %s: could not read BBP %s: could not allocate AMRR xfer %s: could not allocate Tx list %s: could not allocate Rx list %s: could not open Rx pipe: %s %s: could not open Tx pipe: %s %s: timeout waiting for BBP/RF to wakeup %s: could not retrieve Tx statistics - cancelling automatic rate control mii_attach: phyloc and offloc specifiedmii_activate: phyloc and offloc specifiedmii_activate: DVACT_ACTIVATE%s: config_activate(%d) failedmii_detach: phyloc and offloc specifiedOUI 0x%06x model 0x%04x rev %d at %s phy %dmii_phy_setmedia: MASTER on wrong mediamiiautnsphyDP83840 10/100 PHY: %s, rev. %d qsphyQS6612 10/100 PHYinphyi82555 10/100 PHYi82562EM 10/100 PHYi82562ET 10/100 PHYiophyi82553 10/100 PHYeephyMarvell 88E1000 Gigabit PHYMarvell 88E1111 Gigabit PHYMarvell 88E1000* Gigabit PHYMarvell 88E1011 Gigabit PHYMarvell 88E1000S Gigabit PHYexphyxl: 3Com internal media interface %s: ignoring this PHY, non-zero instance exphy_service: can't isolate 3Com PHYrlphyRTL8201L 10/100 PHYIP101 10/100 PHYrl: RTL internal PHY rlphy_service: attempt to isolate phylxtphyLXT970 10/100 PHYLXT971 10/100 PHYluphyLU6612 10/100 PHYmtdphyMTD972 10/100 PHYicsphyICS1890 10/100 PHYICS1892 10/100 PHYICS1893 10/100 PHYsqphySeeq 80220 10/100 PHYSeeq 80225 10/100 PHYSeeq 84220 10/100 PHYtqphy78Q2120 10/100 PHYukphy: Generic IEEE 802.3u media interface, rev. %d: OUI 0x%06x, model 0x%04x %s: no media present dcphy: internal PHY bmtphyBroadcom 3C905B internal PHYBroadcom 3C905C internal PHYBCM4401 10/100baseTX PHYBCM5201 10/100 PHYBCM5214 Quad 10/100 PHYBCM5220 10/100 PHYBCM5221 100baseTX PHYBCM5222 Dual 10/100 PHYbrgphyBCM5400 1000baseT PHYBCM5401 10/100/1000baseT PHYBCM5411 10/100/1000baseT PHYBCM5421 10/100/1000baseT PHYBCM54K2 10/100/1000baseT PHYBCM5462 10/100/1000baseT PHYBCM5701 10/100/1000baseT PHYBCM5703 10/100/1000baseT PHYBCM5704 10/100/1000baseT PHYBCM5705 10/100/1000baseT PHYBCM5714 10/100/1000baseT PHYBCM5750 10/100/1000baseT PHYBCM5752 10/100/1000baseT PHYBCM5780 10/100/1000baseT PHYBCM5706C 10/100/1000baseT PHYBCM5708C 10/100/1000baseT PHYbgebnxamphyAm79C873 10/100 PHYDM9101 10/100 PHYDM9102 10/100 PHYDM9601 10/100 PHYAm79C875 quad PHYacphyAC101 10/100 PHYAC101L 10/100 PHYAC_UNKNOWN 10/100 PHYurlphy: RTL internal phy %s: %s: enter %s: %s: link %s rgephyRTL8169S/8110S PHYciphyCicada CS8201 10/100/1000TX PHY%s: unknown PHY speed %x nfe%s: unknown CICADA PHY model %x dev %d function %dpciprintpci_io_find: bad requestpci_mem_find: bad requestpci_mem_find: bad 64-bit requestmiscellaneousfloppyIPISASethernettoken ringFDDIWorldFipPCMIG Multi ComputingXGAtelephonyhdaudioRAMflashhostMicroChannelNuBusRACEwaySemi-transparent PCIInfiniBandserialparallelmulti-port serialmodemsmartcard8237 DMA8254 timerRTCPCI Hot-PlugSD Host Controllerkeyboarddigitizermousegame portgeneric386486PentiumAlphaPowerPCMIPSCo-processorFirewireACCESS.busSSAFiber ChannelIPMISERCOSCANbusIrDAConsumer IRRFbluetoothbroadband802.11a (5 GHz)802.11b (2.4 GHz)standardvoicenetwork/computingentertainmentDPIOTime and Frequencysynchronizationmanagementprehistoricmass storagenetworkdisplaymultimediabridgecommunicationssystemdockserial buswirelessI2Osatellite commDASPundefinedOZ6729 CardBusOZ6730 CardBusOZ6922 CardBusOZ6832 CardBusOZ6836/OZ6860 CardBusOZ68[17]2 CardBusOZ6933 CardBusOZ69[17]2 CardBusOZ711Mx CardBusOZ711EC1 SmartCardBusOZ711M1 CardBusOZ711E0 CardBus3c9853c9963CRDAG675 (Atheros AR5212)3CRPAG175 (Atheros AR5212)V.90 Modem3c9403c3393c3593c4503c555 100Base-TX3c5753CCFE575BT3CCFE575CT3c590 10Mbps3c595 100Base-TX3c595 100Base-T43c595 10Mbps-MII3CRSHPW796 802.11b3CRWE154G72 802.11g3c556 100Base-TX3c556B 100Base-TX3CCFEM6563CCFEM656B3CCFEM656C56k Global Modem3cSOHO-TX3crwe777a AirConnect3c940B3c900 10Base-T3c900 10Mbps-Combo3c900B 10Mbps3c900B 10Mbps-Combo3c900B 10Mbps-TPC3c900B 10Mbps-FL3c905 100Base-TX3c905 100Base-T43c905B 100Base-TX3c905B 100Base-T43c905B 10/100Mbps-Combo3c905B 100Base-FX3c905C 100Base-TX3c9201 100Base-TX3c920B-EMB-WNM3cSOHO 100B-TX3c980 100Base-TX3c980C 100Base-TX3cr9903cr990-TX3cr990-TX-953cr990-TX-973c990b-TX-M3cr990-FX3cr990SVR953cr990SVR973c990BSVRVoodooVoodoo2BansheeVoodoo3Voodoo5300SX500TXDeltaPermedia500MXPermedia 2Oxygen GVX1Permedia 35000/6000 series RAID7000/8000 series RAID9000 series RAID9500 series RAIDFE2500 10/100PCM200 10/100FE2000VX 10/100FE2500MX 10/100PC4800 WirelessPCI35x WLANPC4500 WirelessMPI-350 WirelessACCM 2188 VL-PCI2051 PCI2051 ISAATP850U/UFATP860ATP860-AATP865-AATP865-RAEC6710AEC6712UWAEC6712UAEC6712SAEC6710DAEC6715UWMPX 5030/5038EN2242EN1217RhineIIrtl8139AWA-100M1435 VL-PCIM1445 VL-PCIM1449 ISAM1451 PCIM1461 PCIM1489 PCIM1511 PCIM1513 ISAM1523 PCIM1523 ISAM1531 PCIM1533 ISAM1535 PCIM1541 PCIM1543 ISAM1563 ISAM1575 ISAM1621 PCIM1631 PCIM1644 PCIM1647 PCIM1689 PCIM1695 PCIM3309 MPEGM4803M5219 UDMA IDEM5229 UDMA IDEM5237 USBM5239 USB2M5243 AGP/PCI-PCIM5246 AGPM5247 AGP/PCI-PCM5249 PCI-PCIM524B PCIEM524C PCIEM524D PCIEM5261 LANM5263 LANM5281 SATAM5287 SATAM5288 SATAM5289 SATAM5451 AudioM5455 AudioM5457 ModemM5461 HD AudioM7101 PowerAL981AN983AN985ADM8211 WLANADM9511ADM9513AIC-7810AHA-2940AU/CNAHA-2930CUAIC-7850AIC-7855AIC-5900 ATMAIC-5905 ATMAPA-1480AIC-7860AHA-2940AUAIC-7870AHA-2940AHA-3940AHA-3985AHA-2944AIC-7880AHA-2940UAHA-3940UAHA-398XUAHA-2944UAHA-2940UWProAIC-6915AIC-7895AHA-2940U2 U2AHA-2930U2 U2AAA-131U2 U2AIC-7890/1 U2AIC-7892 U160AHA-29160 U160AHA-19160B U160AHA-3950U2B U2AHA-3950U2D U2AIC-7896/7 U2AHA-3960D U160AIC-7899BAIC-7899DAIC-7899FAIC-7899 U160ServeRAIDAAC-2622ASR-2200SASR-2120SAAC-364AAC-3642Dell PERC 2/QCAIC-7901 U320AHA-29320A U320AHA-29320LP U320AIC-7901A U320AHA-29320 U320AHA-29320B U320AIC-7902 U320AIC-7902B U320AHA-39320 U320AHA-39320B U320AHA-39320A U320AHA-39320D U320AHA-39320DB U3201200A1200BABP-930/40UAABP-940UWASP-3940U2WASP-3940U3WWaikato Dag3.2Endace Dag3.5Endace Dag4.22GEEndace Dag4.23AT22AT24AcenicAcenic CopperBCM5700BCM5701AC1000AC1001AC9100AMD64 HyperTransportAMD64 Address MapAMD64 DRAM CfgAMD64 Misc Cfg79c970 PCnet-PCI79c978 PChome-PCI53c974 PCscsi-PCI79C974 PCnet-PCIGeode LXGeode LX VideoGeode LX CryptoCS5536 ISACS5536 AudioCS5536 USBCS5536 IDEElanSC520 PCI751 System751 PCI-PCI762 PCI762 PCI-PCI761 PCI761 PCI-PCI755 ISA755 IDE755 Power755 USB756 ISA756 IDE756 Power756 USB Host766 ISA766 IDE766 USB766 Power766 USB OpenHCI768 ISA768 IDE768 Power768 AC97768 Modem768 PCI-PCI768 USB8131 PCIX8131 PCIX IOAPIC8151 Sys Control8151 AGP8132 PCIX8132 PCIX IOAPIC8111 PCI-PCI8111 USBAMD8111 LPC8111 IDE8111 SMBus8111 Power8111 AC97MegaRAIDMegaRAID Series 428MegaRAID Series 434ADSP 21535 DSPAD1889 AudioSafeNet ADSP 2141TC9021BanditGCOHareHeathrowPaddingtonUni-N EthUni-NUni-N Eth FirewireUni-N AGPUni-N GMACKeylargoPangea GMACPangea MacioPangea USBPangea AGPPangeaPangea PCIUni-N2 AGPUni-N2 HostPangea FireWireUniNorth FirewireUni-N2 GMACUni-N ATAUniNorth AGPUniNorth PCIIntrepid ATAIntrepidIntrepid USBK2 USBK2 MacioK2 FirewireK2 ATAU3 PCI-PCIU3 AGPK2 GMACShastaShasta ATAShasta GMACShasta FirewireShasta PCIShasta HyperTransportK2U3L AGPK2 AGPIntrepid 2 AGPIntrepid 2 PCIIntrepid 2 ATAIntrepid 2 FireWireIntrepid 2 GMACARS106SARS0303D1000PV2000PV2000MT2000MIARC-1110ARC-1120ARC-1130ARC-1160ARC-1170ARC-1210ARC-1220ARC-1230ARC-1260ARC-1270ARC-1280ARC-1380ARC-1381ARC-1680ARC-1681AX88140A/88141Radeon Mobility X600FireGL V3200Radeon X600 (RV380)Radeon X600 (RV380) SecRadeon 9500 ProRadeon 9600 ProRadeon 9600 LERadeon 9600 XTRadeon 9550Mach32Radeon 9500 Pro SecRadeon 9600 Pro SecRadeon 9600 LE SecRadeon 9600 XT SecRadeon 9550 SecRadeon 8500 BBRadeon IGP 320MMobility M6IXP200 AC97SB200 PCI-PCISB200 USB2SB200 USBIXP200 IDESB200 PCI-ISAIXP200 ModemSB200 SMBusMach64 CTMach64 CXIXP300 AC97IXP300 SMBusIXP300 IDEIXP300 SATAIXP400 AC97IXP400 PCIIXP400 SMBusIXP400 USB2IXP400 USBIXP400 IDEIXP400 ISAIXP400 ModemIXP400 SATAIXP450 HD AudioIXP600 SATAIXP600 AC97IXP600 HD AudioIXP600 PCIIXP600 SMBusIXP600 USB2IXP600 USBIXP600 IDEIXP600 LPCIXP600 ModemMach64 ETRage ProMach64 GDMach64 GIMach64 GLMach64 GMMach64 GNMach64 GOMach64 GPMach64 GQRage XLMach64 GSMach64 GTMach64 GUMach64 GVMach64 GWMach64 GXMach64 GYMach64 GZRadeon 9000Radeon 9000 SecMach64 LBMach64 LDRage128 LEMobility M3Mach64 LGMach64 LIMobility 1Mach64 LNMach64 LPMach64 LQRage P/MMach64 LSRadeon Mobility M7 LWRadeon Mobility M6 LYRadeon Mobility M6 LZRadeon Mobility M9 LfRage 128 Mobility MFRage 128 Mobility MLRadeon 9500/9700Radeon 9800 XTRadeon 9800 ProRadeon Mobility M10 NPRadeon 9500/9700 SecRadeon 9800 Pro SecRage 128 Pro PDRage FuryRage 128 PKAIW RadeonRadeon QERadeon QFRadeon QGRadeon 8500 QLRadeon 9100 QMRadeon 8500 QNRadeon 8500 QORadeon 7500 QWRadeon VE QYRadeon VE QZES1000Radeon 8500 QlRage 128 GLRage MagnumRage 128 RGRage 128 RKRage 128 VRRage 128 SHRage 128 SKRage 128 SLRage 128 SMRage 128Rage 128 Pro TFRage 128 Pro TLRage 128 Pro TRRadeon Mobility M300 M22Radeon Mobility X700 M26Mach64 VTMach64 VUMach64 VVRS300_100 HostRS300_133 HostRS300_166 HostRadeon IGP 9100 HostRadeon Mobility IGP 9100Radeon IGP 9100 AGPRadeon 9200 PRO SecRadeon 9200 SecRS480 HostRX480 HostRadeon XPRESS 200Radeon XPRESS 200MRadeon 9200 PRORadeon 9200Radeon 9200 SE SecRX480 PCIERS480 PCIERadeon X300Radeon X600 (RV370)Radeon X550FireGL V3100Radeon X300 SecRadeon X600 (RV370) SecRadeon X550 SecFireGL V3100 SecRadeon Mobility 9200Radeon Mobility 9200 (M9+)Radeon 9200 SERadeon X800 GTORadeon X800 GTO SecRS100 PCIRS200 PCIRadeon X1800Radeon Mobility X1300 M52-64Radeon Mobility X1600RS100 AGPRS200 AGPRS250 AGPS5933 PCI MatchmakerMyrinet LANaiAR5210AR5211AR5212AR5424AR5210 (Early)AR5212 (IBM MiniPCI)AR5210 (no eeprom)AR5212 (no eeprom)AR5211 (no eeprom)AR5212 (emulation board)AR5211RefIDE-2015PLVortex 1Vortex 2Vortex AdvantageAVL2301AVG2302ALG2301ALG2302ALS4000LP-PCI 4 SerialBRI ISDNFritz ISDNFritz v2.0 ISDNPRI T1 ISDNF5D6001F5D6020V3F5D6000VME 617VME 270655015601BCM5752BCM5752MBCM5702BCM5703BCM5704CBCM5704S AltBCM5706BCM5708BCM5702FEBCM5705BCM5705KBCM5720BCM5721BCM5705MBCM5705M AltBCM5714BCM5714SBCM5780BCM5780SBCM5705FBCM5754MBCM5755MBCM5750BCM5751BCM5715BCM5715SBCM5754BCM5755BCM5750MBCM5751MBCM5751FBCM5787MBCM5782BCM5786BCM5787BCM5788BCM5789BCM5702XBCM5703XBCM5704SBCM5706SBCM5708SBCM5702 AltBCM5703 AltBCM5781BCM5753BCM5753MBCM5753FBCM5903MBCM4401B0BCM5901BCM5901A2BCM4303BCM4307BCM4311BCM4318BCM4319BCM4306BCM4322BCM4309BCM43XGSerialBCM44015801580258055820582158225823BT848BT849BT878BT879BT878 AudioBT879 AudioBt8474 HDLCMultiMaster NCMultiMasterFlashPointGPPCINitrox XLCinemasterNx10 10GbE643106554565548655506555465555685546900069030CL-GD7548CL-GD5430CL-GD5434-4CL-GD5434-8CL-GD5436CL-GD5446CL-GD5480CL-GD5462CL-GD5464CL-GD5465CL-PD6729CL-PD6832 CardBusCL-PD6833 CardBusCL-GD7542CL-GD7543CL-GD7541CS4610 SoundFusionCS4615CS4280/46xx CrystalClearCS4281 CrystalClearAAR-1210SAPCI0640PCI0642PCI0643PCI0646PCI0647PCI0648PCI0649PCI0650AUSB0670USB0673PCI0680SiI3112 SATASiI3114 SATASiI3124 SATASiI3132 SATASiI3512 SATAGigaCardEX110TXTriflex PCIQVisionQVision 1280/pSmart Array 5300Smart Array 5iSmart Array 532Smart Array 5312Smart Array 6iSmart Array 641Smart Array 642Smart Array 6400Smart Array 6400 EMSmart Array 6422Smart Array 64xxNetelligent ASMCPCI HotplugUSB OpenHostSMART2P RAIDISAPnPNetelligent 10/100TXNetelligent IDENetelligent 10 TIntegrated NetFlex 3/PDP Netelligent 10/100TXProLiant Netelligent 10/100TXEmbedded Netelligent 10/100TXNetelligent 10 T/2 PCISmart Array 5300 rev.2Smart Array 5i/532 rev.2iLONetFlex 3/PNetFlex 3/PBCompexeRL100-ATX 10/100PMAC 9871356k WinmodemSoftK56 PCIHSF 56k HSFiMUSYCC CN8478MUSYCC CN8474MUSYCC CN8472MUSYCC CN8471CX2388xCX2388x AudioCX2388x MPEGCX2388x IR82C599 VLBCY82C693U ISAFEther CB-TXD 10/100FEther II CB-TXD 10/100CG-LAPCIGTC-Bus II-PCISoundBlaster LiveSoundBlaster AWE64DSoundBlaster AudigySoundBlaster Live (Dell)SoundBlaster Audigy LSSoundBlaster Audigy 2PCI Gameport JoystickSoundBlaster Audigy DigitalEctiva 1938Cyclom-Y below 1MCyclom-YCyclom-4Y below 1MCyclom-4YCyclom-8Y below 1MCyclom-8YCyclom-Z below 1MCyclom-ZIQ80310Cx5510GXm PCIGXm ISACx5530 SouthCx5530 SMICx5530 IDECx5530 XpressAUDIOCx5530 VideoDM9009DM9100DM9102DM913221050 PCI-PCI2104021030Zephyr NV-RAMKZPSA21140TGA2DEFPA21041DGLPB (OPPO)ZLXP-L2 (Pixelvision)21142/3Farallon PN9000SX21052 PCI-PCI21150 PCI-PCI21150-BC PCI-PCI21152 PCI-PCI21153 PCI-PCI21154 PCI-PCICompaq SMART RAID 42xxSWXCR RAIDPERC 2/SiPERC 3/DiPERC 3/SiDRAC 3 Add-inDRAC 3 Embedded/OptionalDRAC 4 Embedded/OptionalDRAC 3 OptionalPERC 4/Di i960PERC 4/Di VerdeDRAC 4DRAC 4 Virtual UARTPERC 4e/DiDRAC 4 SMICPERC 58139Viper/PCI550TX530TX+DFE-690TXDDRP32TXDDWL-610DGE-550TDGE-528TDGE-560TDGE-530T B1DGE-530T A1Memory ControlSmartCache/RaidSmartRAID (I2O)SmartRAID 2005SPCI-SCIDMX3194UIS64PH ISDN155P-MF1 ATM (FPGA)155P-MF1 ATM (ASIC)25SS-3010 ATM (ASIC)SpeedStream 1023QuickStep 1000 ISDNLight Pulse FibreChannelLight Pulse 8000Endace Dag3.6DEndace Dag4.23GECB-1211 CardBusCB-1225 CardBusCB-1410 CardBusCB-710 CardBusCB-712 CardBusCB-1420 CardBusCB-720 CardBusCB-722 CardBusAudioPCI97AudioPCICT5880ES366H ModemMaestro IISOLO-1 AudioDriveMaestro 2EES1989ES1989 ModemMaestro 3ES1983 ModemMaestro 3 AudioES366H Fax/ModemES2838/2839 SuperLink ModemES2898 ModemRoadRunner HIPPIRoadRunner Gig-EFreedom GBusWL11000PSST-64PSST-128PSST-16PSST-4pSST-8pATM PCA-200ATM PCA-200e801 SoundTMC-18C30 (36C70)GL24110P03GL24110PGL24110P02PR103WinTVPN672TX 10/100Visualize EGVisualize FX6Visualize FX4Visualize FX2Tach TL FibreChannelTach XL2 FibreChannelJ2585AJ2585BDiva Serial MultiportElroy Ropes-PCIVisualize FXeTopTools Communications PortNetRaid-4MNetServer SmartIRQ82557B 10/100 NICPluto MIOzx1 IOCMercury Ropes-PCIQuickSilver Ropes-PCISmart Array V100Smart Array E200iSmart Array E200Smart ArraySmart Array P800Smart Array P600Smart Array P400Smart Array P400i77516500781179517814/7851/785480658165815479567955/7954MCACPU - Alta LiteCPU - Alta MPISA w/PnPCPUAuto LANStreamerGXT-150P82G267582351 PCI-PCIMiami/PCIOlympici82557B 10/100FireGL2133 PCIX-PCIXCalgary IOMMUEnvy24 I/O CtrlrEnvy24PT/HT Audio77201/77211 ATM (NICStAR)WDT 50x Watchdog TimerINIC-850 (A100UW)INIC-1060 (A100U2W)INIC-940INIC-941INIC-950IPN2120IPN22208849EES ISA2114580303 IOP80312 I/O CompanionPCIE-PCIEIOP332 PCIE-PCIXIOP331 PCIX-PCIX41210 PCIE-PCIXIOP333 PCIE-PCIX82375EB EISA82424ZX Cache/DRAM82378IB ISA82426EX ISA82434LX/NX PCI/Cache/DRAMGDT RAIDi960 RP PCI-PCIi960 RM PCI-PCIi960 RN PCI-PCIPRO/1000 (82542)PRO/1000F (82543GC)PRO/1000T (82543GC)PRO/1000XT (82544EI)PRO/1000XF (82544EI)PRO/1000T (82544GC)PRO/1000XT (82544GC)PRO/1000MT (82540EM)PRO/1000MT (82545EM)PRO/1000MT (82546EB)PRO/1000MF (82545EM)PRO/1000MF (82546EB)PRO/1000MT (82541EI)PRO/1000MT (82540EP)PRO/1000MT Mobile (82541EI)PRO/1000CT (82547EI)PRO/1000CT Mobile (82547EI)PRO/1000MT QP (82546EB)PRO/1000MT (82545GM)PRO/1000MF (82545GM)PRO/10082559PRO/100 VEPRO/100 VM82562EH HomePNA82801DB LANV.92 ModemPRO/Wireless 2100PRO/10GbE LR (82597EX)ICH8 IGP M AMTICH8 IGP AMTICH8 IGP CICH8 IFEICH8 IGP MPRO/100 MPRO/1000 PT (82571EB)PRO/1000 PF (82571EB)PRO/1000 PB (82571EB)82801FB LAN82801FBM LAN82801GB LANPRO/1000CT (82547GI)PRO/1000MT (82541GI)PRO/1000MT Mobile (82541GI)PRO/1000MT (82541ER)PRO/1000MT (82546GB)PRO/1000MF (82546GB)PRO/1000GT (82541GI)PRO/1000 PT (82572EI)PRO/1000 PF (82572EI)PRO/1000 PB (82572EI)PRO/1000MT (82573E)PRO/1000PT (82573E)PRO/1000 PT (80003ES2)PRO/1000 PF (80003ES2)PRO/1000MT QP (82546GB)PRO/1000MT (82573L)PRO/10GbE CX4 (82597EX)PRO/1000 AT (82571EB)PRO/1000 AF (82571EB)PRO/1000 QP (82571EB)PRO/1000 PL (82573L)PRO/1000 PM (82573V)PRO/1000 PM (82573E)82815 Hub82815 AGP82815 Graphics82806AA APIC82559ER82092AA IDESAA7116EE Pro 10 PCIEE Pro 100EE Pro 100 Smart8255x82437FX82371FB ISA82371FB IDE82371 ISA and IDE82437 PCI/Cache/DRAM82441FX82380AB Mobile ISA82380FB Mobile PCI-PCI82439HX82806AA82870P2 PCIX-PCIX82870P2 IOxAPIC82870P2 Hot Plug80960RP ATU82840 Host82840 AGP82840 PCI82845 Host82845 AGPPRO/10GbE SR (82597EX)82801AA LPC82801AA IDE82801AA USB82801AA SMBus82801AA AC9782801AA Modem82801AA Hub-to-PCI82801AB LPC82801AB IDE82801AB USB82801AB SMBus82801AB AC9782801AB Modem82801AB Hub-to-PCI82801BA LPC82801BA USB82801BA SMBus82801BA AC9782801BA Modem82801BAM Hub-to-PCI8256282801BAM IDE82801BA IDE82801BAM LPC82801BA AGP82801E LPC82801E USB82801E SMBus82801E LAN82801CA LPC82801CA/CAM USB82801CA/CAM SMBus82801CA/CAM AC9782801CA/CAM Modem82801CAM IDE82801CA IDE82801CAM LPC82801DB LPC82801DBL IDE82801DB USB82801DB SMBus82801DB AC9782801DB Modem82801DBM IDE82801DB IDE82801DBM LPC82801EB/ER LPC82801EB SATA82801EB/ER USB82801EB/ER SMBus82801EB/ER AC9782801EB/ER Modem82801EB/ER IDE82801EB/ER USB282801ER SATA82820 MCH82820 AGP82850 Host82860 Host82850/82860 AGP82860 PCI-PCIE7500 MCH HostE7500 DRAME7500 MCHE7501 MCH HostE7505 MCH HostE7505 MCH RASE7505 MCH AGPE7505 MCH PCI-PCI82845G/GL82845G/GL/GV/GE/PE AGP82845G/GL Video82865G/PE/P CPU-I/0-182865G/PE/P CPU-AGP82865G Video82865G/PE/P CPU-CSA82865G/PE/P CPU-I/0-282875P Host82875P AGP82875P PCI-CSA82915G/P/GV Host82915G/P/GV PCIE82915G/P/GV Video82925X MCH Host82925X PCIEE7221 MCH HostE7221 PCIEE7221 Video82915GM/PM/GMS Host82915PM/GM PCIE82915GM/GMS Video6300ESB LPC6300ESB IDE6300ESB SATA6300ESB SMBus6300ESB AC976300ESB Modem6300ESB USB6300ESB WDT6300ESB APIC6300ESB PCIX5000X Host5000 PCIE5000 Error Reporting5000 Reserved5000 FBDE8500 HostE8500 PCIEE8500 PCIE x8E8500 IMIE8500 FSB/Boot/InterruptE8500 Address MappingE8500 RASE8500 MiscE8500 ReservedE8500 XMBE8500 XMB MiscE8500 XMB MAIE8500 XMB DDRE8500 XMB Reserved82801FB LPC82801FBM LPC82801FB SATA82801FR SATA82801FBM SATA82801FB USB82801FB PCIE82801FB HD Audio82801FB SMBus82801FB Modem82801FB AC9782801FB IDE6321ESB LPC6321ESB SATA6321ESB AHCI SATA6321ESB SATA RAID6321ESB USB6321ESB PCIE6321ESB AC976321ESB Modem6321ESB HD Audio6321ESB SMBus6321ESB IDE82945GP82945GP PCIE82945G Video82955X MCH82955X PCIEE7230 MCHE7230 PCIE82915G Video82945GM MCH82945GM PCIE82945GM Video82801GH LPC82801GB LPC82801GBM LPC82801GHM LPC82801GB SATA82801GR AHCI SATA82801GR SATA82801GBM SATA82801GBM AHCI SATA82801GHM SATA RAID82801GB USB82801GB PCIE82801GB HD Audio82801GB SMBus82801GB Modem82801GB AC9782801GB IDE82801G PCIE82801H LPC82801H SATA82801H AHCI SATA82801H RAID82801HBM SATA82081HBM SATA82801H SMBus82801H DMI-PCI82801H USB82801H PCIE82801H HD AudioRCU32 I2O RAID31244 SATA82855PE Hub82855PE AGP6321ESB PCIE-PCIX82830MP CPU-I/O-182830MP CPU-AGP82830MP Integrated Video82830MP CPU-I/O-282852GM Hub-PCI82852/82855 AGP82852GM AGP82852GM Memory82852GM ConfigurationE7520 MCHE7520 MCH ERRE7320 MCHE7525 MCH ERRE7520 MCH DMAMCH PCIEE7525 MCH ConfigurationE7525 MCHPRO/Wireless 2200BGPRO/Wireless 2225BGPRO/Wireless 3945ABGPRO/Wireless 2915ABGi960 RD PCI-PCIPRO 100 Server82371SB ISA82371SB IDE82371SB USB82437VX82439TX System82371AB PIIX4 ISA82371AB IDE82371AB USB82371AB Power8281082810 Graphics82810-DC10082810-DC100 Graphics82810E82810E Graphics82443LX AGP82443BX AGP82443BX82440MX Host82440MX AC9782440MX Modem82440MX ISA82440MX IDE82440MX USB82440MX Power82440BX AGP82443GX82372FB IDE82740 AGP82450KX/GX82450KX/GX Memory82451NX Mem & IO82454NX PXB82802AC Firmware Hub 8Mbit82802AB Firmware Hub 4MbitI2O RAID PCI-PCIRCU21 I2O RAIDRCUxx I2O RAIDRCU31 I2O RAIDRCU31L I2O RAIDS21152BB PCI-PCIS21154AE/BE PCI-PCIPowerstorm 4D50TIntense 3DExpert3D5526 FibreChannelPRISM3PRISM2.5Prism IndigoPrism Javelin/XbowPrism GT/DuetteAEONGV-BCTV3AGX016ITT3204 MPEG DecoderIT8211FIT8212FIT8330GIT8888F ISAJMB360 SATAJMB361 IDE/SATAJMB363 IDE/SATAJMB365 IDE/SATAJMB366 IDE/SATAJMB368 IDE/SATAKTIHSSIDS3SSIDS1HSSIcAppian LiteDual SerialQuad SerialParallelDual ParallelDual Parallel BS3 805Leadtek WinFast TV 2000LXT1001EG1032EG1064PCMPC200PCM200PNICPNIC-II8031K56flex DSVD LTMODEMLTMODEMVenus ModemUSB 2-portUSB QuadraBusFW322 1394LS242 DVD DecoderPMAC 98715PMAC 98727MX86250Smart 16/4 PCI RingnodeSmart 16/4 PCI Ringnode Mk2Smart 16/4 PCI Ringnode Mk3Smart 16/4 PCI Ringnode Mk116/4 CardbusPresto PCISmart 100/16/4 PCI-HS RingnodeSmart 100/16/4 PCI Ringnode16/4 CardBus Mk2Collage 25 ATMCollage 155 ATMi740 PCILibertas 88W8300Libertas 88W8310Libertas 88W8335Yukon 88E8001/8003/8010Yukon-II 88E8021CUYukon-II 88E8022CUYukon-II 88E8061CUYukon-II 88E8062CUYukon-II 88E8021XYukon-II 88E8022XYukon-II 88E8061XYukon-II 88E8062XYukon 88E8035Yukon 88E8036Yukon 88E8038Yukon 88E8052Yukon 88E8050Yukon 88E8053YukonYukon (Belkin F5D5005)88SX5040 SATA88SX5041 SATA88SX5080 SATA88SX5081 SATA88SX6041 SATAMGA PX2085 (Atlas)MGA Millenium 2064W (Storm)MGA 1064SG 220MHzMGA Millennium II 2164WMGA Millennium II 2164WA-B AGPMGA G200 PCIMGA G200 AGPMGA G400/G450 AGPMGA ImpressionMGA G100 PCIMGA G100 AGPMGA 1064SGMGA G400 Twin HeadMGA G550 AGPMGA Millennium G200 SDMGA Produktiva G100 SDMGA Mystique G200 SDMGA Millennium G200 SGMGA Marvel G200 SDKSZ8841 10/100KSZ8842 dual-port 10/100 switchMN-120 10/100MN-130 10/1002IVDC-PCX1MiroVIDEO DC20Media 3DMiroVIDEO DC10/DC20Powerstorm 4D30TGUI AccelMPC105 PCIMPC106 PCISM56Raven PCICP-114C104HCP-104ULC168HDMA4 serialDAC960P V2 RAIDDAC960P V3 RAIDDAC960P V4 RAIDDAC960P V5 RAIDAcceleRAIDeXtremeRAIDZ8EMyrinet LANai 9.2MTD800 10/100MTD803 10/100MTD891 10/100/1000MV1000NCP130NCP130 Rev A2PCI-GPIBDP83810 10/100PC87415 IDE87560 Legacy I/ODP83815 10/100DP83820 10/100/1000CS5535 HostCS5535 ISACS5535 IDECS5535 AUDIOCS5535 USBCS5535 VIDEOSaturnSCx200 ISASCx200 SMISCx200 IDESCx200 AUDIOSCx200 VIDEOSCx200 X-BUSSC1100 ISASC1100 SMISC1100 X-BusNS87410PowerVR PCX2I/OVersa MaestroVersa Va26D MaestroMagicgraph NM2070Magicgraph 128VMagicgraph 128ZVMagicgraph NM2160Magicgraph NM2200Magicgraph NM2360MagicMedia 256AV+MagicMedia 256XL+MagicMedia 256AVMagicMedia 256ZXXframeXframe IIMA301GA620GA620T1P2S1P4SCMI8338A AudioCMI8338B AudioCMI8738/C3DX AudioCMI8738B AudioHSP56 AMRNSP2KNetVin 5000Universe VME53c81053c82053c82553c81553c810AP53c86053c1510D53c89653c89553c88553c87553c151053c895A53c1010-3353c1010-6653c103053c1030ZC53c103553c1035ZCSAS1064SAS1068SAS1064ESAS1068ESAS1066ESAS1064ASAS1066SAS107853c875JMegaRAID 320MegaRAID 320-2EMegaRAID SATA 4x/8xMegaRAID SAS 1064RMegaRAID Verde ZCRFC909FC909AFC929FC919FC929XFC919XFC949XFC939XFC949EYellowfin61C10263C81553c1030RPacket Engines G-NICPI7C21P100 PCIX-PCIXFNW-3603-TX 10/100FNW-3800-TX 10/100NX82C501 PCINDR4600 PCIBS21 10/100E-mobility WirelessImagine-128Imagine-128 IIImagine-128 T2RImagine-128 T2R4NV1DAC64Riva TNTRiva TNT2Riva TNT2 UltraVantaMCP04 ISAMCP04 SMBusMCP04 IDEMCP04 SATAMCP04 LANMCP04 AC97MCP04 USBMCP04 PCI-PCInForce4 ISAnForce4 SMBusnForce4 IDEnForce4 SATACK804 LANnForce4 AC97nForce4 USBnForce4 PCI-PCInForce4 PCIEnForce4 DDRnForce2 ISAnForce2 SMBusnForce2 IDEnForce2 LANnForce2 USBnForce2 AC97nForce2 AudionForce2 PCI-PCInForce2 FireWireMCP04 PCIEnForce2 400 ISAnForce2 400 SMBusnForce2 400 IDEnForce3 LANnForce2 400 USBnForce2 400 USB2nForce2 400 AC97nForce2 400 PCI-PCInForce2 400 SATAAladdin TNT2GeForce Go 6800GeForce Go 6800 UltraQuadro FX Go1400Quadro FX 1400nForce3 ISAnForce3 PCI HostnForce3 PCI-PCICK804nForce3 SMBusnForce3 IDEnForce3 USBnForce3 ModemnForce3 AC97nForce3 250 ISAnForce3 250 PCI HostnForce3 250 AGPnForce3 250 SATAnForce3 250 SMBusnForce3 250 IDEnForce3 250 USBnForce3 250 USB2nForce3 250 AC97nForce3 250 PCI-PCIGeForce 6600 GT AGPQuadro FX 330GeForce256GeForce256 DDRQuadroGeForce2 MXGeForce2 MX 100GeForce2 GoQuadro2 MXRGeForce 6600 GTGeForce 6600GeForce 6600 GoGeForce2 GTSGeForce2 TiGeForce2 UltraQuadro2 ProGeForce 6200Quadro NVS 285GeForce Go 6200GeForce4 MX 460GeForce4 MX 440GeForce4 MX 420GeForce4 440 GoGeForce4 420 GoGeForce4 420 Go 32MQuadro4 500XGLGeForce4 440 Go 64MQuadro4 200/400NVSQuadro4 550XGLQuadro4 GoGLGeForce4 MX 440 AGPGeForce4 MX 440SE AGPGeForce 4 MX 420 AGPGeForce4 MX 4000Quadro4 580 XGLQuadro4 NVSQuadro4 380 XGLGeForce2 Crush11nForce PCI HostnForce 220 DDRnForce 420 DDRnForce 220/420nForce APUnForce AC97nForce ISAnForce SMBusnForce AGPnForce PCI-PCInForce IDEnForce USBnForce LANnForce2 PCInForce2 AGPnForce2GeForce4 MX nForce GPUGeForce3GeForce3 Ti 200GeForce3 Ti 500Quadro DCCGeForce 6150GeForce 6150 LEGeForce 6100GeForce4 Ti 4600GeForce4 Ti 4400GeForce4 Ti 4200Quadro4 900 XGLQuadro4 750 XGLQuadro4 700 XGLMCP51 ISAMCP51 SMBusMCP51 IDEMCP51 SATAMCP51 LANMCP51 AC97MCP51 HD AudioMCP51 USBMCP51 PCI-PCIMCP51 HostMCP51 PMUMCP51 MemoryC51 MemoryGeForce4 Ti 4200 GoC51 HostC51 PCIEGeForce FX 5800 UltraGeForce FX 5800GeForce FX 5600 UltraGeForce FX 5600GeForce FX Go 5600GeForce FX Go 5650GeForce FX 5200 UltraGeForce FX 5200GeForce FX Go 5200GeForce FX 5500GeForce FX 5100Quadro FX 500/600GeForce FX Go 5300GeForce FX Go 5100GeForce FX 5900 UltraGeForce FX 5900GeForce FX 5950 UltraGeForce FX 5700LEGeForce FX Go 5700MCP55 ISAMCP55 SMBusMCP55 USBMCP55 IDEMCP55 MemoryMCP55 PCI-PCIMCP55 HD AudioMCP55 LANMCP55 PCIEMCP55 SATAMCP61 ISAMCP61 HD AudioMCP61 LANMCP61 SATAMCP61 PCIEMCP61 SMBusMCP61 IDEMCP65 ISAMCP65 MemoryMCP65 SMBusMCP65 IDEMCP65 PCIMCP65 HD AudioMCP65 AHCIMCP65 LANMCP65 USBMCP65 PCIEMCP65 SATAOTI107OC2325OC2183OC232682C092G82C557 Host82C558 ISA82C568 IDE82D568 IDE82C621 IDE82C70082C70182C82282C8613G+ UMTS HSDPA (F32)010L100L110L200L210L400L800Lx10H100H200H400H/800H800H200HV2011HOX16PCI954Exsys EX-41092OXCB950Exsys EX-41098OX16PCI954 ParallelOX16PCI952OX16PCI952 ParallelQStor SATAPMC/GNIC2ToolsRZ1000HSP MicroModem 56CMIC-LECNB20-LE HostCNB20HE HostCNB20LE HostCIOB30CMIC-HECMIC-WS Host (GC-LE)CNB20-HE HostCNB20-HE Host (GC-LE)CMIC-GC HostGCNB-LE HostHT-1000 PCICIOB-X2 PCIXHT-1000 PCIXCIOB-EHT-2000 PCIXHT-2000 PCIEOSB4CSB5CSB6HT-1000OSB4 IDECSB5 IDECSB6 RAID/IDEHT-1000 IDECSB6 IDEOSB4/CSB5 USBCSB6 USBHT-1000 USBCSB5 LPCGCLE-2 HostHT-1000 LPCK2 SATAFrodo4 SATAFrodo8 SATAHT-1000 SATAVerite 1000Verite V2x00SAA7130 TVSAA7133 TVSAA7134 TVSAA7135 TVPT80C826PT86C521PT86C523PC87550PT86C523_2PCC-ISESES1849I/O 1076I/O 1077I/O 9050I/O 9080PDC20265PDC20263PDC20275PDC20318PDC20319PDC20371PDC20379PDC20378PDC20375PDC20376PDC20377PDC40719PDC40519PDC20771PDC20571PDC20579PDC40779PDC40718PDC40518PDC20775PDC20575PDC20267PDC20246PDC20262PDC20268PDC20269PDC20276DC5030PDC20268RPDC20271PDC20617PDC20620PDC20621PDC20618PDC20619PDC20277ISP10160ISP1020ISP1022ISP1080ISP12160ISP1240ISP1280ISP2100ISP2200ISP2300ISP2312ISP2322ISP631285008580RT2460ART2560RT2561SRT2561RT2661802981298101E81388169SC81688169818081855C465 CardBus5C466 CardBus5C475 CardBus5C476 CardBus5C477 CardBus5C478 CardBus5C521 Firewire5C551 Firewire5C552 Firewire5C592 Memory Stick5C822 SD/MMC5C832 Firewire5C8435C852 xDRS56/SP-PCI11P1 ModemViRGETrio32Trio32/64Aurora64V+Trio64UV+868ViRGE VX86C92886C864-086C864-186C864-286C864-386C964-086C964-186C964-286C964-386C968-086C968-186C968-286C968-3Trio64V2/DXPlatoTrio3D AGPViRGE DX/GXViRGE GX2Trio3 DX2Savage 3DSavage 3DMSavage 4ProSavage PM133ProSavage KM133ViRGE MXViRGE MXPSavage/MX-MVSavage/MXSavage/IX-MVSavage/IXSuperSavageTwisterTwister-KProSavage DDRSonicVibesSafeXcelMagicLAN SWL-2210PA10xNeo-4SK-98xxSK-98xx v2.0SK-9D21SK-9SxxSK-9ExxTigonSTG 2000XSTG 1764Kyro-IISTG 1764X64GXDVDmagic-PRO86C201 AGP86C202 VGA648FX AGP86C20585C503 System5595 System85C503 ISA180 SATA181 SATA182 SATA1901915597/5598 VGA6215300/305/630 VGA85C50185C49685C596530 PCI540 PCI550 PCI85C601 EIDE620 PCI630 PCI633 PCI635 PCI640 PCI645 PCI646 PCI648 PCI649 PCI650 PCI651 PCI652 PCI655 PCI656 PCI658 PCI661 PCI730 PCI733 PCI735 PCI740 PCI741 PCI745 PCI746 PCI748 PCI750 PCI751 PCI752 PCI755 PCI756 PCI760 PCI900 10/100BaseTX961 ISA962 ISA963 ISA964 ISA965 ISA966 ISA551155125513 EIDE5571 PCI558155825591 PCI55965597/5598 Host620462056300530 VGA650 VGA6326 VGA6330 VGA5597/5598 USB7002 USB7007 FireWire7012 AC977013 Modem7016 10/100BaseTX7018 Audio966 HD Audio83C170 (EPIC/100)83C175 (EPIC/100)FDC 37C665FDC 37C922LynxEMLynxEM+Lynx3DMLynxELynxE+Lynx3D910Victory66 IDEVictory66 ISAVictory66 USBVictory66 PowerPirahna 2-portTulip, power, switch extenderFPGA I-Bus Tracer for MBDSZB6120CXD1947A FireWireCXD3222 FireWireMemory Stick SlotVelocity128PCIO Ebus2HMEPCIO Ebus2 (US III)ERI EtherGEMSimba PCI-PCICrypto 5821Crypto 1KPsycho PCImicroSPARC IIep PCIUltraSPARC IIi PCIUltraSPARC IIe PCICassiniST201ST1023ST202140XX4018ANE-344S2PSpectrum24 LA41X382C10182C10382C10582C565 ISAMC322TC9021 GigETC9021 GigE (alt ID)DC-290(M)DC-690CDC-3x5UTerratec TV+Terratec TValueTerratec TValue RadioTLAN3DLabs Permedia3DLabs Permedia 2TSB12LV21 FireWireTSB12LV22 FireWirePCI4450 FireWirePCI4410 FireWireTSB12LV23 FireWireTSB12LV26 FireWireTSB43AA22 FireWireTSB43AB22 FireWireTSB43AB23 FireWireTSB43AB21 FireWirePCI4451 FireWirePCI4510 FireWirePCI4520 FireWirePCI7(4-6)10 FireWirePCI7x20 FireWirePCI7XX1 CardBusPCI7XX1 FireWirePCI7XX1 FlashPCI7XX1 Secure DataPCI7XX1 Smart CardPCI6515 CardBusPCI6515 CardBus (Smart Card mode)PCI1620 MiscACX100AACX100BACX111PCI1130 CardBusPCI1031 PCMCIAPCI1131 CardBusPCI1250 CardBusPCI1220 CardBusPCI1221 CardBusPCI1210 CardBusPCI1450 CardBusPCI1225 CardBusPCI1251 CardBusPCI1211 CardBusPCI1251B CardBusPCI2030 PCI-PCIPCI2031 PCI-PCIPCI2250 PCI-PCIPCI2050 PCI-PCIPCI4450 CardBusPCI4410 CardBusPCI4451 CardBusPCI4510 CardBusPCI4520 CardBusPCI7510 CardBusPCI7610 CardBusPCI7410 CardBusPCI7610 CardBus (Smart Card mode)PCI7[46]10 CardBus (SD/MMC mode)PCI7[46]10 CardBus (Memory stick mode)PCI1410 CardBusPCI1420 CardBusPCI1451 CardBusPCI1421 CardBusPCI1620 CardBusPCI1520 CardBusPCI1510 CardBusPCI1530 CardBusPCI1515 CardBusPCI2040 DSPPCI7420 CardBusPCI interface5634PCV SurfRiderR4x00TC35856F ATM (Meteor)R4x00 PCIToPIC95 CardBus-PCIToPIC95B CardBusToPIC97 CardBusToPIC100 CardBusFast Infrared Type OSD ControllerVirtual NorthbridgeMem1Mem24DWAVE DX4DWAVE NXCyberBlade i7CyberBlade i7 AGPCyberBlade i1CyberBlade i1 AGPCyberBlade Ai1CyberBlade Ai1 AGPCyberBlade XP/Ai1TGUI 9320TGUI 9350TGUI 9360TGUI 9388CYBER 9397CYBER 9397DVDTGUI 9420TGUI 9440CYBER 9525TGUI 9660TGUI 9680TGUI 96823DImage 97503DImage 9850Blade 3DCyberBlade XPHPT343/345 IDEHPT36x/37x IDEHPT372A IDEHPT302 IDEHPT371 IDEHPT374 IDEPyramid3D TR25202ET4000w32p rev AET4000w32p rev BET4000w32p rev CET4000w32p rev DET6000/ET6100ET6300IGA-1680IGA-1682IGA-1683CyberPro 2000CyberPro 2010CyberPro 5000CyberPro 5050CyberPro 5202CyberPro 5252Santa CruzUM82C881 486UM82C886 ISAUM8673F EIDEUM8881 HB4 486 PCIUM82C891UM886AUM8886BFUM8710UM8886UM8881F HostUM8886F ISAUM8886AUM8891AUM9017FUM8886NUM8891NUS201USR9979023CP5610V961PBC i960 PCIV292PBC AMD290x0 PCIV960PBC i960 PCIV96DPC i960 PCIK8M800 HostK8T890 HostPT880 HostPM800 AGPKT880 AGPK8HTB HostVT8363 HostCN700 HostVT8371 HostVT8501VT82C505VT82C561VT82C571 IDEVT82C576 3VVT82C585 ISAVT82C586 ISAVT8237A SATAVT82C595 PCIVT82C596A ISAVT82C597 PCIVT82C598 PCIVT8601 PCIVT8605 PCIVT82C686 ISAVT82C691 PCIVT82C693 PCIVT86C926 AmazonVT82C570M PCIVT82C570M ISAPM800 ErrorsKT880 HostVT82C416 IDEVT82C1595 PCIPM800 HostVT8251 PCIVT8251 PCIEVT8251 VLINKVT83C572 USBVT82C586 PowerRhine/RhineIIVT6306 FireWireVT82C596 PowerVT82C596B PMVT6105M RhineIIIVT82C686 SMBusVT82C686 AC97VT8233 AC97RhineII-2VT82C686 ModemVT8233 ISAVT8633 PCIVT8366 PCIVT8653 PCIVT6202 USBVT6105 RhineIIIS3 Unichrome PRO IGPVT8361 PCIVT8375 PCIPM800 Unichrome S3VT612xCLE266VT8623 PCIVT8233A ISAVT8751 PCIVT6420 SATAVT6410 IDEP4X400 HostVT8235 ISAP4N333 HostVT8377 PCIVT8378 PCIPT890 HostK8T800M HostVT8237 ISAVT6421 SATAPM800 DRAMVT8251 ISAVT8251 SATAPM800 PMCK8T890 IOAPICVT8378 VGAPM800 PCIVT8231 ISAVT8231 PMGVT8363 AGPVT8371 PCI-PCIVT8501 AGPVT82C597 AGPVT82C598 AGPVT82C601 AGPVT8605 AGPK8T890 PCI-PCIVT8633 AGPVT8366 AGPVT8361 AGPVT8363 PCI-PCIVT8235 AGPK8HTB AGPVT8377 AGPVSC-7174 SATAGDT6000/6020/6050GDT6000B/6010GDT6110/6510GDT6120/6520GDT6530GDT6550GDT6x17GDT6x27GDT6537GDT6557GDT6x15GDT6x25GDT6535GDT6555GDT6x17RPGDT6x27RPGDT6537RPGDT6557RPGDT6x11RPGDT6x21RPGDT6x17RP1GDT6x27RP1GDT6537RP1GDT6557RP1GDT6x11RP1GDT6x21RP1GDT6x18RDGDT6x28RDGDT6x38RDGDT6x58RDGDT6x17RP2GDT6x27RP2GDT6537RP2GDT6557RP2GDT6x11RP2GDT6x21RP2GDT6513RSGDT6523RSGDT6518RSGDT6x28RSGDT6x38RSGDT6x58RSGDT6x33RSGDT6x43RSGDT6x53RSGDT6x63RSGDT7x13RNGDT7x23RNGDT7x18RNGDT7x28RNGDT7x38RNGDT7x58RNGDT7x43RNGDT7x53RNGDT7x63RNGDT4x13RZGDT4x23RZGDT8x13RZGDT8x23RZGDT8x33RZGDT8x43RZGDT8x53RZGDT8x63RZGDT6x19RDGDT6x29RDGDT7x19RNGDT7x29RNGDT8x22RZICP82C592 CPU82C593 ISA82C594 Wildcat82C596/597 Wildcat ISA82C54182C54382C53282C53482C53582C14782C97582C925Virtual SVGA IIVirtual SVGAVirtual NICP9000P9100WD33C193AWD33C196AWD33C197AWD7193WD7197WD33C296AWD34C296WD9610W83769FW89C840F 10/100Linksys EtherPCI IIW83C553F ISAW83C553FW89C940FW6692 ISDNLinksys EtherPCIVolari Z7X3201-3X3201-3 (21143)CardBus EthernetMini-PCI V.90 56k ModemMini-PCI K56Flex ModemCardBus 56k ModemCBEM56G Modem724734738737740740C724F7441221PCI-ST32Genie TV/FMDVDZD1201ZD1202ZD1205Martin-MariettaHauppaugeTTTechDynalinkCompaqSymbios LogicATIULSI SystemsVLSIAvance LogicNSTseng LabsWeitekDECCirrus LogicWestern DigitalAMIAMDTridentAcerDellSiemens Nixdorf AGMatroxChips and TechnologiesToshibaMiro Computer Products AGNECFuture DomainSiSHewlett-PackardPC TechnologyAsustekDPTOptiElsaSGS ThomsonBusLogicTISonyOak TechnologyWinbondSMSCMotorolaPromiseNumber 9UMCI. T. T.PicopowerMylexAppleMitacYamahaNexGen MicrosystemsQLogicCyrixLeadTek ResearchInterphaseContaq MicrosystemsBit3OlicomSunIntergraphDiamond MultimediaNational InstrumentsCMD TechnologyQuantum DesignsBrooktreeSGIACC MicroelectronicsSymphony LabsSTB SystemsPLXMadge Networks3ComSMCAcer LabsMitsubishi ElectronicsSurecomNeomagicMentor ARCAdvansysMolexMacronixEvans & SutherlandNVIDIAEmulexIntegrated Micro SolutionsTekram (1st ID)NewbridgeApplied Micro CircuitsTviaRealtekNKKIO Data DeviceInitioCreative LabsHighPointSigma DesignsVIACogent DataSiemensZnyx NetworksAcctonVortexEfficent NetworksIDTFORE SystemsPhilipsZiatechCycloneEquinoxAlliance SemiconductorSchneider & KochDigiMutechXircomRenditionServerWorksRicohD-Link SystemsCorrollaryAcardZeinetOmega MicroMarvellLite-OnV3 SemiconductorPinnacle SystemsAT&T/LucentDolphinMesa Ridge (MAGMA)Analog DevicesZoranPijnenburgCompexCycladesEssential CommunicationsO2 Micro3DFX InteractiveATMLC-CubeAVMCoregaASIXIntersilNortel NetworksSilicon MotionEnsoniqTransmetaRockwellDavicomITExpressPlatformLuxSonorTriTech MicroelectronicsAlteonUS RoboticsNVIDIA/SGS-ThomsonPericomAurealADMtekPacket EnginesForte MediaSIIGDTC TechPCTELCNetLAN MediaNetgearMoxaLevel 1Hifn3wareAbocomSundanceC-Media ElectronicsLavaSunixIC EnsembleMicrosoftOxfordChelsioTamarackAskeyAvermediaAironetGlobespanMyricomVScomAvlabInvertexBroadcomPlanexConexantMyson CenturyTopic/SmartLinkENEAralionTerraTecSymbolSybaBluesteelVMwareZoltrixAgilentNational DatacommPacific DataEumitcomNetSecZyDAS TechnologySamsungAtherosGlobal SunSafeNetMicrelVitesseLinksysNetoctaveAltimaAntares MicrosystemsCaviumBelkinHawking TechnologyI4ArecaNeterionINPROCOMMLanergyRalinkXGI TechnologySangomaOptionJMicronTekramHint3D LabsAddtronIndustrial Computer SourceNetVinGemtekTurtle Beachc't MagazinIntelAdaptecAtronicsNetMosParallelsTigerJet NetworkEndaceBelkin ComponentsARC LogicINVALID VENDOR ID"%s %s"unknown class 0x%02x, subclass 0x%02xclass %s subclass %sclass %s unknown subclass 0x%02x, rev 0x%02x) rev 0x%02xvendor "%s", unknown product 0x%04x%svendor 0x%04x product 0x%04xunknown cy82c693_init: bus_space_map failed (%d)cy82c693_initcy82c693_readcy82c693_write: broken match/attach! : couldn't map interrupt : invalid memory type %d , using %luK of on-board RAM, can't map on-board RAM: couldn't establish interrupt: unable to map device registers pciide%s: couldn't map %s cmd regs %s: couldn't map %s ctl regs %s: couldn't map native-PCI interrupt unknown interrupt%s: using %s for native-PCI interrupt %s: unable to subregion %s ctl regs %s: couldn't establish native-PCI interrupt, (unsupported maptype 0x%x), unused (couldn't query registers), unused (registers at unsafe address %#lx), unused (couldn't map registers)%s:%d: unable to allocate table DMA for drive %d, error=%d %s:%d: unable to map table DMA fordrive %d, error=%d %s:%d: unable to create table DMA map for drive %d, error=%d %s:%d: unable to load table DMA map for drive %d, error=%d %s:%d: unable to create xfer DMA map for drive %d, error=%d %s:%d: unable to load xfer DMA map fordrive %d, error=%d %s:%d:%d: bus-master DMA error: missing interrupt, status=0x%x %s:%d:%d: bus-master DMA error: status=0x%x channel 0channel 1%s: %s cannot allocate memory for command queue%s: %s disabled (no drives) %s: no compatibility interrupt for use by %s configuredwiredcompatibilitynative-PCI, %s %s to %s: DMA%s:%d:%d: cannot allocate DMA maps, using PIO transfers %s:%d:%d: using DMA data transfers not responding; disabled or no drives?other hardware responding at addresses%s: %s ignored (%s) , (partial support) (unsupported): no DMA%s: %s ignored (disabled) %s:%d:%d: multi-word DMA disabled due to chip revision : ATA33: ATA66: ATA100: ATA133 %s: bus-master DMA support present%s: %s %s to %s mode %s %s: can't allocate memory for command queue: unable to map BA5 register space %s: port %d: device connected, but communication not established %s: port %d: unknown SStatus: 0x%08x %s: port %d: device present, speed: 3.0Gb/s, speed: 1.5Gb/s%s: port %d: PHY offline : can't subregion offset %lu size %luport 0port 1port 2port 3%s %s channel: can't allocate memory for command queue%s: couldn't subregion %s cmd base %s: couldn't subregion %s ctl base %s: couldn't subregion %s channel cmd regs : unexpected PCI function %d , %s %s to native-PCI compatibility : cannot allocate memory for command queue , (unable to map ctl registers)540620630630S633635645645DX650651652655658661730733735741745746748760962963: 5597/5598unknown SiS IDE type %d %s:%d: error intr %s:%d: bogus intr %s: unexpected PCI function %d %s: no known timing values %s:%d: bogus intr (reg 0x%x) : couldn't establish native-PCI interrupt: couldn't map bus-master DMA registers : couldn't map IDE registers : DMA %s: channel %d: can't allocate memory for command queue %s: couldn't map channel %d ctl regs %s: couldn't map channel %d cmd regs %s channel %d: can't subregion DMA registers : can't map mem or i/o space : chip is is in D%d power mode -- setting to D0%s: Allocation of PCI resources failed %s: Unable to initialize the hardware %s: EEPROM read error while reading mac address %s: Invalid mac address %s: PHY reset is blocked due to SOL/IDER session. %s: Unable to allocate rx_desc memory %s: Unable to allocate tx_desc memory %s: watchdog timeout -- resetting %s: Could not setup transmit structures %s: Could not setup receive structures %s: Unsupported media type em_set_multi%s: Unknown MAC Type : mmba is not mem space : cannot find i/o space : flash is not mem space : cannot find mem space %s: The EEPROM Checksum Is Not Valid %s: Hardware Initialization Failed%s: EEPROM read error while reading part number %s: em_dma_malloc: bus_dmamap_load failed; error %u %s: em_dma_malloc: bus_dmammem_map failed; size %lu, error %d %s: em_dma_malloc: bus_dmammem_alloc failed; size %lu, error %d %s: em_dma_malloc: bus_dmamap_create failed; error %u %s: Unable to allocate tx_buffer memory %s: em_allocate_receive_structures: bus_dmamap_create failed; error %u %s: Unable to allocate rx_buffer memory %s: Excessive collisions = %lld %s: Symbol errors = %lld %s: Sequence errors = %lld %s: Defer count = %lld %s: Missed Packets = %lld %s: Receive No Buffers = %lld %s: Receive Length Errors = %lld %s: Receive errors = %lld %s: Crc errors = %lld %s: Alignment errors = %lld %s: Carrier extension errors = %lld %s: RX overruns = %ld %s: watchdog timeouts = %ld %s: XON Rcvd = %lld %s: XON Xmtd = %lld %s: XOFF Rcvd = %lld %s: XOFF Xmtd = %lld %s: Good Packets Rcvd = %lld %s: Good Packets Xmtd = %lld : can't map i/o space %s: init failed, error=%d : can't map mem space %s: unable to establish powerhook : can't map memory space %s: pre-2.0 USB rev %s: timed out waiting for BIOS : could not map memory space : could not map interrupt : could not establish interruptpciide_machdep_compat_intr_establish called pciide_machdep_compat_intr_disestablish called atapiscsiwdc_atapi_start: not ready, st = %02x wdc_atapi_intr_command%s:%d:%d: device timeout waiting to send SCSI packet unexpected data phasezero length transfer requested in data phasedata transfer direction disagreementdata phase where none expecteddata transfer direction disagreement during senseunexpectedly in command phasewdc_atapi_intr: warning: device requesting %d bytes, only %d left in buffer wdc_atapi_intr: warning: reading only %d of %d bytes atapiscsi: Shouldn't get here %s:%d:%d: device timeout, c_bcount=%d, c_skip=%d, status=0x%b, ireason=0x%x Device Reset WaitIdentifyPost-IdentifyPIOMODEunknown state%s:%d:%d: soft reset failed  4hd'(2` d:@:@:@:A::A:A:A: A:(A:0A:8A:Д;+2+DR+<** *X*<k** *X*g*Dv*<-<>-<\?-~!j EX j EX j E  !j EX j EX j EX ?'!j EX j EX j EX ?W>aj EX j EX j E ~!j E`*j E`*j E aj E`*j E`*j E Uκ!j E`*j E`*j E <~m+aj E`*j E`*j E  ;!j E`*j E`*j E I@taj E`*j E`*j E i!j E`*j E`*j E A0!j E`*j E`*j E`*<H!j E`*j E`*j E`*(w9!j E`*j E`*j E`*(!j E`*j E`*j E`*(~rC!j E`*j E`*j E`*(P!j E`*j E`*j E`*( i!j EhK1j EhK1j EhK1=>7!j EhK1j EhK1j EhK1"Xb!j EhK1j EhK1j EhK1"V_j E(j E0pj E0pVSj E8? j ECj ECP X ` h p x POy)j Ej ECj ECj E*j E*j E*ԽGYj EhFj EhFj EhF/tmp/disktab.shadowj Ezj Ezj Ez/tmp/fstab.shadow%j Ej Ej E/tmp/resolv.conf.shadowFY j E /j E /j E //tmp/hostsE*G j E0qs E:s E:=s E% s Eqs EH]5+s E0 @s E2s E2op}s Eys Es E}e s E|s E "s EH]5Pqs E8$s Edž*s EH]5  rs EK,s E@4s E@4 :+'SÑ W.eAF2\ ,;APH\G$iv}{])(] rKmzKC|n/2n4{4фPNne/ Djz5+| VhL==TA-Ktb%P 4?sgaV62s(M^uҊ7p993йoл(Yfvs"&>-R5;Y4;4ΌzHA&]A C|2uq0T h :&H [_*_\.{Nܺ(X}L[ҟh'=|*$TL8l2?n2["Xaq;I͟s*m 6<1mYӌ?#d\:"q Wh v2VNYD@w ;csA0l0rYr2O-sd\y^obCѵ͍lAY});ӺEewtTts\a77\radml6o$m8H s|[KIyF\ [*i?UVkmwZl\f~Hv}4䧝 W`!zYUFC>Y{6e[  Z Uh\i֜_ 4qvAk>"ivz$KI/J7"&L~B)>y7-|fՃoC 8J!,zOJcg m+GMj2c8T"s1}G+|'J3ubU@Y2;OLjZ<[c;AT& F3_249 fC?Īz3>F+{%t)WNm'_?K4,)MQ =2sDnd)thPng?e]7DD!$L_3e/Zx*Wt&UCT͂P!s0 uy7KP)&kl况ZB[5 C3-$`{"k,1CSrnIT?Uš"ֵ]7 &$&pQ4>s@އb*aXBWr ߻0 =$l6䪯UҦE͍oK(|*i8zkh'D` zJ Ycgր5 we8^dIq.Ln,2Ž (yei[O 2&*n~jm2;@Lw |C$juOrd28/qFfors6d 54CR ޘ$8S :1EӀI.|+ney;7KDHʡPC TgO(y3gيGKC _z-J   . .. catchmodchgrp cp dd df edexprMhostnamet8 ksh sh ln lsmkdir mteject mv pax tarcpioM rmsttyMsyncMsleepip 0 IP icmp 1 ICMP tcp 6 TCP udp 17 UDP  . .. pppfirmwaregroup8spwd.db protocolsservices disktab fstab+ resolv.confL hosts+ ... ... ... ... . .. bin dev etc mnt mnt2 sbin tmp usrvarinstbin.profile install.mdupgradeinstall install.sub . ..chowndhclientt8 disklabel8dmesgfdiskfsckM fsck_ext2fsfsck_ffst8ifconfigt8initMmknodmount mount_cd9660 , mount_ext2fs , mount_ffs8 mount_msdos mount_nfs8newfs newfs_msdospingMping6reboothaltMroutertsol$umount ... . .. binmdecsbinshare . .. ftpgrepMfgrepegrepgzipMgunzipgzcatlessMmoreM\sed . .. . .. . ..misckeymaps . ..termcap ... . .. tmp db runempty ... ... ... ...ftp-data 20/tcp ftp 21/tcp domain 53/tcp nameserver domain 53/udp nameserver www 80/tcp http shell 514/tcp cmd nfsd 2049/udp nfs nfsd 2049/tcp nfs #!/bin/sh - PATH=/sbin:/usr/sbin:/bin:/usr/bin T=$0 [ "$eo" ] || eo= hex() { case $1 in [0-9]) echo -n $1;; 10) echo -n a;; 11) echo -n b;; 12) echo -n c;; 13) echo -n d;; 14) echo -n e;; 15) echo -n f;; esac } alph2d() { local t="$1" local p="0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ" local sub=${p%${t}*} echo ${#sub} } h2d() { local s="$1" local f=${s%*[0-9a-f]} n=${s#[0-9a-f]*} echo $(($(_h2d $f)*16+ $(_h2d $n) )) } _h2d() { case $1 in [0-9]) echo -n $1;; a) echo -n 10;; b) echo -n 11;; c) echo -n 12;; d) echo -n 13;; e) echo -n 14;; f) echo -n 15;; esac } unt() { arg="$1" tmp="${arg#[a-zA-Z]*}" tmp="${tmp%*[a-zA-Z]}" while [ "$tmp" != "$arg" ] do arg=$tmp tmp="${arg#[a-zA-Z]*}" tmp="${tmp%*[a-zA-Z]}" done echo $arg } dodisk() { [ "$DEBUG" ] && set -x n=$(($((${5}*${7:-16}))+${6})) count=0 [ 0$7 -ne 8 ] && l="i j k l m n o p" for d in a b c d e f g h $l do M $1$2$d b $3 $(($n+$count)) 640 operator M r$1$2$d c $4 $(($n+$count)) 640 operator let count=count+1 done } dodisk2() { n=$(($(($5*${7:-16}))+$6)) M $1$2a b $3 $n 640 operator M r$1$2a c $4 $n 640 operator n=$(($n+2)) M $1$2c b $3 $n 640 operator M r$1$2c c $4 $n 640 operator } RMlist[0]="rm -f" mkl() { mklist[${#mklist[*]}]=";mknod -m $1 $2 $3 $4 $5" } M() { RMlist[${#RMlist[*]}]=$1 mkl ${5-666} $1 $2 $3 $4 G=${6:-wheel} [ "$7" ] && { MKlist[${#MKlist[*]}]=";chown $7:$G $1" } || { case $G in wheel) [ ${#whlist[*]} = 0 ] && whlist[0]=";chgrp wheel" whlist[${#whlist[*]}]="$1" ;; operator) [ ${#oplist[*]} = 0 ] && oplist[0]=";chgrp operator" oplist[${#oplist[*]}]="$1" ;; *) MKlist[${#MKlist[*]}]=";chgrp $G $1"; esac } return 0 } R() { [ "$DEBUG" ] && set -x for i in "$@" do U=`unt $i` [ "$U" ] || U=0 case $i in ramdisk) R std bpf0 wd0 wd1 sd0 tty00 rd0 wsmouse R st0 ttyC0 random wskbd0 apm ;; std) M console c 0 0 600 M tty c 1 0 M mem c 2 0 640 kmem M kmem c 2 1 640 kmem M null c 2 2 M zero c 2 12 M stdin c 7 0 M stdout c 7 1 M stderr c 7 2 M ksyms c 8 0 640 kmem M drum c 3 0 640 kmem M klog c 6 0 600 ;; xfs*) M xfs$U c 51 $U 600 ;; tuner*) M tuner$U c 75 $(($(($U*2))+16)) 644 ;; systrace) M systrace c 50 0 644 ;; ss*) M ss$U c 29 $(($U*16)) 640 operator M nss$U c 29 $(($(($U*16))+1)) 640 operator M enss$U c 29 $(($(($U*16))+3)) 640 operator RMlist[${#RMlist[*]}]="scan$U" MKlist[${#MKlist[*]}]=";umask 77;ln -s ss$U scan$U" ;; uk*) M uk$U c 28 $U 640 operator ;; tun*) M tun$U c 33 $U 600 ;; *random) n=0 for pre in " " s u p a do M ${pre}random c 40 $n 644 n=$(($n+1)) done ;; radio*) M radio$U c 97 $U MKlist[${#MKlist[*]}]=";[ -e radio ] || ln -s radio$U radio" ;; pf*) M pf c 46 0 600 ;; pci) M pci c 88 0 600 ;; lkm) M lkm c 35 0 640 _lkm ;; iop*) M iop$U c 73 $U 660 ;; fd) RMlist[${#RMlist[*]}]=";mkdir -p fd;rm -f" n=0 while [ $n -lt 64 ];do M fd/$n c 7 $n;n=$(($n+1));done MKlist[${#MKlist[*]}]=";chmod 555 fd" ;; crypto) M crypto c 47 0 ;; bpf*) M bpf$U c 22 $U 600 ;; bktr*) M bktr$U c 75 $U 644 ;; hotplug) M hotplug c 37 $U 400 ;; audio*) M sound$U c 36 $U M mixer$U c 36 $(($U+16)) M audio$U c 36 $(($U+128)) M audioctl$U c 36 $(($U+192)) MKlist[${#MKlist[*]}]=";[ -e audio ] || ln -s audio$U audio" MKlist[${#MKlist[*]}]=";[ -e mixer ] || ln -s mixer$U mixer" MKlist[${#MKlist[*]}]=";[ -e sound ] || ln -s sound$U sound" MKlist[${#MKlist[*]}]=";[ -e audioctl ] || ln -s audioctl$U audioctl" ;; apm*) M apm c 34 0 644 M apmctl c 34 8 644 ;; uscanner*) M uscanner$U c 69 $U 660 ;; usb*) [ "$i" = "usb" ] && u= || u=$U M usb$u c 64 $U 660 ;; urio*) M urio$U c 67 $U 660 ;; ulpt*) M ulpt$U c 66 $U 660 ;; uhid*) M uhid$U c 65 $U 660 ;; ugen*) n=$(($U*16)) for j in 0{0,1,2,3,4,5,6,7,8,9} 1{0,1,2,3,4,5} do M ugen$U.$j c 70 $(($n+10#$j)) 660 done ;; ttyU[0-9a-zA-Z]) U=${i#ttyU*} o=$(alph2d $U) M ttyU$U c 68 $o 660 dialer uucp M cuaU$U c 68 $(($o+128)) 660 dialer uucp ;; uall) R ttyU0 ttyU1 ugen0 ugen1 ulpt0 ulpt1 uhid0 uhid1 uhid2 uhid3 R uscanner0 urio0 usb0 usb1 usb2 usb3 usb4 usb5 ;; wsmux|wsmouse|wskbd) M wsmouse c 63 0 600 M wskbd c 63 1 600 ;; wsmouse*) M wsmouse$U c 62 $U 600 ;; wskbd*) M wskbd$U c 61 $U 600 ;; tty[C-J]*) U=${i##tty[C-J]} case $i in ttyC*) n=C m=0;; ttyD*) n=D m=256;; ttyE*) n=E m=512;; ttyF*) n=F m=768;; ttyG*) n=G m=1024;; ttyH*) n=H m=1280;; ttyI*) n=I m=1536;; ttyJ*) n=J m=1792;; esac case $U in [0-9a-f]) M tty$n$U c 60 $((16#$U+$m)) 600;; cfg) M tty${n}cfg c 60 $((255+$m)) 600;; *) echo bad unit $U for $i; exit 1;; esac ;; wscons) R wsmouse0 wsmouse1 wsmouse2 wsmouse3 wskbd0 wskbd1 wskbd2 R wskbd3 wsmux ttyCcfg ttyC0 ttyC1 ttyC2 ttyC3 ttyC4 ttyC5 R ttyC6 ttyC7 ttyC8 ttyC9 ttyCa ttyCb ;; pty*) if [ $U -gt 15 ]; then echo bad unit for pty in: $i continue fi set -A letters p q r s t u v w x y z P Q R S T set -A suffixes 0 1 2 3 4 5 6 7 8 9 a b c d e f g h i j k l m n o p q \ r s t u v w x y z A B C D E F G H I J K L M N O P Q R S T U V W X \ Y Z name=${letters[$U]} n=0 while [ $n -lt 62 ] do nam=$name${suffixes[$n]} off=$(($U*62)) M tty$nam c 4 $(($off+$n)) M pty$nam c 5 $(($off+$n)) n=$(($n+1)) done ;; ptm) M ptm c 98 0 666 ;; tty[0-7][0-9a-f]) U=${i#tty*} o=$(h2d $U) M tty$U c 12 $o 660 dialer uucp M cua$U c 12 $(($o+128)) 660 dialer uucp ;; st*) n=$(($U*16)) for pre in " " n e en do M ${pre}st$U b 25 $n 660 operator M ${pre}rst$U c 25 $n 660 operator n=$(($n+1)) done ;; vnd*) dodisk vnd $U 19 19 $U 0 dodisk svnd $U 19 19 $U 2048 ;; rd*) dodisk2 rd $U 18 18 $U 0 ;; ch*) M ch$U c 27 $U 660 operator ;; cd*) dodisk2 cd $U 26 26 $U 0 ;; local) test -s $T.local && sh $T.local ;; all) R ccd0 ccd1 ccd2 ccd3 vnd0 vnd1 vnd2 vnd3 sd0 sd1 sd2 sd3 sd4 R cd0 cd1 rd0 tun0 tun1 tun2 tun3 bpf0 bpf1 bpf2 bpf3 bpf4 R bpf5 bpf6 bpf7 bpf8 bpf9 pty0 xfs0 ss0 ss1 ch0 hotplug ptm R local wscons pci iop0 iop1 uall tuner0 radio0 audio0 uk0 R random lkm tty00 tty01 tty02 tty03 apm crypto pf systrace R wd0 wd1 wd2 wd3 raid0 raid1 raid2 raid3 std st0 st1 fd ;; wd*|sd*|raid*|ccd*) case $i in wd*) dodisk wd $U 16 16 $U 0;; sd*) dodisk sd $U 24 24 $U 0;; raid*) dodisk raid $U 71 71 $U 0;; ccd*) dodisk ccd $U 21 21 $U 0;; esac ;; *) echo $i: unknown device ;; esac done } R "$@" { echo -n ${RMlist[*]} echo -n ${mklist[*]} echo -n ${MKlist[*]} echo -n ${whlist[*]} echo ${oplist[*]} } | if [ "$eo" = "echo" ]; then cat else sh fi wheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root bin:*:7: news:*:8: wsrc:*:9: users:*:10: auth:*:11: games:*:13: staff:*:20:root smmsp:*:25: popa3d:*:26: sshd:*:27: _portmap:*:28: _identd:*:29: _rstatd:*:30: guest:*:31:root _rusersd:*:32: _fingerd:*:33: _sshagnt:*:34: _x11:*:35: utmp:*:45: _kdc:*:59: _kadmin:*:60: _lkm:*:61: _spamd:*:62: _radius:*:63: _token:*:64: _shadow:*:65: crontab:*:66: www:*:67: _isakmpd:*:68: network:*:69: named:*:70: proxy:*:71: authpf:*:72: _syslogd:*:73: _pflogd:*:74: _bgpd:*:75: _tcpdump:*:76: _dhcp:*:77: _mopd:*:78: _tftpd:*:79: _rbootd:*:80: _afs:*:81: _ppp:*:82: _ntp:*:83: _ftp:*:84: _ospfd:*:85: _hostapd:*:86: _dvmrpd:*:87: dialer:*:117: nogroup:*:32766: nobody:*:32767: Xrwd1iYwd1jZrwd1j[wd1k\rwd1k]wd1l^rwd1l_wd1m`rwd1mawd1nbrwd1ncwd1odrwd1oewd1pfrwd1pgsd0ahrsd0aisd0bjrsd0bksd0clrsd0cmsd0dnrsd0dosd0eprsd0eqsd0frrsd0fssd0gtrsd0gusd0hvrsd0hwsd0i . ..MAKEDEVconsole tty memkmemnullzero stdin!stdout"stderr#ksyms$drum%klog&bpf0'wd0a(rwd0a)wd0b*rwd0b+wd0c,rwd0c-wd0d.rwd0d/wd0e0rwd0e1wd0f2rwd0f3wd0g4rwd0g5wd0h6rwd0h7wd0i8rwd0i9wd0j:rwd0j;wd0k<rwd0k=wd0l>rwd0l?wd0m@rwd0mAwd0nBrwd0nCwd0oDrwd0oEwd0pFrwd0pGwd1aHrwd1aIwd1bJrwd1bKwd1cLrwd1cMwd1dNrwd1dOwd1ePrwd1eQwd1fRrwd1fSwd1gTrwd1gUwd1hVrwd1hWwd1iXrwd1iYwd1jZrwd1j[wd1k\rwd1k]wd1l^rwd1l_wd1m`rwd1mawd1nbrwd1ncwd1odrwd1oewd1pfrwd1pgsd0ahrsd0aisd0bjrsd0bksd0clrsd0cmsd0dnrsd0dosd0eprsd0eqsd0frrsd0fssd0gtrsd0gusd0hvrsd0hwsd0ixrsd0iysd0jzrsd0j{sd0k|rsd0k}sd0l~rsd0lsd0mrsd0msd0nrsd0nsd0orsd0osd0prsd0ptty00cua00rd0arrd0ard0crrd0cwsmousewskbd st0rst0nst0nrst0est0erst0enst0enrst0ttyC0randomsrandomurandomprandomarandomwskbd0 apmapmctl . ..chowndhclientt8 disklabel8dmesgfdiskfsckM fsck_ext2fsfsck_ffst8ifconfigt8initMmknodmount mount_cd9660 , mount_ext2fs , mount_ffs8 mount_msdos mount_nfs8newfs newfs_msdospingMping6reboothaltMroutertsol$umountdhclient-script dumb|80-column dumb tty:\ :am:\ :co#80:\ :bl=^G:cr=^M:do=^J:sf=^J: vt100|vt100-am|dec vt100 (w/advanced video):\ :am:bs:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :@8=\EOM:DO=\E[%dB:K1=\EOq:K2=\EOr:K3=\EOs:K4=\EOp:K5=\EOn:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=^O:as=^N:bl=^G:cb=\E[1K:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:do=^J:\ :eA=\E(B\E)0:ho=\E[H:k0=\EOy:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k5=\EOt:k6=\EOu:k7=\EOv:k8=\EOl:k9=\EOw:k;=\EOx:\ :kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:kr=\EOC:ks=\E[?1h\E=:\ :ku=\EOA:le=^H:mb=\E[5m:md=\E[1m:me=\E[m\017:mr=\E[7m:\ :nd=\E[C:rc=\E8:rs=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :..sa=\E[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t\016%e\017%;:\ :sc=\E7:se=\E[m:sf=^J:so=\E[7m:sr=\EM:st=\EH:ta=^I:ue=\E[m:\ :up=\E[A:us=\E[4m: vt220|vt200|DEC VT220 in vt100 emulation mode:\ :am:bs:mi:pt:xn:xo:\ :co#80:li#24:vt#3:\ :@7=\E[4~:RA=\E[?7l:SA=\E[?7h:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\E(B:al=\E[L:as=\E(0:bl=^G:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[2J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :dc=\E[P:dl=\E[M:do=\E[B:ei=\E[4l:ho=\E[H:\ :if=/usr/share/tabset/vt100:im=\E[4h:\ :is=\E[1;24r\E[24;1H:k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:\ :k5=\E[17~:k6=\E[18~:k7=\E[19~:k8=\E[20~:k9=\E[21~:\ :k;=\E[29~:kD=\E[3~:kI=\E[2~:kN=\E[6~:kP=\E[5~:kb=\177:\ :kd=\E[B:kh=\E[1~:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:nl=^J:rc=\E8:\ :rf=/usr/share/tabset/vt100:\ :rs=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :..sa=\E[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t\E(0%e\E(B%;:\ :sc=\E7:se=\E[27m:sf=20\ED:so=\E[7m:sr=14\EM:ta=^I:\ :ue=\E[24m:up=\E[A:us=\E[4m:ve=\E[?25h:vi=\E[?25l: export PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ umask 022 set -o emacs rootdisk=`dmesg|sed -n -e '/OpenBSD /h' -e '//!H' -e '${ g p }'|sed -n -e '/^root on \([0-9a-z]*\).*/{ s//\/dev\/\1/ p }'` if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES mount -u ${rootdisk:-/dev/rd0a} / echo 'erase ^?, werase ^W, kill ^U, intr ^C, status ^T' stty newcrt werase ^W intr ^C kill ^U erase ^? status ^T _forceloop="" while [ "X$_forceloop" = X"" ]; do echo -n '(I)nstall' [ -f upgrade ] && echo -n ', (U)pgrade' echo -n ' or (S)hell? ' read _forceloop case "$_forceloop" in i*|I*) /install ;; u*|U*) /upgrade ;; s*|S*) ;; *) _forceloop="" ;; esac done fi bsd base${VERSION}.tgz etc${VERSION}.tgz" : ${EDITOR:=ed} [[ -x /usr/bin/vi ]] && EDITOR=vi export EDITOR [[ -f /etc/fstab ]] && umount -av 1>/dev/null 2>&1 umount -v /mnt 1>/dev/null 2>&1 welcome if [[ $MODE == install && ! -f /etc/fstab ]]; then cat <<__EOT You will now initialize the disk(s) that OpenBSD will use. To enable all available security features you should configure the disk(s) to allow the creation of separate filesystems for /, /tmp, /var, /usr, and /home. __EOT fi set -- $DKDEVS [[ $# -gt 1 ]] && _defdsk=done ask_which "disk" "is the root disk" "$DKDEVS" "$_defdsk" [[ $resp == done ]] && exit makedev $resp || exit ROOTDISK=$resp ROOTDEV=${ROOTDISK}a SWAPDEV=${ROOTDISK}b #!/bin/sh delete_old_address() { if [ -n "$old_ip_address" ]; then ifconfig $interface inet $old_ip_address delete $medium route delete "$old_ip_address" 127.0.0.1 >/dev/null 2>&1 fi } add_new_address() { ifconfig $interface \ inet $new_ip_address \ netmask $new_subnet_mask \ broadcast $new_broadcast_address \ $medium route add $new_ip_address 127.0.0.1 >/dev/null 2>&1 } delete_old_alias() { if [ -n "$alias_ip_address" ]; then ifconfig $interface inet $alias_ip_address delete > /dev/null 2>&1 route delete $alias_ip_address 127.0.0.1 > /dev/null 2>&1 fi } add_new_alias() { if [ -n "$alias_ip_address" ]; then ifconfig $interface inet $alias_ip_address alias netmask \ $alias_subnet_mask route add $alias_ip_address 127.0.0.1 fi } delete_old_routes() { route delete default >/dev/null 2>&1 if [ -n "$old_static_routes" ]; then set $old_static_routes while [ $# -gt 1 ]; do route delete "$1" "$2" shift; shift done fi arp -dan } add_new_routes() { route delete default >/dev/null 2>&1 for router in $new_routers; do if [ "$new_ip_address" = "$router" ]; then route add default -iface $router >/dev/null 2>&1 else route add default $router >/dev/null 2>&1 fi break done if [ -n "$new_static_routes" ]; then set $new_static_routes while [ $# -gt 1 ]; do route add $1 $2 shift; shift done fi } add_new_resolv_conf() { rm -f /etc/resolv.conf.std if [ -n "$new_domain_name" ]; then echo "search $new_domain_name" >>/etc/resolv.conf.std fi if [ -n "$new_domain_name_servers" ]; then for nameserver in $new_domain_name_servers; do echo "nameserver $nameserver" >>/etc/resolv.conf.std done fi if [ -f /etc/resolv.conf.std ]; then if [ -f /etc/resolv.conf.tail ]; then cat /etc/resolv.conf.tail >>/etc/resolv.conf.std fi if [ -f /etc/resolv.conf ]; then cat /etc/resolv.conf > /etc/resolv.conf.save fi cat /etc/resolv.conf.std > /etc/resolv.conf rm -f /etc/resolv.conf.std chown -RL root:wheel /etc/resolv.conf chmod -RL 644 /etc/resolv.conf return 0 fi return 1 } if [ -n "$new_network_number" ]; then echo "New Network Number: $new_network_number" fi if [ -n "$new_broadcast_address" ]; then echo "New Broadcast Address: $new_broadcast_address" fi case $reason in MEDIUM) ifconfig $interface $medium sleep 1 ;; PREINIT) delete_old_alias ifconfig $interface up ;; ARPCHECK|ARPSEND) ;; BOUND|RENEW|REBIND|REBOOT) if [ -n "$old_ip_address" ]; then if [ "$old_ip_address" != "$alias_ip_address" ]; then delete_old_alias fi if [ "$old_ip_address" != "$new_ip_address" ]; then delete_old_address delete_old_routes fi fi if [ "$reason" = BOUND ] || \ [ "$reason" = REBOOT ] || \ [ -z "$old_ip_address" ] || \ [ "$old_ip_address" != "$new_ip_address" ]; then add_new_address add_new_routes fi if [ "$new_ip_address" != "$alias_ip_address" ]; then add_new_alias fi add_new_resolv_conf ;; EXPIRE|FAIL) delete_old_alias if [ -n "$old_ip_address" ]; then delete_old_address delete_old_routes fi add_new_alias if [ -f /etc/resolv.conf.save ]; then cat /etc/resolv.conf.save > /etc/resolv.conf fi ;; TIMEOUT) delete_old_alias add_new_address sleep 1 if [ -n "$new_routers" ]; then set "$new_routers" if ping -q -c 1 -w 1 "$1"; then if [ "$new_ip_address" != "$alias_ip_address" ]; then add_new_alias fi add_new_routes if add_new_resolv_conf; then exit 0 fi fi fi ifconfig $interface inet $new_ip_address delete $medium delete_old_routes exit 1 ;; esac exit 0 MDFSTYPE=msdos ARCH=armish md_installboot() { } md_checkfordisklabel() { local rval=0 disklabel -r $1 >/dev/null 2>/tmp/checkfordisklabel if grep "disk label corrupted" /tmp/checkfordisklabel; then rval=2 fi >/dev/null 2>&1 rm -f /tmp/checkfordisklabel return $rval } md_prep_fdisk() { local _disk=$1 ask_yn "Do you want to use *all* of $_disk for OpenBSD?" if [[ $resp == y ]]; then echo -n "Putting all of $_disk into an active OpenBSD MBR partition (type 'A6')..." fdisk -e ${_disk} <<__EOT >/dev/null reinit update write quit __EOT echo "done." return fi cat <<__EOT You will now create a single MBR partition to contain your OpenBSD data. This partition must have an id of 'A6'; must *NOT* overlap other partitions; and must be marked as the only active partition. The 'manual' command describes all the fdisk commands in detail. $(fdisk ${_disk}) __EOT fdisk -e ${_disk} cat <<__EOT Here is the partition information you chose: $(fdisk ${_disk}) __EOT } md_prep_disklabel() { local _disk=$1 md_prep_fdisk $_disk cat <<__EOT You will now create an OpenBSD disklabel inside the OpenBSD MBR partition. The disklabel defines how OpenBSD splits up the MBR partition into OpenBSD partitions in which filesystems and swap space are created. The offsets used in the disklabel are ABSOLUTE, i.e. relative to the start of the disk, NOT the start of the OpenBSD MBR partition. __EOT md_checkfordisklabel $_disk case $? in 2) echo "WARNING: Label on disk $_disk is corrupted. You will be repairing it.\n" ;; esac disklabel -W $_disk >/dev/null 2>&1 disklabel -f /tmp/fstab.$_disk -E $_disk } md_congrats() { } #!/bin/ksh MODE=upgrade . install.sub while :; do ask "Root filesystem?" "$ROOTDEV" resp=${resp##*/} [[ -b /dev/$resp ]] && break echo "Sorry, $resp is not a block device." done ROOTDEV=$resp echo -n "Checking root filesystem (fsck -fp /dev/${ROOTDEV}) ... " if ! fsck -fp /dev/$ROOTDEV >/dev/null 2>&1; then echo "FAILED.\nYou must fsck ${ROOTDEV} manually." exit fi echo "OK." echo -n "Mounting root filesystem..." if ! mount -o ro /dev/$ROOTDEV /mnt; then echo "ERROR: can't mount root filesystem!" exit fi echo "done." for _file in fstab hosts myname; do if [ ! -f /mnt/etc/$_file ]; then echo "ERROR: no /mnt/etc/${_file}!" exit fi cp /mnt/etc/$_file /tmp/$_file done hostname $(stripcom /tmp/myname) THESETS="$THESETS site$VERSION-$(hostname -s).tgz" ask_yn "Enable network using configuration stored on root filesystem?" yes [[ $resp == y ]] && enable_network manual_net_cfg cat <<__EOT The fstab is configured as follows: $( is found, and the fstype is not nfs. Non-ffs filesystems will be mounted read-only. You can edit the fstab now, before it is used, but the edited fstab will only be used during the upgrade. It will not be copied back to disk. __EOT edit_tmp_file fstab munge_fstab check_fs if ! umount /mnt; then echo "ERROR: can't unmount previously mounted root!" exit fi mount_fs install_sets finish_up #!/bin/ksh FILESYSTEMS=/tmp/filesystems SWAPLIST=/tmp/swaplist MODE=install . install.sub if [ ! -f /etc/fstab ]; then [ -f /etc/disktab.shadow ] && cp /etc/disktab.shadow /tmp/disktab.shadow DISK= _DKDEVS=$DKDEVS while :; do _DKDEVS=`rmel "$DISK" $_DKDEVS` if isin $ROOTDISK $_DKDEVS; then resp=$ROOTDISK rm -f /tmp/fstab cat /dev/null >$FILESYSTEMS cat /dev/null >$SWAPLIST else ask_which "disk" "do you wish to initialize" "$_DKDEVS" done "No more disks to initialize" [[ $resp == done ]] && break fi DISK=$resp makedev $DISK || continue rm -f /tmp/*.$DISK md_prep_disklabel $DISK unset _partitions _psizes _mount_points _i=0 disklabel $DISK 2>&1 | sed -ne '/^ *[a-p]: /p' >/tmp/disklabel.$DISK while read _dev _size _offset _type _rest; do _pp=${DISK}${_dev%:} _ps=$_size if [[ $_pp == $ROOTDEV ]]; then echo "$ROOTDEV /" >$FILESYSTEMS continue elif [[ $_pp == $SWAPDEV || $_type == swap ]]; then echo "$_pp" >>$SWAPLIST continue elif [[ $_type != *BSD ]]; then continue fi _partitions[$_i]=$_pp _psizes[$_i]=$_ps if [[ -f /tmp/fstab.$DISK ]]; then while read _pp _mp _rest; do [[ $_pp == "/dev/${_partitions[$_i]}" ]] || continue [[ -n $(grep " $_mp\$" $FILESYSTEMS) ]] && break isin $_mp ${_mount_points[*]} && break [[ $_mp == '/' ]] && break _mount_points[$_i]=$_mp done >$FILESYSTEMS : $(( _i += 1 )) done done cat <<__EOT OpenBSD filesystems: $(<$FILESYSTEMS) The next step *DESTROYS* all existing data on these partitions! __EOT ask_yn "Are you really sure that you're ready to proceed?" [[ $resp == n ]] && { echo "Ok, try again later." ; exit ; } _i=0 unset _partitions _mount_points while read _pp _mp; do _OPT= [[ $_mp == / ]] && _OPT=$MDROOTFSOPT newfs -q $_OPT /dev/r$_pp _partitions[$_i]=$_pp _mount_points[$_i]=$_mp : $(( _i += 1 )) done <$FILESYSTEMS for _mp in `bsort ${_mount_points[*]}`; do _i=0 for _pp in ${_partitions[*]}; do if [ "$_mp" = "${_mount_points[$_i]}" ]; then echo -n "/dev/$_pp $_mp ffs rw" if [[ $_mp == / ]]; then echo " 1 1" else echo -n ",nodev" case $_mp in /sbin|/usr) ;; /usr/bin|/usr/sbin) ;; /usr/libexec|/usr/libexec/*) ;; /usr/local|/usr/local/*) ;; /usr/X11R6|/usr/X11R6/bin) ;; *) echo -n ",nosuid" ;; esac echo " 1 2" fi fi : $(( _i += 1 )) done done >>/tmp/fstab while read _dev; do [[ $_dev == $SWAPDEV ]] || \ echo "/dev/$_dev none swap sw 0 0" >>/tmp/fstab done <$SWAPLIST munge_fstab fi mount_fs "-o async" ask_until "\nSystem hostname? (short form, e.g. 'foo')" "$(hostname -s)" [[ ${resp%%.*} != $(hostname -s) ]] && hostname $resp THESETS="$THESETS site$VERSION-$(hostname -s).tgz" ( cd /tmp; rm -f host* my* resolv.* dhclient.* ) cat >/tmp/hosts <<__EOT ::1 localhost 127.0.0.1 localhost ::1 $(hostname -s) 127.0.0.1 $(hostname -s) __EOT ask_yn "Configure the network?" yes [[ $resp == y ]] && donetconfig _oifs=$IFS IFS= while :; do askpass "Password for root account? (will not echo)" _password=$resp askpass "Password for root account? (again)" [[ $resp == $_password ]] && break echo "Passwords do not match, try again." done IFS=$_oifs install_sets while read _dev _mp _fstype _opt _rest; do mount -u -o $_opt $_dev $_mp || exit done myname _dn=$(get_fqdn) while read _addr _hn _aliases; do if [[ -n $_aliases || $_hn != ${_hn%%.*} || -z $_dn ]]; then echo "$_addr $_hn $_aliases" else echo "$_addr $_hn.$_dn $_hn" fi done hosts.new mv hosts.new hosts save_comments hosts save_comments dhclient.conf for _f in fstab kbdtype my* *.conf *.tail host* ttys; do [[ -f $_f ]] && mv $_f /mnt/etc/. done ) _encr=`/mnt/usr/bin/encrypt -b 8 -- "$_password"` echo "1,s@^root::@root:${_encr}:@ w q" | /mnt/bin/ed /mnt/etc/master.passwd 2>/dev/null /mnt/usr/sbin/pwd_mkdb -p -d /mnt/etc /etc/master.passwd echo -n "done.\nGenerating initial host.random file..." ( cd /mnt/var/db /mnt/bin/dd if=/mnt/dev/urandom of=host.random bs=1024 count=64 >/dev/null 2>&1 chmod 600 host.random >/dev/null 2>&1 ) echo "done." set_timezone finish_up  (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H ELFa(t44 (DDDD`D`}}}__]]$$$$$l 444OpenBSD -LTP@0! MP@ -0LM 0PS`@p0 x%/ P000`P`0 R ^ *0 0 Q P:00@=}D= 0S SX 00-SL@  @1S@DQ@Dt @Dt0] -LM$@0S0S] -< L04S0 00 h)* }$ _ 0S00} -LM`pQ 0S5/7p@PPPQ P Q088 8NQ  }D`\`, p-PLM@@P` ph 0-@L 'PP \SXG 0OSP8  (00SPS},d`\`xT -鸢帒<LMP000圂S0: pP=xw '@T` 8KX0  \ , (Ÿ8  RŸ8  0 8 80000S0A  10S000 B `S 1p0S0 Sl+ h10S X1X!0T!0SH!@1  !8 700011000S `R PpU80p @0S 0S  0<t @0S 0Sl 8PDHb cLP t\P0: S\, KPP0000 0~'pq~0S0000鸅m@ 0-L1 R 1 0Su*Q  1Q   %-A MP 0!0  tP l岂0 0;'80 0 0 0  P0    00 00000 0000 @0  W00 \D L000 :0 0 00(00LP -0LM 0RE0RQ0R_ x00 l@ R R*T bQ ,00,00S hTL -`1LMP``p@Q ,QP@  . }0S@ ^O0/T0V000 0T0 0 0 0S00lO 0pd  t4P@0 fR `!* 00 0Rb*0 00dHde -pLuM0d yK,0 _ 1b1 P a!  B=9! = 1 T. tP@M0 Cr/ p`ᄹPno JP PoOK 0!dPP+A ~ R  x1 RtVOKd0`!+A k  R ,1,R@Kd0!+w?KAWv?K!00/C#b10  0 1됀K p`0d wKP_+뉁3 @v?K  00 ,0SD,j.A?fgg0gg$hDhdhh -LMp Km+@T` P P@ Tj_ 00T 0-x0L0PS0@Q  sP 0S(0 R00 R0P P-L` 0S0nS 0@ ,P@gl0PP@p` ,Pp@0oS` JhP -蠟L0S 0 R0 R * X @ Pp`0DS 0 PUjOvP D0\j/T0 "joj59P p-L M `K P@0s  k|pi|pPh -LM, pPo5G"%$,0O"#!,0 0o -LMP, 0 <|2  B 0R00 0`p @T Tn$ [$4 Tv Ttc$ P$Te TcX$0U$,4  0| Q wZP@E70 Z/  p{l1 R/ @pTg' YZ`PST0  lP@0  P{To{ 5 1`P@0{x %P@X#0 # # 4 { 5Y@Ahhh hD1 -0LMPpP`)0 R @;$0 ; 0 @t{0 R xW@ $0@Tj_\`{ K$K{'@@@$00 hi,i 8iHi`ihi -1L4M`, P!10 00 @,0P 1P/{TBp< AH0`JZ/ 0@K 0@`T9 T7 Z# G#T) T' O#L#T T D#A# 0@K,0<T00 zZj -#0 '# "# 0JP@F0 | a0PKY@iii,ii -`L@PP pJ0S p4Pp^{鸅 -LM`@P0p ٙP@ ;w0S T <0 $$*wj, -0L 8},j -qLMʠ`0 P6 \P0d .40( 8%P<(@dl @ed, 0C0  $H0QZ T# Z #D  T.Lj -HL M, 0 [PnP #1RL0S @D@030(+"Pp g@#"B`@"v#,Pc P 00 0b0  0 0$ D0QZ T#,Z #D S.Pj -AMLX6 M L6L@P p`84 , 0&Xps ?0@8Szꬶĵ D\d 5` YPp0S JP44 R@ 8$ 9P41Ppl4 < @bTQ {T YY P`)  P  PP 0SP*0 P9P<40<4  P<$0R0X0S 7P ṲTTPP B.K B B8V{P@ 4Pvpu0S FBK@@'P XP@0DP@Tj_0T@2 R 808%P0"8$ 84P084 1 RcBKHHyP] {P5 0P0 , 0  c P P`| 04D000$ 04~ 04T 0 00TP` ,P` 3 P , P ' P P`|+ p>FLj|>HkXkc lff`kdklk ` kkkkkk([kkh0g -PLMP P` @ pK  X80S@@w 00S00᧷: 0-P@ 0LSP  0S0S0 p -LM Mß'}KpG` pG , P@xPq #T@U hp` P 0S &PP @KA <0A؉ 3) 0QqA9  w9@X vG=;2 ,0S ,tiw9@T(p@R P. !KAA RwP9#42 R uOK3PwP 3 ~EwaMK@D0 @D!"@vs0Sx w0Ss0S  Hw@wζ̶uK3P-]KZ cP[K  \P@S0 RuIKA 0vP?`:0StPP@' 0DTD0g.d(l8lx@lLlXlhllllff([ -L4M⠘在T `D0, v 0DSpH  TTX' R  08S08pW $v @TP 0S T 7p DW7' 0qv0WS] PBO0gWpW' 7` ZvP h7Qp`' 47W0 Kv  p 7 W$'@v @ 6pW'5v  p6W&*v0S   R |6pWt0&v0S$ $  R <6pW4`0\& v0S( (  R 5pW 0 &u0S, , R 5pW0%u0S0 0 R |5pWt0%u0S4 4 R <5pW4`0l%u0S8 8 R 4pW 00%u0S $pWH0%uL uP uT u4Wu ,0S ,坺0SR p44W($(H)P0 pW 4prPTKPK!p3PTxWC@0($(PkuZP)0BOSl "l Rp^ X3pWßL0#POu0Stt3P p3W#0>up|+P_0BOSl Xl RUp^ 2pWß0 #P u0St t 2R P2pWH0"ux0 2pW "ux0 1pW"tx0 1pW\"tx0 1pW4"tx0= pl1lW"T4pPBOl0 $1pW!tl0 0pW!tl0 p0W!|P 0BOS 0 p0Wt@!t0t40H@KLKL0 000Kt  ptlp؉l@.lkllllmmmm m(m0mlo|>PjppLp\p0g -L0. .xp, -LM`P_P( @(K,pK 0  (0@SR@ -L M0@p00 0Sf `rPP 0S nSW =>P0`0@Q CP QIQG  0V0P . 0' Y0  0000V 0`0 ,K, ?R0S@p @n0"Sl 0%Y000 LPH00D 0oSP %:ggggg -Ln -ML M .0~`P,0 -Pp B0@3StHt$@\x||$= <>LP P<P  ,< = =XLP d x=,L=P < \=,<|-<< << ; ;; ; ;;,; ;;,;;,;;,p;l; \; T;vP; ~@;<; w,; $;e#;,k;o; d:h:+]:a: `b0FSQ :M>KQ0C0C pp   InK`F`F-P@ $`>Y0S 4: S <  ?MKHHș@ ( Pv9؉9^@h9 9T D PQ R$ U9 P^ T Q R U(0  ܤ0J   H/Z 80380S5 0S  8 R 8 R8 R  % R\8 h8 R`8 R 5 Se  88 Rk i U Up80l$ X00R00S7 P 0@ P 10135:3P r X7 R 0B$ 70S4 \7 R R0$ 70S4 7 R 7 R\$ 60S4 60S4 6 0 S4 0$ Sa4%S04 RPؔ6Y> A# Д0AP,  6X@JP  dV000TU 3 5#:,P( 0V00X@6h1h ? 6``U 0#5 %* % U UU 4S X0 4  \ P  @ؔ  YRJ^   $X T \% P ؔ PY0 <U U%1 ATE Uc ccXe 00S.K05 \pt \ IC6<0S@#/Q 0SKoP\0@  TS050P5 P  P㬄 X#%*X4dPP<5 4< 05 0@RQx" <%!q0`J  0 5 SP L S3 p0# U Ugg Ug gg #X 0H,଄  <Ja ` 0q%P@V`!X:5 S S V X X42 v \b 2\b`$"#00C4 <4R 00UV `Pn4S\004 e$ V04 0S03$ 54 5 X4 (4 $ u<Qp ,0 S ,||>t4rrrs$s<4s@PJDH@sPsL0dsPlrT$rXps\|s`sdrhKl LpsssXu$tDthttttuKܤ0C@R0 00aAU0!|rP!d0B!U0PBBBB@B`BBpB0BPBBBB|4(KM.KP B4`( Kp$(0K4(K4(K-K0 B$@5 (K 4D% 0K.KH5 4 B#4 `5 4L% $D PT"$`lK``V! ` pK @X K DP,Ġ KHQ. ,KL R$D @5%(PK(`K@d! \!4 $ X! $0@ P \ 5 )0R`06P$(6R0/ D!b0 $v> 0Xp6BNKx6Q%̠%4%(@D@D0 P5&[ !0S66TQ$0 N0o00  e T QܤU0 U 0A AH7(KJ.KP BX7(K`'(0K$"$d% $$PT0!l |! D! `0 @ p lKd`V,Ġ@ `000 q%4$4]$ 0`> 40Q :V>d8U U Uʠ 5 V:%V#4:U8'L40S@.ccT5l P0!01S030S345-*Q$H9U! $UT  h9Q eVPR 9U  T 9R UP9R R/5 iPBNK@D@D*5vK P p$ e 5(Pa4: S ܤEnK`F `F @P0   %'`\d4S: 8j\d4S0 T([44 嬄 D D ~gF -LM@(KtP`5  Ppp0W0* R00S 0rS`Fv (P@ P@Z`F (00T P P (0vj?(0 9(0 T0uku -PL`p@PDP @T:T @2 u -LPgM/, `+mPBp  Q q00  R P\ 8Ÿ q00  RP 0`SpSapCP 0S.S  L00Y00S ,0S 0S 0S $0S5MK  (pI w8pW0SH00Y00S(0 0(0,0S0,00S' 0S $0S ?P $0 ?c02 $00 ,0S ,B0 {$, u (l oX `P@ <4j0uedAvA4vds L$s@vXvhv -LMpjQ5Q/iQ& i,Q0S h94 0ii`8|@|PPihi<Q@iLiDi<i4ivvvvvxvwwww$w Q-0L $ Q*  h,w@w -LM`@pOf $K+8PHf0S0S 0 J$0 UR#UPw p-LM`PU@ T<EPP UTUpT\w- 0\ \8 0000ӑS^ 0 ^0 Br0 BS 0r0 -ALM3 0  0 8 0  0  0  0t  0d  0T  0D  04  0$  0  0|  0w  0r  0m  0h  0c  0^  0Y  0T  0tO 0l J 㔢,pwwwwx8xHx\xlxxxxxxxy$y <S2  0BS^Q 0( 0 0 0 ?R(0  -R   4K P@ 40 R0 0(@6 6FP0 0( d<P 0L6< 0pPPy z P-L D` 0-LMt@ 0PdhQ e@e 80hh0(0 h 0Syx -LM0:(0 P0( 0S(0 0 (K  gPP) 0S& =P`u 00,pK J0cSb iSI lS> oS& A0S 0S 0S(0SP0AS, [0 0S0 IP,00 0oSP I,0(0zP,0 0 0qP,00 0iSgP0 TI,0$0XZP,00 00.(0pzĂytȂЂ؂A -LM `P0p-S000P(K 0(P P@  0S 0 Q (i5{d5v t t D0h0S $ "-,0 0$  -LM@500$0 C 0+ 0 -00 $0 0 0+ -0 D0- -L M0KS0@0,0  K 0 r0 0`t -LM@Yd0 00S 0 $: 00 $ 00 $: 0S00  <<  00 0 -LM@d0 0 -LM0@S  h 6 0 << 0 -LM@00$08  0 0(0-K 00 $ 0g@+$Efꌃ -Lch;f|] -LM K00"PG4t - LP94nt  - LP+4ot  -A0 LR`P pPJ RDA R pP3 RA R pP R@ R pP 0S 0   0 p  0$  $ 0 p $ 0   0 p  0  0 p zT|}\ -LMx \, P`p 0LSE,4<D0 e+c@cT 1  ~eW%X  @}W $8W8}W $8tWp8kW P8bW $08YW00 QW $7HW@ $7?W  76W  7-/W00SW $ \7W <7W 7 W 6W  6W $ 6@W  6W $t6W@ $T6W 46W  $6W 5W  $5W 5W 5W00 tWX5W $85W $5zW 4q@\W00fW4]W $4TW@ $t4KW T4BW  449W$40W 3'@W 3< S S 3$W  3W $d3W  D3W  $$3W $3W $ 2W: b0S Q KdeW " @ ^ 0K0 X" XK 0SXT1 ,0S ,啨K`K``K`a0S @K00!dZ 0Sqi S  SetplhrI R3 HQc<Lc0 Hc$  ,8HX$܆(4T@ ,<Tt܄̄HdćPPhЃxyX `hă̆tЈ 0-0P@0LS 0@0200 0-|PL0@S d0db00 0HS@b4b$b0000܈x -0L0CSQ tM00-  Q^00?  Q^00@  ,00 0  `  -LTM\ X3XSp`| , xp p <R|0_ |0@70T #|YApa@ P,4Tp0| `Kx| Pxt KPJ4K|x P}W D TT|0S0t  | l h 0S |`KxPKP& |0 | Ql0Sh0S,0 S ,x Pb x Pl 0WPP|0 |(1  0P .@{__0l0  EP|0|00.t  b~pA|@ Px :p7 P/Htt@ht@hgt4|>@ -0L /g},P -qLpM@P`!p@pF@9 -PR`1`00 00Q @` 0T Q" T 1@KჀP0: S 0`S  0`ST 8  (./ PW P H -GML M1嘁\$ `@pL x1x!t1Q0T*IKAP4: S 81 R bP1P a$0 S $ѥz]0S PP BNK@D0 P  P`1:e]?00 tlaIKAPP0 R4: SN]000 (0 -0L 0S},8 -hLMP`0 4 L%Z?p ?0@8S񟗅(0L\d0S0$00, 2 0S 4 ) 0S " 0S#00 #000#0S 3000 t#hCl0P 0 R 0040 s4#0# m$#0S #0S0Pa0Ua 2 R 2 0 R @娂ŸQ 0@Pp [0p"0CSt(U 1P C kU $P 00 U P@ 1\  400ESx tp@]PP bPN0 o r-^ 0 R, KP#0ESU 2 ~@e/6` P C7 00Sd 0 R__P>- **|>J$J*L)J*D)P)* md, p-LM@P`vU0Se/ 0U $000 0 ph.p @ -3L M0 P` B(-%-"- -200I 2 R Q0 0S  [00RS (0s&0S! dBd^XDH00CS0X0ӤX0r Ppp $B00CS00Ӥ0b PpyWYWmp0SE 1 R20S 0 S,   , K/P   Q( K@@"X P 0 @.0P 0_+ 00TK 0PH^  PZ0S Z0S *`0 Rt  P`H)*XЧWEVJD)4|JL)md,dltfdgd -LM@Z00CS####################0h4,$ ^Ĩ 4| p-L M 0@"Q`Q,} P*@+@ 0@@de 2 09R @ ^ 0S0  R@ @ ^ 0S#  R@ @ ^ 0S  R@d0V@    PR@p4+ppP ЩU0, -h2LM Rp P2pQ 0S  [00RS P?> -L,MB0 80 0P, 4  ~딠p`0 w0S= / P80BUa ,P 0lP 0S 0ڕX څ!,L, D 00Sv Sj ,$$"4Q 80!R,00CS0, 0  ,0, o+,0 8Q  ,v008P,,00* C R +, 000 08@$ @,W0 08P,,00* C R , 000R,*0R,* ,x, L,T80a ,<gD`hl.t| -LMZ0, #00 00pӑ Y33`   Rx3x!t0d 0P Y ( <, 00 $8 4 <  m+. P@ PtB Z 0 Y  0 Y&. P@P[B Z 0x $hY (XP2LL"8@To0, 8@T${$w$sP oT k 0T@ \0 BS@TZ@TP@\ xUPU@ "(T0 DG 4B0( *X0 00CS00  ä0P )L 00 X00 X0JȬԬܬ$8Phxĭ̭p$8XĮ̮ -LM@0p8(0 pP P@| 0 0!0"|PD !P@\ o_Ke/E P P`D e/\ 'PP3 DA@ YX`D00CS0X0ӤX0 PpP A00CS00Ӥ0 PpNUnU"Z(0 S (-*TZp"V4ZT Y;<Yخ *| 0-LM$PK@x,@ p1P h (K`1pH (00 -*' P@BU 0#SCFY(J0,0  ,0S0 (,PK6 kXp , 0"S U0S U0 S4Y0$CW0аذ8l -LM@U0S@ -LM@@T000S 00U0S -lL M@p` \ |0 0  Rp P00 0 پ`` -AML ; MBK@$ I:I8 , 00 8$P  pP00 PP :P`` R 00L`P1V4k ,婷(;P` KK0C 0C00 %P4V4 P 0S44X0PH`y0S440044 PV 0Sj0S440 b0S  440@40@4 %QP+VpPh 0Se BNK@D@D 0*04S\  4 44!\0PpPL W00R00SB|%B~KpG pG [9P 8V`P &* PPBNK@D@D0 044 S;;S(  04B%@40@4 PBNK@D@D0 044 S,  0'%@@ PBNK@D@D0 044 S8  0\ %@$ @$ LP BNK@D@D0 044 S0P BNK@D@D0 {044 S4P BNK@D@D0 i044 S<wP BNK@D@D0 &W044 Sptv8dP BNK@D@D0%D044 Spt~QP BNK@D@D0p%1044 Spt>P BNK@D@D0$%044 Spt=`+P BNK@D@D0 044 SPFP a0BS0S8a AR:R `0A8BV< B.K B BD$ PD4` 044 SV P D4`044 S<$V<4 `- DPT` *0S P #@T:q30  00S044 i04S44S $044 0< 0<$ @T6 TV* tP `D4<$P V ePD4` u<$4 <4V TL"D4f<$P##V ?PD4` O<4P~ V 0D4 B<$4 <4P m D454 <$0aC1 0 #@@ ]#@$ @$ k,0 @qS t,; dz#@40@4 /8s#@40@4 m#)$ BNK@D@D0 044 STI440CSpבxʑS#@ @ ( r$4(P\`h.j$s Ḻ LK,8LDlز$ -LM(0S`d ,0S 00SH 40S Q| 80S0 ,0<08S804 <Ph (PaPY (PR8SIPU@0a Sp>P7<P-00S$0S0S8PU@U2 \aP 0 "PU"""< " "8""x"l"`"T"w"<DThij P̴0D -L3Mp0moKPe/OK 0 e/ KK?KH2 01 2e/$1 (  0S X -d1L(M\@@K @ Dq04Q@K`@@ 0^< 0YC 0T2 0OH 0J2 0E0. @ N J Fc B >5 0p'B 0`"XX 0hd.,̵DĶ,hط(`ܸ82P *0P ": -MLM N~KpG ) e/9 , dQ   P PXP 4) KA  BA .K B B)   CP@j(K0PS44S qP(K0S0( K0@4@44 @@ @\4p*S:\4 X4(KS:X4 0mKS(K008 RPe/뎎KH:  } *P 00CS00  ä0e)(K00qP@ P 0@pSAPOYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYQYYYYQYYYYYYYY8RYYYYYYYYYYRYYYYYYYY$SS(T`TTYTQYYYY0UUYU VXWpWYWYXVY YU[ _OKe/Xe/T  P! LlSe/DE 0 @8 PP 0S WK@ p OP@ 6 0IP RƟ6 R@@R@ R OKe/e/Z    0) e/P Z  P  e/OKe/e/ e/POKe/e/ dOKe/e/Z  d a 0) jOKe/e/TOKe/e/(8PXOKe/e/|Z  0 - 0) {Z  "     *v7 3]UH0| @P3 RLZ )9@ e/ P< tCtt#tPP  R0000ӑ yS0 R000ӑnSU P#00ӑyP p2 ,0S ,  !P@ Se/MN ENU P@  0p0Q $$@PP0S e/PZ  POKe/e/e/ Z j |81 RPZ  )9 e/P   PM Ke/e/ , *Ld|A.rdAй@  ,JTx* @Th -ML M R, p0 @ S a`BV00?V ڰp ,0 S ,/0S 0S8 V08ǡ00000PSV4 00 0 ; 0  P@` :0Sg  @1^:0^0n005:0 S0S  0 P<0S9 P@ aO440 P @0  P1 R 0S 00b01@ Q  Pq n P 00f PV P 0SS` 0V0R00S`V@ P@? a`B0S 0S|VBp dVp0( KBNKa@D\0 (K@D . 0<,@ < 8d p-RLM0@`+ a@ R\0"(\` ph ^0S  0 SS S0d0T!\ phK (<<dP0, 0 ph{,|4`t -SLMp 8Ka`N‡PV(VT` Pl 0S0Sy  PK 0 SSZ, [RW R08 0R 0G @T0 4 0 S?0S< 0S K408   P`1 R 0SS 0J(U` h  0S0S* U" X1 Q *D1 Q :0S S R0000V@@@@@ P龍A 0hu ((PU2UP 0S S R000(U 88/P0( ,< 8 hL -LM&KPpT b[P1^PD1@0!P * U:U: Q:Q"P^^@(1 Q:00Q$^T 0`S 0!@l0Q` PS 0S`(0S@08 <  -RLM0`pl a@QgJ(T` iR 唀R 06M  0l!00`1 \ p; p0 3 P 0S S" P0bS0c00 Ri7 P i*0 `0T< 0Sh. 80ijT (@@AP0,`< ,\x p-LMKP@ [PTPT`0 R*0R*0@  [Pnp8 < 0 P0:00 -a0L0p@TP  L ၭP >P0 S R @000?S T S 0?S h`+A IX0 ` BR X0  äX0 g|. -AML M4 8 , d- MK 3(K 8 BnK`Fs< `F (L  RpS3(@K @T 0 0S S@D00(K0?S (K0*S 3(K RTD   0SQ"0000ӑcS &S %S 0@-S+S@84 0D HBK0A0At{P@H0"S 04 Rf<4SZB0 `MK ]'8+\ 8-Q `@  00* <\' #ZP@/48`V%0 OU/ P V  @0aS@ lZ  K ,0 S ,凐  P@<l0 H000@D0z MK4h <0?gbSe4@D( b<$ 00]??A` |Y@0@D0z( O -K0P kS gS844(Y< @DmS/4$(4( Q 0a#5<4 44800(K RK SH( K0?S X0  BR X0`  äX0h 8 -LAM MhB>K0C0C4 , p@2(K0PS`V2(K \ @   0@R1(K T1(K `\|1 ,0S ,嵏y 0g g0C B#b"Baa  X8 < JLL!LJH 0F0 0@Y NBKJJX@8<$~J;K  ,CrP 0(K;K, S QQa B RR24  $4 mL00CS0X0  äX0 cpĭ̭$ -$LkM0Ke/ ,0 34d/J0!PP P@ P' @T`t\JX 0@@ J T8@ 4T00CS00  ä0 zT`@ QPP  P,#3P P@t x3x tU,@0\#\3P Py@t 3  t?0@8 # 3P Pc@t 2 t)8@4"2P PM@t p2pk t4@<@T44T" L2@ 1p@S pb <PRR0SS T * R 0 dR0b00S@<@P!1P P@t T1T$ tDh!h1P P@t 0 tTD0 ,0S ,.0  e/0 a00dF h0h@ H0JP<Lvt$@ LX,x̱,< X LK$0 -8@TLPp60S S 0 (S"H\T& TP`$ 8@T0S S 0R8#H\T@<0 P @^hh -LXM|`K@X pPP 0rSP&E |0@Sb00C8SEEnHa嘁@hH T@ p1GT0\0CS0<0  0DD PP 0.P* @(P" @T>H 0@5H T@ 0 T00CS0 :@00T Px0K @1S@,<@$ -LMp<P@ 0P@ @p <P*`f ax x0P@ @p <0 fP0 0`m((0 mH8 (8< h, -LM"KP< @0S0 @ 0耟  2[ 8#Rp`#P1 0 QS*10@  P 00!10 HP!H0@ 0R!705@20  0 8 < 0@-@000<0\00  [00RS?00 Q 0  <0R 8\ *0 SSP(0\1R:0\ $0@3G<0S008 D)< A-p刀0 P0b0`Q0S S ^ @ 0S0T0%0n 0%!Q< 8  -0LD0C6S[D̀̀̀̀̀̀̀̀L̀̀̀̀̀̀̀̀̀̀T̀̀̀̀̀̀̀̀\dlt|̀̀̀̀̀̀̀8̀̀Ā̀HhD@<840,($  CCCCCCCCCCCCCCCCCCCCCC8hlX<\H,`8l Dl$L -L`pPAT 1SPUA@@P   p-LM`P@PQ@TpP Q P pQ -LIM MJ~KpGpGP @ , 1JnKS`F1A@TP,0 S , >P0rSJ /:HP@ PrU B>K0C0C4 000 !Pv@0@@ - 坨PP 4S JnKⴀ`F10 "\a0@|$%Tʄ1SvBKAA  0d\u؉؍d -2LMp`@0P0 $ \0 ~ 0 ~ x 0p ^\ :` 0X ^< :, ĭx,8 < @ -LM`pP@0 0 08!0 01QQ p: p 02 X P 0 0S P V 0 SS Px0`000< 0S40H. Z8 0Tp,<  , -2LMpP0 0|0`` `d@t P0P t*T @(A  J,, -2LMPQ  0  @ )@t 0& t K0T:`pW; 0 \l< X0 ,@ ,0 0XPJ, -2LM`px \p0@PP@ @| <0< | HL, -2LMP 0 Rp`0 0` `@t 0 tm 0 @ 0cxpx!t<P` @᳣P @T<C 0 0T @,| Q-Lp`( P% P# P! P !@R PP }@T! 0 /\ PJP IP DA4 $03T\,P0S  0 S Q -LpMpK`P 0sep @T X 0S@ 0@0PSrdAedA -LP\p@` 0B0C3SO꜏                 $                             $T <0( ,0P<0( ,048  1h[W <0( ,0P( 0NV ( ,0P<0W<0( ,048 ( (0R, ,0R0 00R4 40R8 80R< <0R@2 44 4P$ o,D0 P 0Z<0 0Q&2 -LM0U@p 55 u  % 5P,T$4@  $Pp 4Q 0SDP ~PpdP(D0: S  S  S0 0vp{ 00 R000Sg R4?;#003 <0S c#?;0P@ ? LD T@ ;00S  ?+83 0S,3@T c ?2"@@ 0S H2 AR;;S" ":00S 0S 2Ql2l"d2T"H2D2qV>0S0||< KO1Ps1 V@ 00 ~9>!0!t@ 00 o*>0!f@g0* >0d!\@T P!P00p 0Q  >0!A@0 0T P=0 +@0P 0<0  H04KĐ|KH8KK(KKK KTK@DKKm@0dx -LMc0Ss0S 3 R S0S3 Rt3 R hCPÖ>[P,K @0S 3 R| 0 0R  R B 0 S "000 R2 R0S㼂 00CS00  ä0N00`V xx20 0hP89@2`DBHP(@ 0S 0+50 a000+mP !1aA0 @@AP| u@ 0X$1 v@e0APR0: SN8 @TI0vA@D0 R㬀 00CS00  ä00 ( 8808 $04K8HĐ4LLKKȐ<K0LؐKhL` K`,l KKt -?MLMt0t` R   0S P Dp0S?KK@D0P@D?++_P8@4 p- LMP|Ut`0   p@0T Pࠡh< >8D4 -\0L RL H0 @R0,0, 0[>0X>8|KKhL 0-QLP) 0S-   h 0  ^P@ڸ0 T ;;S0@0T@|0 t>0<\ 0T C>00  ^P@0 0@84KK|K<Dh -b0LP@@xr PP PX"000SQܞtttUڅ;;SNU8U0011 U00R@@T U 1 Q %P=;!0|!=l1 h=\=,;0S ;0S ;0ES U0P0 0 R0Q/PUd;0 S `;0S \;0S X;0S00PXb=00 000@48DKȐ<DT -1LM R*ʔa0S& !00CSYxx0Sp1  0SK@@@Ԣ0S0 0  0S==[0ȌlȠ@$ K$ @ P@0 HP U0S \p0 @0T@_0 >0@TP 0rQ00000K@ĐK8K4m K -P@LM0 U 5ࠟP.0 R  0@p`W 80 S80S*0S@0'Q:@ <000P@84 K -L M䁟P@P!0SؤؤؤUTj<0000U$ha 0 RQ R 0Q8:!u< 1 R ): T:P0U$`0 x[0 njlȠ( `0P@( Kd$@ P9$0H ;<<T@8D4t<Km -?ML M804S?KK (@D, r@Dz r"(K0?[K<(PE0 PE00 PAb0 0PV?KK(@D@D?+L\P`G?+E\P;@@ HP+X@ P00&0 P ,0 S ,ԁ}90 ;;q9 ;k9 f9p  a9` ^9 ?+[P}@4mDP| -LMdNK@D0 @Dp (0 Pw P 0 y,NPi,K-*,9,K'$,@ HP, K40h 6+P9T x+PȐ@L8L\LKؐK0LL L -bML$M 0,0 @bmK(`FP$`F T T 06 ,0S ,|0DP0 P!0SZx1 ZQt!0SCb}b]pP0S(P ,!0S,Z -PP0(P@+~P 0S @0Sy 0 00,P\0` X@0 ;-P+PȐ8LK0LؐlhL  -bML$Mx0x@ R  +P P L0 Db=K0C$0CP0 0S "|8LȐ0 -%ML,M%K0(J⒍K JE(H,0 (H %b}K(pG P`$pG; S/R P58,0 S 4,{ KH%0R/S /00H5 0H5` %,K( B:KBP#V:KP fL%$(K0: S 4 S*PsP5.P|4 R ,PsP00'P@40S(40S- :KL5*KP/QH qKLP T5*KPB:KH5P@0S 30S #a=(K0Q|3|#׸*P#P* $P$C0S3 R *KP P0S 2 R{ "a=(K0Q2հ"mڰR0Sa2  Q V dP|20 S SQ$ 0CS+P0Sh 4B0Sd ("00CS00  ä000V (*A J%K(JPJuP@ "   {20P!4t,11 0Qڍ0S0  (Ka=  -0QBa=l (KX00SX0X Z20l 4LL Ppx@L8L LHLLKK(L0LؐL -LM⬡0P,P @1`pD3P P00SP` PUD1 R 4'4P 1@  40$P$ 0S U0 R 4P  @0| ,0K8P P+0ST 000 08PȐKĐ4\K -!LM0S|@ a1@11 WpQPpA\PX@T PZ\A1 R 33@0S`P111P 1 110@1SZX0 R Hl3HX,@\ӯ ^\h @ꘐKĐȐ 0-@0PQ00L ? Q ?;#ʁ P!~ Q ~<Üʘ0 0P 0x 0t0p0 0P03 83`4V. -LM\q0`SN H!3#c1c0cAT R$0S8 Q0S. T P T $`P 00T 0$`00  XPl0(&PC3dAdm@d@000XRPld4V. -LpPP 0S ,0SP!%0aV 0S P0S$0 0@0S# V (P00 0$ 0 T %P(@2m`PP0000p=` -LpOPP 0S ,0SP %0aV 0S gP0S$0 0@0S# V ;P00 0$ 0  R%P(@l`PxP0#000td -LM@($aMP@ 0S 4 -1LM 0 bM@ ^0 - ! ^  ^ a0 :#:900 P \0  ^  ^ ^  ^    0-LbM(MPbMK@D$@D0p 0 d0 KX0P  0 坿@0 0 0S q0\4 Ȑ@ 0A0- SPL@ 0]0S8  R0SZ+ 0U+Lt -a- `L0Q!0p@[ P20P d 0p QL -+4 $$+ PP 0 KS- L0P 0 -PL@LPgb=0  <|1  5d1  .Lq0 '41  1$  1*  00   0A0a-  bam` ; P0@09P0: S `0  ,h 0S HP (,$0H8 W! -LTMr0 $0 @"P2b- 0LS`P2`  0L`pPKS񟗞888a=0A 0WPP2 HD 0 P,2 0 P 2  @*$0 S $yp1  0 P1 0 P1 0 P1 0 Pp1$ 0 P$1* 0 Pa=0 0 P; 0| PLPP00S S S S  Pd0 )@0l A 0O Pv A0q0` (,$h0 mS- LO0P 00 mS- L@0P 00 ]\L -2LM pR@ nPb0   2  l"0 T2  <2.  $262a-  am` & 1>  P F $04 4!N0 y P Vt $04 4`!f0 h L1^  a P@:0@0P3n000cBP) 0: S `@0 0S@P0 ` `,o 0S P `@0 0S@ Pn#R\L (,H8$0 |0 \L -H$L|M0 ,0 < P $00CS 4   4圐K R 0  & P3=6K 0 P7#00CS,4hhh,,a=0p`P@00S@b-P ``06 u P03 ($3 0 P3 0 P 2 ](2 ,0S ,n2 0 P2 0 Pa=. 0 P`2& 0 PDR>0 0 PF 88# 0 PQN0 0 PV 88# 0 P^ 0 Pp nP/P*Pn000cP@P00S S S S  P<00cPy0 'sq0b= 0P@60 0C PL [b=0P@06\  03 P 0\Lq (,$(TqQ-H0 4S Q 0 S  qK -LMPpPb@03 R 0#400"400"40 0"40  0"40  0"400"40 a͠$ 0 `48 0`  !H8 0Da=$"$2T:0D0P300cPP*!0: S `@0 0S@P1 ` `,o!00 P `@0 0S@ %P0 400 400 40 0 40  0 40  0 400 40 a͠$ 0 `48 0`  !H8 0yK (,$08H P& -%L0M0 (0 H P4H@ AR4  0ASthttHPa`%<%8.K-0K.[- [%<$,0KP0K+K(,0[+[pPPČ%H8 0P`KPH0`P@P`b- 0^ H3 A&S(0 S (yl0LS#H@4B0KAKB [A0[4Pq 80D KC0K 83H@@ 4#H0 4@0K?K@ [?0[4P#H@ 4>0K=K> [=0[4P" 4<0K;K< [;0[4P" 4:0K9K: [90[4P" 480K7K8 [70[4P8"@460K5K6 [50[4Pa=@,@8@4 K30K2K1K4[3 [2[10[ $4(PpPE400K/PK0 [/0[4UDKP2P-000cP@P#D1H`0S S S S\H  ePH<00cPLH0 %EC0HP H 0 @@,@8. K-0K,K+K, [.[-[+0[ 4H0P@b- P0@/HP b=0+ K. K- K, K#0| (,$ -0` LK$KP P0`P| P#d 0QpL0L {P0, C% K(,( 0-QLM@P&0 R00P0 R0S 0;0 R0 R0 R a= 0P0"\ 00h$40 |000 0 `LL ̐А8<(, p-LKtM @`KPP   \L0  Fp$p"0 00$d- 0P ) -LpM`@KmPP X0PpWH0P 0R ,0 ^a$PL -LtMpPK@CP1 R* 0R5 0: S, &PP $" 0Q` P X 0x @O$X"0L C$P 0R $LK -MLP4M H4p , t * $00C S\ x        3 P3 RIKII 4S+P) !#0@P \ `3 RT3T P00##3 ,0S ,i3P 2 Ro 2 BQ R0P0 R0Sx"0;0 RQQ B0S|2 R p2a  02L嗷P \P0SBB0S1 R  IKAA?P!0S$\1  $!4t!`#11  BnKP`F`FU!B4: S>Sp@ Pp  00#00 s,  /%x "B 8X hL`XLK(,<T`LL̐А8``|0 p-LtM`KPP 0@T0: S /%Pp L 0"p}PVp  pL -LtM0@/SP @//㝶`@pKT/ `{0SK0S ĵx0\g0S]0S! *x `L -@LpMS` Pp0S 0 R K4P0Sl00d0 Rd00HP 00 W"  0P"ꈎ̐А8d -LtMp@W0 P`0S 0 R KP0Sp00d0 Rh00HP00 " 0"꘎̐А8d -LM@0Sl`0P 0S 04 !$0 RP`hLK -LM@ I0Sl`0ӵP 0S 04 !$0 RP`hLK -LM@P0Sl`0媵P f0S b04 !$0 RkP`hLK -LM!@ePC 0h~! -*0LM"*@2P- 0hh! -LMRp, `1 0S00000SPP0e0 peR  V@*0S@T*0S T00- x@ x@@T P`W,0c 0  !pWaP  0p\ x/0cQ` 0 #pLlL p-RLM`0 PpD@0T<  P 0ph  ꨎ4 0-0@SLPF 4 0R0a 0h2 L8 -ML4M!0QP,0 pG`1 KK`(@D@D V k#  @P p R0 RPa- 0S0S 0 Q 0 ,0S ,fK(A4A 3P a=(K0Q p0| 0QX0P4 0@ Q  0$ `Ldld -0 0R00000L R0000 R0@00x0 Rl`h0P PP0 RP$XLKdLTL K L p-PLM@` 0Sp`PP Ṷ@P0/S00H 0 S8 @`0 0 PPPPp d0 R00T0T QH0  \80 R,0 P0U긎4LLK 0-0P LRl0@T 0S @T00SU0 ((1P^ L ,i -QLP=aq R1 0S  0S0! @0S00 0 P 0'P 0P 0` KP DPv00ꬎK K&B`P0 \*L-S0!^ *\ ^ *\^0305 -$$q0LS`P P: 0-S00 00 0S&0@T0  ᖯ:TP 0 0:S l R1 0 LP0A?0C0 hK|>K, p-LM0@P/|P00l0w0SP`ph8<l0Sph00phhL``` -LTMptp % Dp 00@JS񟗈(+,,,,,,,,,,,,,,,,,8+,++, ,<,,,,H,,,T,\,,,,l,,,,,,,,,,,,, +,,-, -,, -,,-8-,D-P-h-,L.T.l.x....,@/p(4qDTA0S`0@0w,0S 3wCϮPv  4 uz4Po\j43S Pvd43u,3u$33t 2 Pt2 Ps2s2r2rBp2P: \2p2pH2p 2|2 pt2@p}l2pzd2|w2|qP1@ 0S `Pa0CS"-$.$.$.-$.$.$.$.$.$.$..$.<.D.1` 0S{1P1P1P1P1  &t1p1{1[PzqT1z-L1y*D1y'xP0a,AH0pK @p յ<1P@x  0喽P@ P⡣UH@ 0函5 0'$L|>K(P LThdLXLKTLLLKLLK@LL(L4L̐`LLА L8LKB,xaKn9ؐPȐXLL 0 ĐBXL0@0t0 X X0 t0SI0S| |0 0S0000X1 0S@0cP0 0S0w 0S @0yP 0$!0S0<1 _P1 RH!d1 p6QM Q ! R 1R B Q @A1A0t0 001A0t0 01A0t0 02B0t0 0 - 0PDDLM@, 0 4 8 0(Bp 00@JS񟗾4$455,4445<4D45555555552L45555`4l45545544555555545455555553 555$5545555`55h5t55555555555vfP040 606666|6T6t&h640Y8  6 86   w4 8YP8  fnS6 0 f5b5%5 \0X5 | 0-S 0 , 0S,  5000 Bx5x%=l55P6W44 0$0,0%000( 55 %, 5R Q@b $4 00CSTY  0Sd6d6d8d8YpP. Yi 80I`0< 80 VL hP\D;P< Pp$P(4 RYPW Ø3 , RPC0S 0S ZP 0S,30 ծt{P@\ L˫P R2P 2Pp師P `P x2`0P<0 20H CQ0"Q0v <2PlYPN YY 8 I`0 @0 8 V; @Q P1ᄫP B CP wPttP1 RY0  8`\]{P@x )P`PP P0 OBPP;<P `P`P@  ,P).P# \0S KԐ|>K@LXdp|KdLXLTL0KĐXАL`L4LK@Laؐ(|K PȐ, -LpM`@pKt@ 00RPP77P0: SU/00 0D 00S_P  d -4L$LM4$䄟P4 $4p $p 60@DSp=>>>>>>>>>>=>>>,>X?>>X?>>P?>>X?>>><>>>>>>?>>>>>>=<??>?>>?><??>??>?<?@ @>>>@3x3x#000d3+ X3uH3@c@6zP@ P %3 R ) #b尒ŸH0pK  p б2P@l  2咹` @ pp`❟VH@ L2P價H2b 0-S 0!0S "22!0291100!101|1!0&H!1r!!0QSL@L@@@@ R|PP R0S,1 $\P 0 R _ R 0 PPK `LLLKĐLАK LȐK|> KB4L,xXL0K0L(L@LؐKaX|hLL p-0LM` |@Pd0 P0R4BDL S00CS00  0p phHhL, P00 -L0L R0 R  襞, P-L 0S|P1 0PS$ p,Pp`=ẨP@ nUP  ppP0VPPS0  U  0S( U  p-LM KP| qd R0\4P0 0b0CS#ELELELELELELELELEELEELELELELELELELELELEE`P$K4 V U  0xS S *S p`P0E" $ VUp`P%%K5`P*%F:`P!%O1Q0r 0-LMKPwP @"#  0 S R TPP   B*0 0 C 0 0 K -L 0㙷Nm, -L0,㌷N, -p@LM@ 0\~4 0LyE 0<tB 0,o0$= jN,   H   -MLML0P`(0  0S ,(0 S (Y @Rpx 0\S@ S  R wR 7TPP`  PI000S  \R 0R 0S *OTP 00@0@0S PS" GS0000S 00P 00PPP(T0 0gS pS00BNK@D@D ;D 0Tz(v     8 d  -@TpL 0S S`PUP P@@0`S 0 p`PPP P   0-\0P@LT 0 @T0U$ 勜P괐 ,i -LM0PS x@T l1P0000 <1`V0S`" 1 R @T 0T @T 0TT 00wS 0 pfzPp  R/00`[ @0/S`0 0@4R R/00p鴐4LL (  p-!0LM0PP@ 0 R 0 R pp0 " 0/S @T|0 Rp帗PT @`H0@PpUP004LL p-0LM`0@P?P6 *P *P 0S p*P P Q  P Qp*P Q P0 R /QPpQ @PQL@-0 !S@@T0]P P 0-S P]P ^ \ ]\ P Q0 -PRp0LS@ 0/Sk 0S 0/S6 2 R2 RPp10SS S !Z 0(Pp10SS S +0  \Pp@!00CSk `,1 R.000S S 0/S 00CS00 0 <0C<`0S.000SlS 0/S 000 00C0Ԑ @L H  -ML M\\1 `P$ ^KPE840,0S/0Sᾧ0 S0 K0S( .S @ Wp  P;0W$0 S x$Vd0 K@TTfHbhL     a < \     p-LM@P` 0P D0 L\ 0 pPࠣ -P`L/Q@@e Tp Q@:0Q Q0@*0CQ:0QQ0@*00 01  -LcMZK MpKK K(@DKK( @DN*K", 8'KWLK KPH0`K: bK(J,J 0P'02(K  UT1*00UT1:T3 0 PPi1!(K(K0@cTP 0S 0Y pWp,0 S l,VT *0S 0TP*0S0T0* K\ 0 1(K R K(p0(K RK*K:K(姣ZKX:KZK(8W0S  KP KZK(8TxKQ :K(0n꼐 T\  , < -LMpXP, @ *0S &S  \S 0T*0Sh /R9R,00`BVP"0S 0S0 `bV0dV @\S R0P -LMp㗭1PU|姶PP 0S`QP@ 0 S/R< O4aP2 T,/00 1  bPP 0S [Z[[4[00 R,0 h@T0 0S/S @ ,H3Hl=X0X P#3!"c1 0c!R 0S R(/>3 p-PLM@3 R0 (a0S= 0#S4 \S. PP$ i0"C12d1@cP 0S PMP P0! 0px  ` 0#S@ P,匰P  />3= X0X P#3!"c1 0c!R 0S R,/>3 -PpL`@ 0Sd /VPPp0 S 00C S0u 0SbMP@j U 0SE00?0S1W 0S !0 0P!10@ @@P000 RH 0h eM, a ^M\ P 00000 0S MS CS000 0S 07 cS mS00dv,QW0p0@ .QT@}  ( @ܐX|@@-0\ @a 0S)  S   0R  0R \\  0 S0S 0 S0S  0R ܐH -LMPĢ0pS@ q 20  00S| 0ST`q @᧢P_0 1 !.B=R pGV0G SRh4ih4ih4i`h4iC111v>C 0C0 !0!>CP00 1 !.BR00 R0S P&0B00 1 !.BR00R0S P0 1 !.BR P 0 1 !.B;R p010!.CDR Pk?C@.PT @} 0-LPL@DT  0ˮ0S0 !  d -LM⬁PPe 1 R 1 R|1|!11a11acAT pP0 S @T0 0RT 00mK0hjK0$qv -dpL0S ` AT@0`V01P@PKKIKU p-LMP@T0 p٭0Sx`t 0 h0hdرX0P 0 00 H 0 GHLPL -ML0M (R04 ,0  2 ,0S ,:P4! /!8 0AT ~KpGR0pG8 @TJP@, Q0 a0Q  P D! TJ4a=  8,1008 A  20`PS 0S0 *0S  5PT 4a=0 S0ńq8  k$ G<\ 0-LPL@DT  00S0 ^  -8L@T`M !0pAT nPP! @T IP@ .qP )qP 0! 0A"J Jh T  DP J qP  8 -@L0`SpP` 10AT P @T P:0G0 0-LPL@DT  0p0S0  =T -0LP -p`LP% 0Ƃ"S12e1PcAT 0S @T 0ST Q WIP@ 0`0 10 A/>3 -1L M@\, `p? ̡1 0, @R@\`0 PPI P 0S: Pda00S0@P! 00S00S IP 00 0 0   )&0, PhPP 0p p00  ` WPP 0X0@ HP 00    0-LPL@DT  0銫0S0  = p-LML`0S P0AT  0r@TPOUp -LM䀟pPP, / 0"c12f1`cAT 0S @TfHP@ oP pP ,000! 0AH(o0ST />3P 0-LPP 0A"#12b1 cAT 0S @T00 ST 00 00SHQH0/>3 0-TPL@ T0 04 @00H0S0070K -LMP0@SȠp  0S P@o0BS` x0 (00 徐 L 000o)H`V$ 0`00K -`L0S$ PPUJp0"S@0S w 0RH Q zGPUZG000L̐А p-@Q0@LM@C!1`@P  KP*0P0:0 R@U K0P0,*0P0:0@p  -P 0S\ \P00S0 BS|}}|00L\:0000L \*P\:000L\*00L  L 0 00L 0@- 0P@CR}}}`}00L\ :1!P@00L \*0\:000L\*00L  L 0 00L P-  *0 R: R$0 R:  Q0-LP0 S\  0S 3@T0   0K -LMP@ PpP \ 00CSP0 @ ($ 0ĐK,\ -LMP, P, 4#, ,(3(cpp0K0CS d, B, l0  , ,2  t , ,2|   a,  ,l2a-d2bb0  00 02R(0 ` >0R 2 "00<(@ /R }   @<0S@P `1`) (@0/S  00C0Xl1 @1) @1  5R K0BS` 0@Q KP0  @P00 9p 0 0 :0 d@0, @m, 0PT , @b, B$ (,H8  lLpL -3LCM |3 B, Rꨃ83 R  3 ,0S ,JBP0SPdU <"K d2K0b S Sy 0CSV+2 Kd1KK 0P>KdP2 0P >Kl,20 P  2 X>Kt10 Pa=.K0 PK&K 0P|KP RP@!0S Sa]P K@ 0K@P `p@< 0S@P``0  _+0 Kd2.K@/K N@KPt0h0x\0pP0h (<`x0(MhNNMXNLNNHdTp̧([NTN'(DdxM|NHN.A0 pbW0`0ppp|y0 ~h O ~| P 0 p p0 pp p]PP Hq00St~ xQ1 01 q>P 0 0 R* 0 R :g0 1  0<2S!000 0 0p1!@  @@ZP` hB@vj ^  0<2S";0000 B>BS$  #0 $ 0<2S (@'(PKdA (KPYoK P0 `A \A XA TA PA LA HA DA @A ePdC000 (3>K QPVXCX_K#^?K@|A 夞PHx!1RS@$01P0;CS040@4Q0S|  `$d㳘l㰘A 媘!r 10C1 =At0\ T0 02=P@T00< KcK0 ! 刬`VKe/K:1 = < K eK5 R x0S:= A 7 0S \5  1 刡 ߨ 00Ì bK 0_Pʱ 0<~D$&r464\&=K@另PpOd&Y?KP0C P偦P Y?KP0C PsPw0F]?K ^0(PK0@00  O? K ^ 300 0p1  000+]?K8 W ]?K. 7 ]?K$ ~FP@ 00 OOK,@@H 0-LP:㝗0^  x0\*&P0\@ PL0@ D虐@P@4~ NMxNTN0< -LM@@ -MLMXXb0PpH,0 pp03*0* 201 0 2 ߤ1  Q P1@ԡ`0 810 @@n0P0?P P$JKx!(@D@D0h!`Pj? W0P ,0 Q  ,sA D`8#8P#$0$ @JK(@D @D[K<:(<2: !<(K0<:(<2:(LL!<  06 xNMMNLN|NhNHN%M -L4MD 0K`$D 0P@K0 Z L7  >  ,OD h0S '0S0 0R0; 6"   R000 0p 6F 0 B0p0 \Ɵ0 ` DX@0S #S $0 0c@BHX@000CS00  ä0: S7 S@PHUp|0 ă ā Ă< 4 <( "4\,<PEU, pH'W 00CS00  ä0icPHpWp!pW T0W6 'W00,QP|0 ă ā Ă< 4 <( "4\,<?pW0 PH 'U00CS00  ä0C' p D 0T Phß00p@gU0#DHL9$H 0 \DP0S.W)4S4#0pW@ *0 @S0pW:0pW@ *0Sp 0W:P@K0/iPKP@0/Ϗ0 \ 8K⯠48 < ( 4" <( "4, ! 0,< `Rc@0 , =9 A0 0 0 =,0 2a, 3c#0OPK< LH0`KqPK@ P K`KPKH 0@PK\,!L@0SPK! !H0Sh0L@Sd*PK`T0 A 0010Z1P7  = pLNMTNNMPN$ 4<H\tL`xLhx ܈DL4<MQڲ0AQQ00  8#8LȃLȌ 00Ѝ -ML$4Mx4Q (K @, \ 0 CR 004~K(IITK(JJT$0 t忤 * ᗂ0# ᶤ* ᎂ#0S`V* X1tVP@+tX0 3y - DyP@tV0 Qz8#0 儤 *\ *XQ 2 R J  b,0 S ,>2@2@P0 Ÿp`0 6@PK0L X0/0)K@ B0/j0/P@@0/P@@Z0/0/P@ @JK0LP@0/@Ԍ)K0 BP@0/@8KP@P!<0 @ *ہ xi }xW yxP@M  f   *㿁3K (JJ0 ٣ *㱁 0RK(II l*㤁Y@AxNTN,PND8NeDL4<XHN -L0 K M00, 000K 0 X p/? 0@ @ _` Q @0 RQ   -LM@T (0Pӓ0PG2TN -LM@Qsddddt|ܻ $`hQ<`hpxȺкغh;0S #!Q LT\p<`XPLHDh84?0#$(,"(h0S S0Swusqo0("# Dd(Px  $ 8 H d t     !,!L!p!!!!"","@"T"l" p-L M0@0aP0 !P))| 0w 嫠r妠tmVP`F `00CS00  0p phq(XV`F""""## -0L M0 K0 P@ p0888 (e0 LNL # -LM@0 01R4 R(  0 $h (#T# -LxM0`S qP10  0D0SJ 0S TKPKLKHKDK @K0S jP^ 0 qPV 0 UP@ x0SJ GP @0S? e<4I 0S t%Lx%<[%[X%%%%\%[ [& a@&X&l&8&&&& -T0L8M<0 0  8 @ 4 0K0 , ( $   Z@K3` -MLM⼑0P0 P00S,  1Q  0P1#\Q:,0 S P, 7E.K B B0h$ !1`$ (@K  d 8 X \ @&?͉ hBNK@D@D 0 P h F0D_0 Up` "pL[&pT -LM r`p&姄 PP(0Sc P, (0, ( ,0VƗ@0 /j0,000S71P@N &n,0SA&c'100,0S0 00 P0 R @@P0, P( ,P6  c Ɨ@0 S/0,0C0K00 (0墓*pT`&<[&&, -0L)MA1 L0 B0Q 0`!0 `0000L0 S  `0 00 `P(yp@W  Ֆ0001V' @ 00CS00 0S 1P01rXQ0P 000,0 QPpTx[[ -@LMT 10C1Jh@-p0\ ` L00n^@` 4K0C4 01PßPoAJD  \ $  0 B00S00Y X 6#1@% "X`P$R`1 ,0S X,k4 0@89P @" Q 70$ :  0mPPd 0hƑ(0CC1/|yx0Pw00S  n Q<;P9pT''''[ -MLM0tC\d#, 4 <(  P@\434 #A6T8 4 ` #140\F" $p`B6# AV#1%Y X @0 0 \ p2Re L 8(LH0PS@*KAAD R& 48 S <8(000 @XT:8H000,0 S ,3 4 0 |00S00YX   D0TPDHNPH @7 Q L 1HH@8H0006#!P*8H0L Q@T *BKAA@ 0 S@@T:086|0 @P0088  <  +HpT('''[(8[ -0LM PU@p$`?` #T*U0 R  0喃" l`▂#0U<0 R 0 0喃" [pT([((<(X(p( -0P0 P00LMS0 P,܀ R0 P.:p$60PP5`@2:(P`@,F0B͕$ە|P0 R0`@004$F˕00$ᵕ@0 pL[(NpT[ -!LM0\00 \pG\(:`(P``ᙕ,F0B$呕0 ƚ \Pt0t0l h d@d0 H0(0000[pT[[L[N([[[[[[DT - 6 8`0(@ 0L 0SĠP`H묀pp2P3@00 00`PS P@0Ss0S{,P,YpT[[N[[[[[[[( -LM@P00,[ -LM@&B ?] Pa(H,PUp* 0А۔0 T00P00@ 000p@0 (($`噒d0 dS D 0 Q00u,P pT@T[HT<[80)D[Z[8)%L 0-(0@ LRP 0 ,, 00 0-(0P@LT ,~P  T00T0S 0 T @0L[ 0-LM@0T0 T00S0 T0P7@Hj0S|tp0 Rd T0K0 _ 8 (D)L[L)ܒT)X)<[d)p) -0LM@ 0h i\ 00CS  00 00  )[) -PLM@ @1 Q (P0P*0ES;PU:0U z W/ , Ẁ0 0V`%P( 00@$Ko$ @0 0 /&`$ 000H0G  W00 R[L[pTD[Z 0- L8M00 H0 <0 80 40 00 ,0 (0 $0 0 0 D PK@ HK@4 Ԑ$0$  00C00 Z[D[ -LM@Pr0 `0"pM b0@SB$8@|1 b 0`ip1 h \!000`01@ m0U>0(!S 10`00!0`00 0@TQ P 0 R T@D\  0;T@DlքzX T0 R $[H[@[)|>Y4[)([T\)<[EE)[ p-L@M P`KN0S 0S   p* -LM`t`ğ QS, @ Dd^ 0S 0S p P0S 3 ,0S ,. 0ṢģL0SD P$먓0S 0S 0\CS 0S ?0S 0S , @C 1 D@! T 6`Vh!h1h!X0 d1@L@@0,@ \@ ,0KT@ P@ L@ H@ D@ @@ <@ 8@ 4@ 0@ 6`TP (0@T*0U U@\K (0PT*0U6`V /&ꀠ?>1 L!\  @YP ?>1 A! @TڑRڎpT[0[D[ -L M0 \0Z0 Z00S70E 0S 1St5  d50S`P<5&0O @0 V"U 5 RD K 0 0P 0  㖍Ta D0S Y U`4&B ?~PPp` Y YP Y  Y! U@1(@Q0 T PEU@ #6#aᗏPP@T1X@QcT P #0001 01S@  YD3  , \3)&T3 0@L#09$ 64$0 R  "0S k J0@$00 Pq p2l2    1&P x2 d` P~ 2 RA @>1 R,9 Qh;Pe@0 ! PPZ @@TP|6#1@DT PM\1 R 0  | P+ h1 !0/i (K0 Z@0 ,N0S 0Su P 00M(< jP0S &X^ P D x6C tt[[pT([,0)Z,<[D[[ZNN,-8T(-D-P-h----Z-i. -LM@P.Ppe`VWY!?> DR.000 0. $0`F0V$0@X L0 S00*%P (@ R00  0R 0S R0R0S P 0 R 4P` _X0 S00Dō<<<[0[T1N[Z-D-.<[.<N$.i. -La8M0&0Q 0  p 0KL P H D @ < 8 4 0 , ( $ @0(0PU *0T0 T00SP (0@U:6pW<0P 40H@ PK0S  pTZNx[ -LM`VPڴp崀K@PT 0S  0T @T R 0S `FVP 0  0P 00N[T1 -ML M0,0   BR    xt P d$PTDT$E>K0C4  L44 >$0ß 3 R( K#d `$ *B>KMK0CL0C L4 p0 R X:p# X*pCp\  X:W$3 ,0S <,) 0S 0 S s S # P"   00C0 " P  000 00C0  LR0S-@<2V᷌@Y P  唏2(KWKK@$ (@g0\4  X$ kEQ& B0O0  0l{ 6`X!0SV Eo0 z5@"%$1 R}0 P P& Pd P <0:90|s[..@THT( [... a./pTD/<[H%<%i.<.\.%D-t.. -MLM$p\0,0 (`; R 0S L0 S8(K 4  `0 A?(K  A?(K D KKv0((K0Q 0@^^>KMK ᡉ~ P$ $\ 0S  R0.S $0'$00Q0Q0 Q00SpG h'dX X (,0 S <,u(00 00CS񟗳  dd$$$0S&&L0S6 `03  00C SKT,T4T<TDTLT\ 0S 00C S' $00&[ P%00C00000000      y0S $\NK @D@D0, S^K PE0 0%5 R "$\00 PO$0SL0 R$ 4 RO$\ P; 0: S0   4$009$\R  0.S  00p PS L0S|3(K4!  `0A?( K A?(K KK Ou$\0 0 Q0hNK0ᴀ$00$03  0`0C0 v@@Q @T; Q 0S+ 0 SP $00$0P "00C0"l>KMK + PH"\D000.S "P wfP00L Rm `0j 0Sg 4\@P^>KMK @d$00$0@1  0`0C0 崀=@?PtP( w50.SR 00Ph L0S# `0 0S 0<0P$0 H/pTH.L[[T/d/l/x/Z/[//<[////0 a.0D0x0000 1$1 ((0c -!0L1pCW:@`V QЀ Ȁ0 R 0pGW*0 R PQ 0 R x0 UP`@H000<0 00C000@THT[[[[ 0-L8M`Q QT!00 @D H0 @0 <0 80 40 00 ,0 (0 $0 0 0 K0DS0@T0@@ 00CS.00 0QP 0S P0  00 dHK HKlHK4 00  F[ [[8Th%D1P1$1 -`LVP)P>1 1ER# @T 0S @T.!0EX00C0`FVP 0  @00X T[Z0[ -LuM膟0,0   p! 1PW1 1 1  6 \ᔦP  (` ,6&=Pz !,6"! 0&1& r&n rKj f?K^4 Z(@1^*P P ?> P  RN/ 0`F<0^:6^  ^Lş 0P<,5% \ ?>1/1L.QAN 0 40\1弤 01 0S  1, 0 S  0l` K_KL$1Š,6 1R rK P0S$1ᮊ& ᠁Pl0SV1#៊&ᑁP<6 P90S 0S ) d1 0S HrKr P V Tß,0 S ,$C1! 0 000S  ReKL P !&g001&?P hTeK+ P & F!00! &Pq 1{ ve,6KQ01,&K `,6|AQ000L0SD1 S@D0S!1 S*0\!5 2! 5:? >PN0ׇ? >0N0CS101 ,6 0x ,6!q pX@0 H;pT([[X11112<2`2P[h2t2|22[2 -PULp`:4@$@TPZ 㡮U:22 0 8@080< --L W, p-PLM@P`l0l R cT D0 Rp80k d 0  b0@8}2 --L  --L  -LM@f h # --L  p-LtM/P@TK sP0: S p0`rSs Շ 0-/L@wPU+D0 00p/00(+f+f00N2 -LUMpPKP6P@lK8/0S-0: S  SU q|P U@P P@0 R000K@ P h1: S@ c$^<d23$3 P-L %P 屫43 -QLM@ wP T 堫FD3 -L;DP 咫T3 -kMLM7 6@, @6K0A䆟 A 6 PP6: S 1PK z&P0S| |6 Rq 0 S i\;0Sa L6L&@HfHv@@ @@@@0 00S P5P(0%<00PC0S0S X5 ,0S ,"L%e.K B BP \P @0@T H6<4"D0# sP@0@Tşş%5@0T06 v4 RД3S (0 త4 @@TZ0Q $R |P0S (4 R &6+P, ,4@ &PT6&  S0"",3 0P@ Uh 6T#00/>10@~3PL ~x3PTChG ~T3P= ~P03$- 6SR ,@!0@T00 "2 ~B00~0"S P x2|lPP\Hd,(PPO@sVT J/ [[o1  LPP>, ][&R0S%"0!S$ ЫpuyPL~v|d ,ntd 뚙?ALT[8[d3D-DT<[H[3[[P[PT3[,[4[33334@4d4444([pTL[[45[5[@5Z[d5[4T@THT!@\1 00CPp010  p[[0[ -L8M 0@K0 ,0  -RSL4M@ Ppl h\\1  BRH hT 0, P \0 , K X T L H D @ < 8 4 0 `HH\KP@ 0 P0 X T0 PP 0p  0U0?00f f{Fk`` {/00f V:TPU L0L X0 0 TP z U \Kd<[Md a -L p 0-LMMpPANK@D0@D` 0 5 k "80 o 0S @0X:[: -LM0@}oo@ -LM0@S F`GXG`G00S lh0 R \P0008N3c븅<[::: -L`PV똡嘁q@!ȳpb@1 P8H\H\HDH\H\H\H\H\H\H\H\HTH\H\H\H\HxHHHH@@1@@@0 L]004@0 0QQ0 R|0 R 0 R|0 RP0 R XyjP L壢H0J.\\[: \},:\\d\ -0`P0@LpP |VgPlP 00UGj0S8D7PP$  0 \|( \ -sL` P00CS00@Ӥ0tE U T T 3 R^ T0M CR `o000- CR 8^00@t$3 0 0 0S= 0^ CR /000T C@?R 00p P0@0@|2|t"0`000R P, 0Rޣp0 CR 0@0R P0Rģp0Rp1 R 0^ CR X000I CR 0000R0Rp1 R 0$ CR 000Rp0 R T 0 R2 0T0Q0S* Dl [0@" eX`i@0`[\\\ \\\\:d -0p`0P@LP fP@ 000T0S `pP@ 0 \|(\ -LpM` 0Rp䠟%  @p@ PP  ŢPP p @TPl0ld0 KᆏPL, P 3RP$ܓ[d\\([ -PL M@, 0 YP@0 -SX0`SpM 0A0C,S?QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ0,0  `  L4H4 0`00 ( p0SV PEU@  eP PEU@ȃc0S &ePPE@ $0S33 |3 00S UD30 0 %Y U Z U  ,  dU "0p0t0 ڴdPPUU|dP\PUSPb0S dP 0S0S20S p ` 0pGS # W R0S) 4Q P  PE@1QP Q dTPE@< 000PEU@ 00S1Q 00S  Ld0 kP 01S00S00S @ 3d|0 kPpk ^` `Fx?`d]4`E;`FFF`T`] ``FF 0-TPL0@S s<0  0P@0000 ` p-1LM0`@PP$ jPUP  jPPp jPx0l jP`P0X00 DjP< 000p `gi zi G`i \]G~i ` -L,MD0P`K@p,0 ($ { c `jp [0S W0S S0S%@PsP<   Cjp㧞<@TU  @00PEU00Sp<<,0 S,w `i$$G0G$G p-L,M`0P@@K0 +$ y{ 1c`0` j0sHDg I,8F @ 0S Ep `i$@GPGhG -L8M0@(0 LKPp`$ C{ bU0 @ PK6P @Rp΃0h-S`@dbP8@ D0D ip0 (0S (|GG `i$GG -PL` M0 p 6P`  e0 Sr200000S0p,K5P dߝ,PU V 0 Sr,200000S bP m TPh0 r1000P^ 00S .z  AR #  z  tAR #u dYb Ub 00S ZP2  p,Z  XbP% 0 00RSY 0@T 0R @0S 0 0S$0S 0p0SPU{,5VW<<( WGG^^d]t] ``x?,G -L0 ,a(0( hp+  `d] `zi G -4L ,a(0( hp  `d] `yi H p-L M$@K DQz8 hp$ $fP`  $0 0 ` hp 0$ PS 0@UU0  CR 0 R00Ğh 0PU@H00CS00  ä0 ]p `xi H,HTH -P0LMH@D0  \ (0$0  ````] -0L0 ` -0L0 ` -<0<L00, h0Sh  `d]i pH -80L4000 0g0Sh `d].i pH -L% 0000 0``] -0LM0@S/ h00S00S P00  t,0T, @00 0 0 0````]AH -$$ 0L00  `` -L(Mp0@PK` @ 0 }" g0S `3[x DT 0 T KmgP@ћ 0S,  `d]i `G`i HH Qd0d0A00d04`EE -L M Kp0,` T4$P@\  05Qt0p00dS X)[`0SHD p@h P`$ P0t@l0@BH`EH4`E p-0LM0`0S P oP!K2PQ@T 00S `P 0S 00S` @TV8׀03p`HT`IG `(I -PLM`@Kp| `$_1 @`3@0 DP 00 ,(0f0Sd] `i PI ``I -PLM`@Kp| `$_1 @`3@0 DP 00 ,{(0lf0Ssd] `i pI `|I p-L,M`0@PK@$ 0 w w_0S Wb P0r00000Sp  ,Ka_PX P?H00fp8 0S(yp `Ii$I `II p-L,M`0@PK@$ 0 zw 2_0S b P0r00000Sp  ,K_PX PH0ep8P 0S(4p `Ii$(J `LJ\J -LM@0Pp`P  R0@r1000xSY@Qg W ^PY r10000D0S  rt10000D0SX0UYDD)Y 0- qP100000S00B R00000ӑW0C q000000S00B R00000ӑW0C0@00W0\R00S r^P@00 `hV fv`lJJJ p-QLM@P` 00S R00000ӑxS T0S r000000S r000@000STT T00P0SPP  phI8@FT$@@TpJJ# 0-L0MP@0K; K @ h@0S`  @0[<0K]H0H <0K0dP0 0S 0d] ` `i JJ 0-L MP0Q 0 @!K  w0Sp = Kp0@KL ]@0@ dp0 0S 0J ` `iJK -LM䁟0\pK@8 P`K$0 u@ u0tL0 H0 0L0 Q *P L0H K2lpK1p`K01@Tژ2 bpgQQtPP@1@SPTUpPl rp200000S 0:SP P8l (PPU t@T0, CR 0 R00ꛘp0K1SQU@ Tڴ1S0Spm\X1PT![ Lb0D bP 1S  0 CR 0R00^l000CS00  ä0 \N00S),0 S,4 d] ` `i i8iiiiKKL Li|LCB L(L0L K@LDL`L.hLi tL`L ->MLDM1圑0 ,   >KK(@DD@D ds` ZP aP` 0S;,/8>{KL@K(pG $pG>[r r 8P 4p Z }aP@ <0S  <0TP( 0 0CS00ä0—<0@T|PZP ,0S<, `G ` `i Li|LLLLL -x0L`! @ T @ 0 CR 0R00ꆗmx0 sst`SpRW` LDLATP@fCPAC$lCZEd0S AB0S 0B8 0 CR 0R00?505P d 0 CR 0R00(x07< hLLMMMCB$M,M8M0 CR 0R00pphDp$X,X Q-L@ x`B @0S> 0CW31 V ,0 CR 0R00 ` R"R000ӑ0 CR 0P R  U 00 R0 S0 S0S p-L$M08@K`  Qj4 <0K 0 LP [ 0}s<0S  ltse0S 00S Q0S 1#$0$ <pDF -LMK,p0 Q`Z& 0@S @sW0000T00TQP  j jT@D0T0T0 d20DX@-^@ 0S\\  P2  RR P2 R\ 0S\ -LM@  G,4X -L(M@q0D@K$ ,a 0 2j$ Q Xp0S3 0S/ 4P%daP0   Xp 0@`TUQPPE Vt`߾ hܾ@00U00SV ͎ 0S,  ` `i$XXXxX - @LM0 i\4V 0-Lk@TlPll 0h~Q 00C404 JX0S 0hO0d]X ` `i XDDxQD0DsQ0@-@@@((0P\ P, ,0PRP0@00@-@@@((0P\P, ,0PRP00@0@-@@@ 0P\ P$ $0PRP0@00@-@@@ 0P\P$ $0PRP00@0@-@@@000P\ P4 40PRP0@00@-@@@000P\P4 40PRP00@|@-@@< <0@R8 80R < <0@R8 80R@`@-@@< <0@R8 80R < <0@R8 80R@H -LM`p5c P8 %00Xr|P5帕 P@ %< 嗜p< 10@GS񟗤̥@@@@@@@@@@@@@@@@@@ @@@@@(@@@@@4<D@@@@@@@@@@@@L@Th@t||@Ħ$4@@PD4T$P@@H4@@$4P($4@ $P@@@ 4333 3#P@3#3330ă80 ;0u3h#@t3P@@`#`3P@#@@x3,#PP@d3`3\3X#PWP3#00Q 3#< e<J2"P2@@@#0Sq`a%2 R2 R 2 R2 Rh"0S0S\2 R42 R0SX2 R 80S(Y 0/;40 "0S9 !0S3 %S" !0S! 1 R!0S!t1 R!!1V   y11 S41 R!1 Rt!t!p! 0S ST!S0 R 9X@ 0B ?L@0 `){  P$ra``Y aYa.\Y``a`hYtYYYY 0-0P R 0L0x0 R00d0 RX0 R H0 @T4a0a00 a`a`0 -LM,K0 P| lR0 0 Q{00P4 U 0S 004!4  R0 P,@4`8 4`P80080 3S 1 R1 R 01@`嚸80 R< ;a 0HH>A^K PEPE0$ ``YYY,0 -h0LM$pK\P@`  L;0s,  ۵0 յ`YY p-LM@`0S Pq00  00S|0 R?0X CR 00`0Sp0R P崅` -0L (>`},Y -LMp W@P< ! ?K0PdS pğp0<0 0dd` Xp1@T <PL`< 00$3``#`22 Pb0A QU 0ŸS2  0S "0S}  HEd2Pp PPhd"S000 8 KP8<"H0SXT PCP:G< R P 1 R ,0S L0S RR P 1/2a@#b! 8KFcPڲ3[ Z0S V\=,08!z(!ufJP@ 0S0 d@ P P |徂/۶P  D00Sb0@~\Hȕ[Еԕؕ̕ĕZ [8[gMbX[d[[[[[ -LpP`H mPP=XP@0 X PS_ `ۃiP0`  (``(0S<0 0P,` P0,,0@| 0S0@LL ,0 00  g$Z\\@\ p-LMT`@T PP T0S0U@0pg00P 0 RPg p-LM`hPP@0  0P0;\0dh  z00TTPPPPPPP pJrpo0Zl\\ -LM,K㐒2嘢@ 4pKT ' @,0@PQ h2 R,0S`t7P0 P, 0,0@40Q9 @T40Q& , Q ៵00 0cP l  1 Rʄxx!=9 B = 0 0R 0S(,! 0R`VV `0 0,00 R A Q $08 0bS$0$00,0^00STd 0,000,0,@ m 0Rdgԕa0PP d|^dZ^ggg8g$aXgHg^^^^^_ -1L$M@HK,@ |H0KP0T0@0P 0P @ 0` S@)p p ````   @P ^@ @@@,P 0P20 WPP0P 02S 8 0\` 00,000,0 Q 8,9,0 RgpZ4_gX_l_ԕ -LLMTTC`0 $0 $PPp0 SP )Q )Q 000  R0S^ " $0S $V \0P R T K.0l'YdK@V0@L"0SZ0S T K.0YdK@V0!W 0S T K.0XdK@V!000SPP `T K.0X ,0L!(lL0, 0RL0RR000,0T K.0XdK@V T K.0XdK@xV0 x 0>l` g0STR `Q0SK R pG8< 0g|Zx__`g___,`T`````0 gtg -L(Mlq0@PKda @ 0 ~H HPD3[1 ,,!0zP"P  0 S   00 0 x 0x 3KHP78T 0ꉫ78 0tgi Z`a a4aDaPai xaa -LPM∡0H@Kp|P `(0 HP DP @P C@;C0T PUL1f(0 S (o&C 1P @0S0S 00S.pX | NKHS FPLf85PP 05(, ީ5 bIi Z$b@bPb0@-P@U>01 0 R 000 ^0 0-@0P0LS0S 0' ; |0PP 0x 00P 00鐩58H 0ꆩ5$ Z43gxgghb^ -!LWM0,0  p|PUaKJ/ Wd ?T [FP=WoK0PS @W 0]KS  @P U00R00Se0 ,0S , \\ K.0 U0 O \ 5D0D <5 0$ 3xbJi(|bZbb^ -LdM☑@q, KⲠP0K0`0 ` p@ 0K K` `0P` 0 R  )000 PPPP0  0S 0 0 .0\ KUUl`K@ S0 0p P ,0S X, R@ᝨ40 xg [bgbX_ -RML 7 M(% 4%  ǟ7 ȟx,  ,  0 8 < @  t' 噊p/ H0@/S`Lpt(0:;;@00S lVA0C2SEh0<00S|090;0:0;j0:080gş80:( 8 07^FKL L4EG.Kx t :  B0p l zP 0 P5 - 09;F@ ^0:;8ꋧ TNKA dy@ 倧0S 0 R 4%RQ #NKA WD4P|ß0 R 4 R Xh 0@0ZiP00<0 L,0, "NKA )2\3 R 4 R0 S  "NKAl2`P0S2 4 R.". GP"'@$0 )y/ )'T 2P00(x10 \hP 2T hPp!NKA P L0 R 4 Rk (`rΦX@@ a080 00|V00NKA 1Pڠ0 R 4 R Pø;d0 0:;7+/0<0:;:?.Ahhd|> O2y@P80 ,%R0 KL@ L@@@@@N>K@0C, @:0C D P$0S `0 0 )QPC"0  NNKL2@D@DP)` 0T `QPH2) 0`QPpg Ip H 0S Qx0S 33  0 0> 5 CP$  0 @T @%@T  6UPTT$0 00000000@P@T`@0D @ED4 @0R4 1 @P ,O>K)0C* kQp s $KNK@D04% R44:0  4 4: 0 HQPPh0 8EP00 0 s0% 0% 05S8%R 454 00) 0x0   ,0S  < 4 (%R F <5P(%p2 0s 400) 0   0Q4 ZQʨ&0) %R 0S`\KPE'p@0@PP 6&0@PP6ONK@DP) 0 PPP6) 0PPP(@ @徧  帧 L p A %r6B3B0@ 8x00MKBKK PhPK@ALI @A L 0ID L H PUd@T]0SV0 NP@0 5 @VP> D%804 =KH0Cˠ 4 $5 4 DL5 D 4 `P H%$Gp  R 0S:HPڠ0   80S Oߣ0S v @P-$A,:0=KEK0CL0C 0 01P\: Rhfp ;x 徧/u Du0 S X*N>K0Cɠ@ 0Cp* @O 1u05 vPP:`@+0V@0  )0 OPX%MUPtO.K B< B(`P`4AP4  `J@TO^KPEPE 0 P@540S {wAP0vT4AP~ XjA`l<Pt` |04 -<@O>K0C)0C D TOP [KNK@D qQO>K)0C ?OpF N>K0C 0C4 0OD-D00.% t` xt$l=l ͣP| % 1 PP` J@P 0 U eA,%0Y-PP0  P$ 000P hh -LM8P |0 R 0 l00 L%L &w#P 00 @4 @ @ @ _@ K N@@<00    0  -3L$M R 0SS@@@@@@@@@pp3  M\\!00j0Kvg_3 3 .$(," \"(!̠0!0 `.2 p22@80K8P  0 0@ ,@ 4p Y0P0?@ P`2 X0E0P 8 u,@K?<@@<4 Ġ̌(<"4!Č ̌$ 04SM|&''''d1`2  _  R$ R <W 0PPK .0eFP 0 DRWPPK .0RFP pU 1MK @D K@D @ @ 0Xt \Ptpnlhd`\Xޜ ܜ 04S(@(H(P(X(Ϝ0   Q1q$k P3 K P- 8 P0 1P0 21 .1 +|1 (p1 %d1 "X1 L1 @1 41 (1 1 1 1 0 0 0 0 0A[?[0HP @@[0G @0H P 40K9K3K6Kd<@T KVhp (0S4(ԠTL> q p-LMP`0,@KHP 0 + |!G 0Sprr -LM@P  00R0R  00Sh  -LM@P h00Sh  0-LP@P $00S0h  0 -L M K2P@![A[R0 ʐP x0td P00TT0@LP 400 PP00ht@r$rY(r -LMI.H̟qf qčTqܟȍ̍qXxЍԍqf؍܍qqqqq<dqq 000 -$0LM@ 00[ 000000000000 0000 `0`圢0A> 06 pIpq QcPa 4S4S 4?0 8pP@us*`0A>@t 0 001 0*l (pP|R*?T A.0O0P000B>0,10S 4PU/0K000 q*;040 00S 00S" 00 0000000`0` 0 0 0 0000000 0000 `0`0 $4SY*0p rr$Р -pLM@ 00s)0@r@-`@? 0"00\ 0S0S000\ -LMZIp q  Z0Y0:H!O 4  6y†04 S4 S* P%0 4 S4 S0 4 S4 S*p 00 0 4 S4 S:T0O YA. P ` `6& 0I6Y$Р -x0LM@ 4 BN@Ap@0t hz 00NpР 0-LgP" 0P0Q  0R 0R Q(00A> 000 $$0(00S00B>0$@-(0A> 0$Đ6I  -LM@$0AR 0  0R0$$R 005:| L0$$R0$4 A  0@0 0$4  0-PL $4S0C! 4S4S 4 A> 0@0P0 A 0@d0 $4T0$0AR 0  0R$$0R* 000hc5=?0/9P6 0S000  p- LM 4B>0 pQ 0P@00QP`@BN@0 A>0A> 00$d0(@K B>R0  40 40 0x6pqph(ps -LM}3Px 404@0  0000 0 00 0 0 00  0?\00 -LMX@ 0S 00 0 @0S0 04h -LM@0 6pq @ -LM̀p`P@TC@! 3A>B.A 0 0$D4 dD P  40 40 4sto 0-tP@0L 4@ 4@I 40 04T&0@0h000 pD0 00000Sp00000S p0 000  -p000L00 0S0  Pt t;P@ qL0 0000 0S8 0(0$ : {$s (s,s(0 $ 00 0 $  -L 00 0 p-LMP%%$`$@000%000p% -`Lp00S 0P@w%x 0 0S %l%0 0 00(`S@0S0S 0-L@LP 0LR0 0CS00 00 00  -鐠p0 刀0b? |`PUL@0S 2$%0 P0b?U0S( 0f0@m  -錀p0 儠0b? x`@TLP U u$0 @0b?TU,0@ 00c0m^  -PL0`0pS @$ 0 R $ 0 0CR00S 000$$000 p-LM|` x0RR@$`0`P0 0R00C0$00`00S c0Sp 0-p@LP$`0P0z$D P:00@P*0P0 0-t@tP0LS 0S 0S0800 P0S00( - 0L00S W 0-xPx@0LS 0S S0S0S S 0S 0S S 0S0S S0 -LML@00 S00 S S 00 SS -H0LM0@S ,0@$ 0@]00 ( 000( 0-L@dPeedded$ffeeef,f,f,f,f,f,ff,f,f,f,f,f,f,f,f,f,f,f,f,f,f,f,f,f,f,f,f,f,f,f,f,f,f,f,f,f,f,f,f,f,f,f,f,f,f,f,f,f,f,f,f,f,f,f,f,f,f,f,f,f,f,f,f,f,f,f,f,f,f,f,f,f,f,f,f,f,f,f,f,f,f,f,f,f,f,f,f,f$f0h0hlA00S S y00S SLM0.0?.00e=@]@0 S=@= +=0S?0SeXC`0SeX@e dM0S P P 0S#0K$`K$K P P 0(K(0 F@(P]T0DcS&pwvy`{u~~yw0 -L M@000 p`P00T,0  300CW 30SW200CW 9B2 R 200CWUV T0S x20S [,UVP i; R R E20S pWWJZZ`P#p`Pv0X,0 p@q>P ,PL1AP-00Y000 # 1 00S0uv   00S00S0   00S5 00S 00S,pWZ00S0   ,0S 00p 000 00SYk 0 o~ lh4u0$,Р -LM@`PpTW 000CT0 @T Jp`PvY Z@@TZXZ!o7 , -01L M0pS` 10S P; i9pP@+u)V 0AP 00S PP@ 0pP@u l0 000 0H,$ -LMp`pP@uV iE 0S<00S,00S 0 0S00CLh'Iu P000P -P0Q0L00 00 000@ - L00 00C0@ p-LMP`(*@0  000p P0-L@P@ 0T庼0h鷼00PP0PP -LM@0S00@ p-DPLM@`T Pp@Tp 0-LP@P000P0000000000   -pLMP@u) 10S1!00`Q0 #P+hp@ UP@< P00 P8p0t T =  P 0`V00S:00 P``V$0P@` P@@P$@Fx00S00 S 0 P@ P pCP@造L$Р8PT -pL MXrPp20S200QPW0 P@P v20S @ T T10: P@ P p1@0`PP` x!0$ P@ p`PP,  0,0 @7Qp@ 0000  &0 P` P k @0Q P 0Px00Sl00 @,@ @0PU`XW,x  造LTР8P p-pLM`Pv cP;p P P@0P`40`.@0P`p P P0`p -L0SH hp0 s 0 0  Bhv -LMp`pP@u P |00Sh0 tW V P@(0 f K!錠<$vHv -L M@Kq O p-LM`pP@uxEpP@uPph UT0 phhvv< p-LM`P@P  P psP@$00S/ phꌠ -L M`P, , SP,0@cT A dxuP@ Ho1pw0x00XW0A ,0@T)y z  V0 U0 1 ,0c@0;p`Pv ,0@T| ,1 ,0@d@ 0@ܠ,@00CT Tp`Pv XW  000S o20@0CTA D0@@Y 0 0@@v,0( -hL6` 0S 0 0S<0040   0+0 v0FDHL -p嬀0L`gPPጠ _@T0 W0P0G  c$  bz$P@`LDHL0 0DS@0 80 40 00 ,0 00 0 X̐ĐȐԐА -L M@@0 S( P@p`p`20S, 2Ÿ  00 r0s 0SR !0S0S1 01 00p 0 00 0S/@@K 0 $1P a,1UP0!c0@P#P 0 0P00 0 0  0Rph0 00d0 0000 S 0 (0S8(dXDHLY̐v p-LM0`SQP@0SPE P P@P0SUfp0SQ 0S0ASQ 00S0 0S  -qaQL 0@ l0T@lT@S   0^ࠡ0nP 0 000 h0 00000nP0<0 0n d0 ̐$DH4@P 80DTL$0 000 @P ꘻$0 000؟ p-0LM0@S 0S PpP pp`P R`000SP PT R ,0000SS Pp$H -@LM80 00 B0 @00`0鼐DH -T0LM0@SJ@000S P @TZ鼐D -0LA P -QPp1MLP0 0``P!A0P000SPh0S `1@HT1@0@T @1@a0 0CRP  UR1000S S 00@0TS P0ø 0D Rڴ000SP W00P00S U PT P00C0LL0 0p<0 0P000ؚАLDH -0LM00@0T0p` Pcڴ10U 010`@P`  TJ1U RZT010Pe0 DPPE0 0U004К̐PԚ -p@LP`P 05P  T0P0@` "l@h 0RX0X 0 ?R D0@0 000c Ԑؐ48D P-L@p`5PU U nU"0 Pa50Sa uꈥ\ |0L 0R 0SPUQL0   RRyxw0 P50000050Sp 0S 0S0STQڨ0   RRPO0 P0 00& 0SI 4Q!0S 40S0ST0   RR(0 `P000 3 0S R0S300PSU T P0 :P000 ßS0 0S_T2QW T g 0 P_T$0S 0S a 000S|2Q00  C\2LB 0 P 0 P000=_S0S 0S  0S  0S 1 T "0  P  T  0 P000 P D10SLSS G >PC <P2 10S ST0 )0P 0 @@0@0@0TP 0 PX 000P 0 yP  000鰠Đ$DHؚ( 0-@1@LP T00 P0S1b Q 1 Rb\0 00R 00S 00S00S 0 000 00000 00 p00S d00S *00 00T000Ԑؐ48DHXАP00S 00<0< 80Q0(000000Ȑ\v8HD0 0 Ȑ4 p-pLM@0`t lPPCp@ p.,@0t T T000CUP800@&P@0 V000pLD -@0LMTpP-P $@0ꌀ0P0PE( P@ p U `ZP @0<0Pf(0PE0@W0000LD@-p@T* R  :P0b0D 6@0@@0@0 H< @-P 0S 00Q  -L``P@ T 0S0S*0 S0SB @ T 0S0S:p R000 0  `0St0 @ R0 0S0S@@0 S$0 0 0 H -L^ 0 vܚ -LMH@0S dR 00 000P00LP -2LM0pS px} XW"Z 0S 0S *Z 0S0S:0S0S0$2Z 2 00`PQ PU`R?Q=PP;1 `XW f1`P0 00pv  0x@0XW4  0 V;U9@04P 0 `VU a0`P0 00pv  09@0VU80   dPLРܚ -LMZP,"PU 0 S 0 S *PU 0 S0 S:0 S0 S01U 00 p ` Q `VpR+Q)Pp4P(0`ZGYE $1p0 00px  0@0P`Z,Y)p P ` V U x0p0 00px  0@0P` V U0 Р -LM P@p` P@t0u00X00S T00XtuP@tTU@0 -L M0-S eGEC^,  g*`P ^LPp% 0S" 0SIPP` @@@HP 0`U0S%Pe* % *Y L `40 , ol|8ubw( 400S Aha0@S<0 -A @L2$0R20Tw -'PLM! $P .P ^P@0 00 `P|@000C 0`@`000T@P@ 0s0s(Tv,w -LP 0-LM@ PKT 00000 -L M@K0,sώ0s 00@3d -L M^@K |0^0s 0s\0000 H00 0400 S P 餚< -LZP ,0, 0S p(pT00C p p000C 000C?001X0@-H 0\8001000\0 010X0@-<00 CR,0010 BR0 000X0@-8 0R (0P@0100 R0X p-L MP` 0@R$K0S ]0 /00$0s 0s 0 01$ KpX0@-P 0S0S0X@0^! 00S 0SN00^0X 0AP<00 r0s  PX@-p@0\`0 0r0s 00000\0 X 0P PPB@ -LM\X@TLD@0 840 ,(0oĠo,pp\p`8qd p-LM@/@`P8 0S BPl   70  p錟 -0LMK0K00K 0-L M8P0@K 0 . 0S D0 0-L M8P0@K 0 N 0S .0 0-LM8P0(@K 0 n 0S 0M -LM@u q0r00T00S 800T@qr  -LMB@6P񟗓                                @T \      t1 p1RDT10SD1@18B01$1@0S, upq' P0mp@q aQP@@ T0 SPO@@Fp q  (0\P錟Ğ8,(dП p-LMB@6PXXXXXXXXXXXPXXX(XXXXXXXXXXXXXDdpXLXXXXXhXXXXXXX0pP@u2HP@UʰP2 R B@0`PP`VUP@UʒPL2  B?n@0%2z2S P@@r@0`PP`VhUfP@U`P^ph\0P@~t0 u SR?P@09 ep0 s2  0 _0 S*P(Rph=Op0 s ph| |0S0S S00CS00S S p@,0RP phph-p8Ğ 0:S S@.S ?S  \SR R 0-0LP0CP@ Sf|||||0B0C2S=ldt\0 00 0 PE000< -<<LM0pSP0:S %S .S) ?S \S / `V $K00!c(PPDP`VPE $K@@!O(P (0S PW00P:g錟Ğ.0\ -D0L<080`00 ,0b A0 |ĠП(0$0 0b0c0A}d -0LSPp`@7  r000000S R000@00ӑ0 T00R00S@D 0S 0S uP0S000S&10T00S 0T S@D00\00SH00S800SSS00S᤟0S r0000000S0S000  $00S00Sᬟ| -0LM0@SԀTpW.0000Sp頠`00CVP@tu 0 0S 0`0CVp0ܟ -$LM0s0s@ !1 P@R00or00SnP`00CV)pP@u XWp q   Q0 P0  Z$`00CVܟ0 -LU0S, ,h0S000hVꐟ -PlpL† @430SX L0Sh=@0S⋢0P造|< -LM@PQ=0 | p-LMP `@ (0K l0 0"T\XPP (0 00 p鬟| 0-DPLP @:T000  00h@-p`P@Q|0s 0S 0S tu' 0S$\!:00SP00S0Q 0S 0S tu 0S0S*QXh@-0S  0S 0R0S ^ 00S0S:@T 0S 0S 0R 0R@螡@ -LP@ M`, K00 p`PWY Z 0S0 S` M Z  0 S0 Sp`A , 0S? 0 S, @0 P`R @0P`, P,0S, 0S @0P,`00 ,  0S0S , @0 QP`R0QSW -LM\S\p`@0 :< P @0R_@00hï @ 00 0hï @ 0<K%0SP0PS @K 0P<K 0O<\ 0 <0 <\h00S0 0 TꨟD -LM@K=0s0s n0 c -Lr 0 0S0 h造 -LM@P  pP@umP@0pX W``0P@,0`(WP@  hpP@u|0`0VpP@u p u `VJpP@u 騠< -L,M@@K `Pr@K` ph200 <q8 r 08@ T<\  Q R`( 0@0C 0, K  `P @0 8 ` P @0puv R@0KD10S D@0dS0c S0 P @,0K4 K0,m@K,#0"0P00S`0P00S Q   H  4  , 00@z00CS0uH00So4, 00  @~@THРd -QLM@P` 0S!-P 1,0<R A0S* 0S!0S001 &뀁p0S  PP1Wp 0S  01A 0S 1 0S{  0K(0s$@tm K>0 ` PP` h P00 R00SH0  0K 0P LDl< -L4MP@pß00K @KP  R0S `  D `VD r0s tu h20S R0S0S *tu $200@_0 K0tu 0S0S*100@_10!0S0S00 ?SRp00pWÏ0K D1t u  y0z 0 U T P @t u  U0T0 " 0 @0K@  Pl q0s  ,0S00S0K@0K0 K0@ K 0锟Lp@-`^@P  \\ 0S 0\ 0SP@Up^p 000Р 000Р 000Р -@LMTP oDl< gdah]""4" -81LMXH @@ K|C@ [:nT0  @`Pp%0S0S 0 0?00`0  X 0S L0DS$0   iР"(ܚd -LM0$ KK 0 0 P$ - L P00Ԡ -LML0K Ap@T0[S00KT[Ԡ -FML M7GNK, t7t@D @D0`PXX sD'X<p 20@FS&&,,,,,,,,,,,,,,,,|%,,,, ',,|%,,,|%,d','',,,,,,,,,,,',(@(L(,,,,X(,,d(,,p(,,***,,T++6 R5 5 R0%<0uKA $P00Q0S Q0(8luKA $P00Q0S 4; 5p$5 k5 gtKA s$?Q0S 08:$000N000;0@008`4 R$ = KJ p pGJ HL$ 0 Ps /P* P P $0004SP0;000@P P3 R3 aP3  080@0 P8  Pd3    P43    P3 R0"< P P070$H P P060$T 060$P 070$L 0 70T H L 008rKA $P00Q0S  n0$000qKA $P00Q0S U0,0|qKA $P00Q0S l?0 0$qKA $P00Q0S )0001 `bVQ$B~KpGpG`\P  2P $0HP cX0-S jx )t'4\|>ԅ 8P0gkg -L4M0 4 00[ ,0 XZP@K0@FP@P 0L0P 84 R 0@ D0  @ D t0H0 0D S ;0 oR04  0S00@ 8#8L0 T3 M 00CS0|S0 00| P@7@c000<0SC0S #0P W000 S)ԔL< C444 00 0hBD@0px )rd2 R  4@ 0SZ ,K00D 諠PPJ 6D080 ` 1B< @K0 00!P@$ P 1 xo(q@ R xed(`1 RH@4@0thܠ(T -LMp0R@ 0 P`0 B|UTP$ "NKP0 p`  0 S P T0@T@ OU9hȤ -OMLMB Ur  , u F ?K@KA [%0 B% 0UK 0 P.UOKH H Q *WU1(K R qP0`S @0 @Pta 0PS@pPP01PQF n% 5P P P 00P@00P0S P&TK@ ?KRp%XPP 0, BQ40  P,ZDT8LW꘡ܤ(M ,@Lp -GML M!0p,0  $KJ`J*K@_ ?K0 K@_0ypW  0SS?A pV`P$ZW0 ,0S , P-L@ p0 Sp p `P ޶P P4  0@Sp0!R頤 -LlMȀ0@K pd$0 康`0S" y0`C3TP|VS0@` @T&P$TPd L& $0S $埛T |h -LtMpp, `PKY 0<< 0 @@uVW rV!diP; *0W0@ 0[?S. Y  KP 0@ S @RT00T0ST00T0S\0 ,0S X,DL9V@5V@F  |$,Dh p-@LMVX`D00CS0X0ӤX0 PpP x@00CS00Ӥ0 Pppu YUyUpC@  d|h0!400   00!$!Ƞ ! -AML M , @t4D 4$ 0D@4 BnKP4`F(K t0@Y.@P?/@@B@DRPN`,0 @`VP$@Z -@L MX k&>opn00@X$`pZ p-LM&> @`@KS NP PU$@p, -LĠ[D 0Pp`W , nrp  P O00 -LĠ[D 0\Pp`W,  "p  P( O00sd -GMLM 0`p,0 CMK@D@D 0PX0 )K /oO~@0  pX `V@$p,0 S ,巗@ -LMO뜐0,0 so P 0  @lP@R,0\ E0[S ,0 R,00ZP`p,0  |"Ld|8 - 0 S[R伇 -LM P@ ?0 1<00 ! 0! 0 QQ?  0 1<00@X0S o0S 0<?S 0S 0S0?S0S  M-LMPT00\,0 `00S S00\ ,0 !0SS:P% 0@0@ 0? <#! 00!  00 0? <#! 00g,0S 0@0 @   !0$0   Op -LPE@c@@4@Pc.@Pc@@  -LM✀oK@pP, k @<L#NP@Pw0N,0 S ,˕8 -LM`p R0 @ˠ p P̠ 0Xp  @? 04p  @Xht -L,M|10  00S ⴮PPkP@0 @PP `DpKAA0N0PDK0000 8Pԩ -LM@|30 ` 0p0S. `PfM1 SB  N! 0@r!0!! PpR \!!!!!!!!! O,P) 0 !\!  0  ` S ! 1 R !!PP @ @ PE0Nd0 , P@! ^,!00p@ ^0 0p@  ^0pP@ ^, 0p@ ^0 0tp@0^ p HPdĭxpĪܪ 4 p-L MPq00  0`0S AOpိ@11Tl^L t @@o! 00@!0!P`HPd -LM`|0@ 0 0p0S$ G11.QQQt@0SPU`BLPNHN@ ?_0NHl 0-@LPNs0锥 -LM␠@0`(0 N`oKp_90 p`` (0S (奓Ы -Lc 0-@L0S P0  PN0S0 -0LM@ r &> KU -`q00 L 0p0S2 @ᚬ P%P#Uw 11>p EN11>.QQ$ D2N<}K Dzp$N@H` 0-LM Pv R|@|K  0S@ pX K@0TD  <"L弍 0鸹й8 p-MLM`@0 0 P`p* AK@@+0zTP! T*AKAA 0r00000S  r\00000S 0S@\:۰0 Spu-Q* rh000000S  r@00000S0S QQ: p-PLMU`x x0]d XX 0@04PP0P"0p锬 p-LM 0@Px50`0X0S 00 0 0,@P @ p鸅 -0 SL0S S h0 hr鰬 -0LS S h饯 h밬 -LM0@S S   h鯌갬 -0L w㯆}, -QLM,  10S 1 0 RA000x,  00S Sp1I0S; `10S7T1,@<T@@@@ ! 0Pp`SO1 0p^UPP$X U`00Q` e Xp, hP PP `pchP`0`@"H0 , j,0 0!0 0 000Х0 .d!ĬȬ̬dЬ 0-LPnP @Te0h` p-LM`)P@P 0 SP UT0  IKP00@  6p  -9LMܩ 000`fS0  eS gS )))000P@00GS񟗰nnnnnnnnnnTrTrTrTrTrTrTrToTooTr,p8pXp|prTrTrpTrTrTrpTrppTrppTrTrTrTrTrTrTrTrTrTr0rpqTr qqTr@qTqTrTrtqTrqqTrqpqTrXrqqqTqTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrTrqTrXrDrT u6 0 00 R5 5 5R95 ! 0 B 5E ,K喯0, R( P00R0S p AW\5 \EPD%00@%6 ,Ky0, R P00R0Sp44r44  44 4 D$4 4:$$000htt0 0 0% X4ZTT 0+@4P<4N4:N830000E3 3<3   83 33/3)3 3$3"3 3330CJP<3hBP P;P <43 R$3P0@S@# 30!)pp8P20 P2U0!0 `c TPV20S* 0S00`F00  10hS"@0003@2 0T03 0 h1R0S040  008P \1 .P !@8 ܧĥ,,ԥ4ȥ0̥@@bPХ<,إ -LM@PpK" p P0Sʄ0   T p`>p  00 0 -LM@h@- 0@R:T 0 S* 0R S R  :0 0b0000訥 00 0ᬥ -@L0P00   T00 0D S0<PP4 0 0PS0h鬥8 4R00C0 R0 ᬥ -LM@T- -LP p-0LM0Q 0R0SP  *P`3S S S4 085 P+P@p@  -PLM`bPP20StI  P X20SC<<"0@S@00K 0` <@ @@ 00K@  0@@pK0 K\ , * 1@ <0R0 0S B S@ < lP@t1 Z00R00S H000 810S,10S 10SJq0S 00S0G GP0SX,E@X00 R00S!EX 0S0S0SL 0Y0 R00S <00SDG  4X8l -x2LM< P \20S``JH"`0P=020p R8K  01@P10pK0P@ 0 0=P10S 8PK(0S0 00S,0S P` Pq0僐Z410S V``V < 0R0! R00S8A RV3 00S/00S+V# p0SR 0 00R00SR kD0 0R00\h0 : -00C0ȥХ,<̥(d -@L`P1T T0q4T0S` 0U  R00000ӑ00Q000 Q0 Q0a !00S  R<000ӑ0!0a00Q0 -LM@P[pt ttt00S$S 0,p 0 0`^S0p0C0$3t0 S 3 0S00 B B0 0 S P0@ P00C0044 P  0RI r@200000S r2P000PU0_S ,S ^S $S =S -S :S /S 10S  R10000ӑ0.S 0`?QXZ, ̅P0Q010S$10S p, R X00b0CS0X40h0j`C f0Q0Q a01 p00S  Rh000ӑ0!0a0 Q4S0 -LM@0p@R`,@ *$R 4Sf 4S P`PR S Y7Kp20O00O4S  0 0 Sr400000S00S_S   P0S r4400000S0_S 0 S 0R r300000S0_S0 Sr300000S00S_S4SPk P bpW00cO0O4S @0 0 Sr200000S>00S_S:   P0S r200000S(0_S% 0S! 0R rH200000S0_S0 Sr 200000Sl00S_Sh  Us 0b00S10PcUj~pZ0O00O4SL @0 0 SrT100000SA00S_S=   P0S r000000S+0_S( 0S$ 0R  r000000S0_S0 Srh000000S00S_S@,@  0 S 0 b10PU, -L׃Pe ([ -L.P[ X^0@-@TP* ^ \00S.^ H0 0S \4000 ӑ^ 0@T:0 -\0Q 0\ a p-1LM0`S@PP10S U t0 CR 0R0 S 0@00,CP$10S U 0 CR 0R0 S 0@00CPU 0 CR 0R0 S 0@0TL@0 (00CS0 ph0  0p` TY -LM@PJ@`p!j"pF@K 0PD(pppppppppppppppppppppppppp pppp4pDpppppppppppTpx` 1p1' 0`0 R0Y00 @b0Q T00S J0 R 0 R V @PG0P@S@0$|>TPLHkh p-LMK/P @P`J011QhTZ MP@Tj_EZpD]P TP`d -LKM MCNK@D0@D,0 pCKKPPPM.KAAbP@4: S  S \H,0 S <,备mK`F`F P@ PP  P@h 2 R_2 R BPO P4S 0G0@$<@ 8@ ;0K4@ 0@ CK08K KKNN( 0<K @$P`! 04 1D MNK !0P o0 0xB{p B@P p @0MD@0 0Pd :P $$  pM:0P 0 2P T]] (P@T Ph5mK`F`F P8ȯkHTP ԯ -LMp(KPP3 @T `W@ W Tjo(TPZ ( D (00(PZ ( D (00T>Bk 0-x0L0PS0@Q  P 0S(0 R00 R0鬧D P-L` 0S nS 0@ ,P@ǀl0PP@p` ,Pp@0oS` >hD p-PLM@ PPpP .P 00P @Q T`ܠP. P 00РP 0SpL -L 0KM#+O -L 0iz,,H -OML Mh3PJK@@| ,  K 0CP<P P| <0$\-PPL 0<1 y|>lmpLp\p00g -LM@ P T  Q q0@0  R\ 8 -LM@$P T  Q q0@0  R\ ]ߝP 0-LM0P00CSK @ 0$ ϓ0 R  A00@d|> -L0H >y|, -LM`P%P( @(K,pK 0  (0@Sk  -L M0@p00 0Sf &?PP 0S nSW =P0`0@Q  P QIQG  0V0P . 0' Y0  0000V 0`0 ,Kᛣ, ?R0S@p @;0"Sl 0Y000 LPH00D 0oSP :ggggg -L$M<@K`PPD  P40K>PsC圃 -0,0K * K#pr ?0L:SlꠢءX8XLtX0000S  @@K,p| @ ?@ ~兜2000,K +K.0Se D 00|!0`VQF `Fv  P?Pp   0z`Fv P@ pP P P pP@D0S  Dp\0l 0 a>#40K` X̲`X84|>0ucf`kk 43h -LM0@S\ PH P8PP cf`k -ML M0ß0`@( ,0 @q3P`d088 B~KpGpGP"04 0X T048"qP0 T  TPP KA >KA B0Ck048\480   82X4"@ ,0>=08@Tn 4 p@` P- U|4|X@ 1 ,0S ,(KAA =P<8#4P   \T P=0WT ,  "4pp PX^^K R0000 0W 9 00,80 080  0PP 00  B 0S00C0V 0R0R`V` 0S 0S4P  0S 4P `y^y\y  0,<P%p  0 9, 8 R" 0PU 0S  0 U  0PPU8>84P00`XKc9LL%hp@,TXhTx r.ܳ@84 -LP@P : q00  R.@P*`p@T  }P0 R @Tj@0 0 000< @0@000eP`*hX 0-T0LPU @8 @T ,8@T PU0hܒ -LPp @`T P @T@74 100 00 @@m p-LM @`P 0PP ,0 R Cp 000pT -`LMP@(P$1$fPp` !T0s ?S mS 0Pp) x0 PbQ VU UWtV fr0 pR0`0s.}ܴ|> -LM0@0cSZ bSZ4 `K  0pR R   0 P `V | $40"WĂ,(0 ("4S @ %P 4T p-LM@PP`pP$0S`~8긅 -PLM808 4 $@, D @xq}t,ȵ P-L 0,0, (+$9 0^qX}l, -Pp@LP;`"dpT@6 "P/ 44444444444444444444444444$44,4<1`1 11111a Q@b11 RQ ||10sM P % @+P9tttl00]pp000ظ|>@@<80<g -43L$M `R@P#TTP0-S  @P񟗩,4<<D 2 @@KDKp  0@ < 8@ 4@ 0p ,@ @@PPDPn@0S_V V@ *0SR 20S@T:7v1LP0S   RR 1 R001 6pP%|1 R\!0S0  DE60S0C00 :636+6r30 R 6uP` 0  @@]PD0l$ ^ \L X@0<8 @@0Hl([ -LMA%QCX|@xx0  Q d\0S P 0R 0000$@[똱4D̹ -@6L M P0R@`,P 0 4P { 0gS 5@DT%U0-S 50 , K P5 RPP |||%U500@DTd5d%0Q4  S4  040 5 s 54 PppRp@100 QPP 103S 10S4 R0S ,Q  0S ,0@  0gS 144` R4@4P<$ 40040SU V V4U7V  4U00T00S 3 R340@S (3 R 0k`4\ 2 b0 0, K4 [0@-SB|  ,@P`ht` 080 0@2 z|@T , KO4 0 @T  B@T t!00000@T  @T 00 $0 0w@T {$1 1w @T  w{@T ^cyyph0$ @T {|m0.<h@Hnl[طuж @|D -PLM@0!P@- 0-S ,@Ph080hz0000 ꀪ-P000 R b0P P51:P13:4S<4<,!4$ <,0!$d.,0 00 0rS R0l008#8S hp 0-LM@0 S  0S 0S0S0SP 00 S 0 S |Bx00 K 0 (0 $0 0 PDPU <P , 000iTh -L$M şPpP5 d E0@00R0TH4P @ PU U ğ 000U000DS񟗽PPPPPPPPPPPPPP(@PPPP\HKLK`d 0D@ H @ <` 8` 4` 0` ,` zP5L R-0S  *LȐ R R H0S U 00S0S 1#$0$0 0 00Sh P 0H` yP Z00U @ NP a=P Z0 1`V@ 0I P P 0 ( "# xP P41 R 8  $00`%R U 0Sw0S s0 000l\`\@TL|hH<lF4DXpbDl p -LMP@00S p SpBT  0ϒ005Q^` ^ T0 U   VJH\|p о 8$0D\ p-LMHPH`@D-$ q0-  k L@phȪ Q-L`pX0L0CS00  ä0(mC  A -!A00CS00  ä0/ P@ WT% T# 0B00RPP@ P@ W T T JTs- 0B00RPP@pp xx Q-Lp@P`8 \5 0LW3D 0V C,<R 3000` \ 0 CR 000 \\PV 0> CR 000Rh10 R \(0R \ 0 S0 S 0-,@LP0S P@0 0-LBMQ0 0C @ST,,,,,,,,,,,,,,,,,,,hMM ,x^ 0S dq0 L ~ 4F/K< ȿп -0`PL@ p 00B S0B a0BSWBA0BS7BR@Plh|` `Q:0e0b``` -L@LM "005P 0;0뼱h -L M0 K@ 0R뀪 -L`,MDKHKP@  0D @ ,@ <` 8P 4 0` ``lPpmHP k`Pd   0ppWPYH0pN)V V@ *UL0T 0SQ 0@T:k`0U0U@@T P  0@ 8 DP < 0@ 4@ @@$p) HPV )V@*0S 0AT:kGkP` 0  @@pH0p8Z(0*S  r(@PXh -PL$M6 P- P$ P0 P0   @0@v+0 R0 R00x0 R"`0 R"LLL@ H,0D@R+|0k@-@T<0 1  0B0R \ p-LDMa0L@0  PRJ 0S ~ X KX@PT9 0S0N j0TS0@  b$H D*(AQ   *$0  B LR 00,K*00CS00  ä0 0S op d0R PDP0 R0080 R0"0P4<HP(X` 0-LM@0PS3 @K bD0TS  c@0PS  YLQH 0  x0D0 R " ,0 R " 000T0@ S)4hhhhhhhhhhhhhPhhhhhhX`hhhhhp<0S88>*,0(0$000lYx p-QLMP@" 0S S Ul0 R \0ph*0 @` *p0ph* "48<#h p-LM@ `P)T=  0K0ES0dttttlt|)00CS<DLT\) R| Rttph)lhd`\XTP(D@)(08DHPT 0-L\P@ "10Q0S aT0 R 0h)0 0h|)0hx)Q R R  00S "48<#800000SYX p-L,M` 0@@KR0 P !KT*00 R ^:006) 0S 6np` p-L$MPŸPb0 S @0x Rp 0S$xPr0 S mp"R 0tt!d` 㾻T 8PK0  0 80 40 00 ,0 (0 $0 0 S08 K70K o0 [R R/0[0S Q"[-K"48<#8 0 .K/0[0St,`偻dP0P 00|.jP ,mrXht|< 0-PLM @ @T T ,|Rt0d0 RK 4PP .6P@  QP@< -T0 ML\@4 <@P , ( p-<4(LM<Q"4 L0`,$,!$#\@!P0T0Q00SA1T`U (!P`V ,pU(UU $Ġ$ $< P$Ƞ$$< @|| P@ P$Ƞ $<X HP$<< (PP`<| -p2LKM@PHK ,@ `Upp 0@CT@#V@PK^I \`D PP@PK00PW @0S <0S80S40Sx V$l1ROK RH[  <P0,(!p[1 ,0S ,pl M0 S- ʀS S `V0 00S SpppS SpS Spppp<( -LM0@0CS8LLLLLLLLLLLLLLLDLLLLt|hh0 h!h#0@-d Q00XB.P@0L#"\ 00  P0S:00A0蜬| -L(M 0K"[["48<0#Q02K4 2[S2[S X Z4 0,,,!,@K P qZA <4(<"4(< p@{*4@8 <#8  p bPp p+[*[)@[(P['`[,0[p P@ P`Y00S W*00SW:2b\\Ȯ -0LS00S< 0S S hFh0 % -^𝔰1S00CS (08@0 `R$0SDHLPTX, p-PLMP@a@A 8刮00!S 0 倮0!S0 偮P0 p 0 p@0S ¸P 0S0Sx0 W R 0S l`P 4凸 @0 <0 pLl؉d  -pP0@P@TL`% 00000S 0T 0S0S\hTH 0S 8@,<P@`l |  00V̬@ 00N̬ 00F̬ - 0 Lҭ0 LMDd - 0 L­0 Lhd - 0 L岭0 Ld -PL0M $ 0 0p0 0pS`! K$K3P 0S@! K$K3P 0S$0 1傭$0P_5P0 $ Q 0S$00aSP 0 0QPPW 00S  $000S $0b $0$0QR  0v$0TpdLdp 4 -CML M% P` , \ EK@A@%f3P`4 55 T`4 |5 t5 d d垾`50S y R<5 t 050Sp `4k4Pj 50S0 0R r40000S 0S0BKAAS0 0r40000S R0t4000ӑ00S0BKLLH40S : 040S 4$4Q T30Sc0 0S30S S0@04P0@00` 3P@~d}43@\4XT30SD30S `43P 20S`4 `4 20S l 2@`4"2Q\20S@Xb0 v0Svh20Sr TR0@P0L3P0@00eENK@D, `4 0fPX4S`4MHTUH 0SE 10S< `43P6 p10S T10S <14!41Q ^@10S@p0 0S00S `0@0K3P0@00P 0SEK@\4XLd@0  ,0 Sh,+h Ld@<L@h 4pH0@ H@0 X- 0 @ 0^ 00X -AML0CMP00 , 04 4 0P004@@S`BK@ A@"1P 04SBK@ A@"1P 04S44 2Y4443PX2 4TpJ <20S2 0 R r20000S \!BK0LLS0  0 r1000 0S R01000ӑ00S044T d10S 44 44D10S 44 44V 44BKAAAV P44#"/K0 P 4463p 4SP44  RQ  0|@h0 Xa0 ,0S@,.g\Ldh 40 -LJ7@00CS00  ä0 0S t00S h@h0hP`0Xp01P@`p`p0$0L<H@(0L -ML M" P4 , 0 ʂK@ A@"0P 48 2V2 48K t2@ l2@@@#PP H;8 @лp R 2 k 20Sg KAA3P1 '[481PU 10S  BK@R@ r100000S0 R0t1000ӑ0 RBKA00AD10S t ,10S  Q10 S`0 pp0S00S @PpB1P0P0004 K0P@8㻻80@ ,0 Sd,'fLd@<Lh 4H0@0 Sᬩ -LMHCD\ <<3|8#0 ,僩 利30So$0S 2 pu`$2r20 \0Y2 RŸŸ"2I2x2`l2P`2@ L03<242@ 0 '2 21@{ 010S !1 10S !11`X1@T10 |p1pqHh \1AT1T \|00<ը0S(ب0@T Q ƨ0@TP0 <L@.,@<d|0|M p4$4Lhtp P<4P \<L,8Xd p-PLM@P`0S00P xP00 \P L0 D^pV 0 Rp鬩L -0L 0d - 0L0 0 d, -0L 0d 0-PLM@ !0S000.P 1 VP QP0 K1 5\0 0  |0 0T0 HPH@DX ާ0S40 8ק0ݧ L<d4T -0L ? 0Ld -0L 3 0\Ld -0L ' 0t\d -0L  0d 0-PLM@P\1 T劧 NP@!0S000!P ~P  ~P0 T嗅0P @,㧱0@0 @0S 00S 0Sh0W00`0@0 P\04@;0 00 0L|0|d -0L 0 d -0L 0 4d 0-PLM@(1 %M~P1  # E~P K1 +\ 0 0 00 0S000hPt 0@S00000.,0 D0Ʀ0( S0000L(Pdl -PL M   KK,P 0S0 0埦0 0P|@0}S t00S\0h0\P H0R@0 P,0  Ld&D -MLMp0P 0 00P0P 0 Y`7.P0 Pq ANK @D@DP X0 \9P^ 80 V^] 0S( bhLd(4 -PLMd   KKW,P 0@S 8080 (0 0>8L@d -PL M0 , ,K0K0!2,P 00  11 00 1 0 Է4 i$ R0  0S 00;-0S 0S0@0S 0P0'-P0P000 1,P0`@4㠷@Ld@<L8H0X -PLM   KK+P 0| SKK+P 0\S T0T0 tD0 00S$0 `ltL|d -P0LM0P01@0P1 J夯p 0\``P -P0 PጯP 00|S  -P ,Pp0  X0,0P=\U h8\(Ld -PL$M0 , ,K0K!7+P ,0S ,K0K!.+P00 1, 001 4  4@ 3P 400|S 4K,P 4\<,PP1 00@ <1 41 嵶< $J1p0S. ,00CW*Ww0a050K00`!50K4b0pS0@0S 0P000,P0P00h00S ,00CW<{4@0 P,0 [L(d@<LH0 -ML Mq0$0 X`TPP@P@@,TFC|PP 0S`Q/P@Lq@BnK-0 K@`F4!0r 凮P+0 K0 10S A' X00  00  `000SP0S0q0#00p`11`CP 0S 10SX1P1 1h10S ,A0 0 0 4 04 h 010U PUC5S 4Z3,0 SX, XTLdD x<,Xl -0LM2 L?@0P,0 B tQ  xA "  yB$ϟP PB B F  rPp  rP@p  rP"Pp"wU`/ュP` 0STlPV 0STH2Sp1 p p1S p10ST B0T00* Cyt t1S t yrPt1p t qrPt1pW 0St /F3P 0S00bU ᡯx x1s  xKp=n/K=00p3P<0|1  p,僯| |1S|0 1 YP㼬<P@8= 0! pǏ $ QP E=b  |!p` P 10`S1  <0S, <0S(,0S!0S:|<# 0C\0\00;$0 pÏR0S*<lx*1P (;0S3 ;0S/˟P*0S':0/P0S*p;#0 CR 0R000; 00CS00ä0;,ATH x#:0S: %B 0[S ]P 0:SSPp :P0@090S L:p 0`[_K  xt9T0}Kh1 0d1 \9  0Xp890X L@K $)P0( 0XP  ~LQ0Ux1 G SOK <垶P,90S 9 xx x1s`ȟ $ x 嘿P 0S x1@o  0@x1  L@K0@hPPU'ox1S Ux婧 H  0S8"ftQU 0S7d"\XǟX'0 80<'  :㈣P rwP@   %}PP &0gP &0X 劣P0& 6& 60S6  Q p\ ~/K P  !R B00S S S R B0! 0!R0 0S S S 50S 6" 'P` ` 㵔P  㯔P 5  R  hŭ` 㞔PLO\5 ~/K\P  !R[ 00S S S  B0! 0!R0M 0S S S 1SF <40S4" pP":N0`0K  v1Sd4 i2S 0 oP<4B0 `S,4 q RU ĥx1sxDtOO" Sp嶢P20|1  p"| |1Sp`,01 ٩P 1S( 9$(52P@3 0! pǏ!ZO OP0 1 K": " b0@PP | Up` P PU10S, 10S(H"0S!0S:42# 0C\0\00f810 pÏR0S*1ڴ1S00S} 00SyxPt0Sq00/P\0SY*<1#0 CR 0RM00J 0T|(a< \8` 8DggTXht @D`ta,DLXp|,0 00CS00ä0X0U1S- p0s 1S 0S 0R 00S 0;00S03#PR  Hp(D0 \ jx1sx:Nt8N6Nx!,0 S,pS -LM$@#吨L -LM$@#~L -ML M60H ,0 0L P$ D4 _P@ 60S'D4㸨 㵨x僴PX  0SX TyP\  0 S \$ D4H`D SpD4L$:נPi D4LT t P `   mP   mP5\P$   mP @gX$R P$ p/+@/ᢠ:Pហ@pᚠPW3 W1*P0#03U0S* TD @@ᇠ`@ ႠPVV*4 T4S 0S Y 0SD4L$ttT.T +T :^/`ZVP P`3V U  R0305`1:` :EPT 0S U ppU 0S /PpP30S t3tT$ 0PP 30SD@3 0V@4 10S 1U! 0nV BNK@D@D0!嶷x1 @4 < 8  \ACKX1APA@4 PP4CKSAA4$ 84 1!0?2cS D40`4 hLD4`$0RD4 D4HSD0`$0Sr` ,0 S,Q,<̽  L }L pqD.t0dQ P-L`7 KP@u 0pSP' +Q 00 %Q r00000D0S  r\00000D0S PP0pS@00gxp000000S00@ p0 00000S70@W0@ 20rP000000S00@r$000000S70@W0@ -LMl @k0SX  k0S<  k0S$ 0P 0  -LMP0  w( -PL 0 V  -P- L0  ,0 -$LYM0@,0 4p@` [K寶 ᫶p4Kl  0h d `A SpP4"0L@KiP dP $LK 0ZP#LK P0IL0[S LK 0RPU u  ᦦ 3 p1Q,,d\pAP#P3T N p10S S_K <奰P,2 峓P`آ* ᤹PP0S U 0S S_K <zP`,ҝT Pc<P`@TV  1 p %icQ ذ0pt1 @i]/KpA EP J0S x ^?K 嵳Pz ሡxA00pႡ0dQS PP H10S 08 04PPㅠP | _?K,倳P00SA p0\0 0 ,0S,yO,8` d@LDg8gg  ( -LMd@ 0 0CS00ä0Rӯ((0 0 S gL(, --p1pq0LS00`& TAT庒H P8 4 wP娒 +00CS00  ä0 呯P@T=0  !| @*偒y0 |͜P0PST^(L08@LT `drx -LAM M8B>K0C0C0 +, ɴ %@$ 7 p< 8 4 BK J4`J U'0@S񟗾uuK 0C c R+#$y8Q 00 S Y44044 1V 0  < 0 YR# 00S <$`0RR0F<,0 S x,vM< 0 rd L@ x( -LM00 (@(0 ٭t(L< -JML M0͟@,͟KK`$͟VSp=͟N_N=,p 0P@004 <P@0< 0 $ 4  Q 0-S<$TU< <@T $d t< p<RY`<` D D D D 4 P`# <<0S $$<0SLPJ004Sb4S ]4SX;Q04 L04 娚PL; 4 R`T0|S 7$0@D4 M 4S$ V& *0S:`4 2zj 4S  ? d:IK4 4AA(P4: S 0:$pLHE>K0C 0C)00P 4S ۡ4 S9T 9Pz hPpI 0SG &P !P=D9`0S 0CS0Wj` 4@90gpq `v  4S8P@80<HP 4TSd8P- 84 $R P& ur4DS7@$P da4TS7P Y4S 4  4S  Fd7 0S k0CSh\ppS7/4 yPp``@VH70S> 60S 60S6&4S.ʸ4S 4S'4x6# 0C\0\00K.K 6 B B Ɵ0O4Sʸ4S 4S5BNK4@D@D+%P`60S7 50S |50S/hşP*0S'450/P0S*,5#0 CR 0R0004 00CS00ä0%4奫VW0 S|4 VOh4#0 CR 0R00(4K.K3 B B0Od40S 30S 30S #4Sʸ4S4 S440@3 0 CR 0R00<3P@ 0 CR 0R0 S 0`02P@ "p` 30S2 20S 20S*x"4Sʸ4S4 S4P2#0 CR 0R00y2 00CS00ä0n140@ 40@ 0 S1 +4$St1 4#wŸ㿟4S2  㹟.㵟㲟4DS0@ 10S$1 "@P~004SG4 S0  4S4T 0S0S ,0 S,I<$D,\L(@x$z(| 4d0LX8 X` -LM00 (@(0 OG(L<l  -LMϟ@`0 _X0K, 0` 4` <` 0>Ο0Οp0 >Ο0p0 P` tPH H0S > 0RS ,0S X,00-S X>, PQ<>@ 4>0S H0S , .0 80 R@0  D0 H0 S  L mP! =0S =0SNP00@0S@<0S<(= p (=p.H㮞@0@0 婞< X,PS ,00|SO ,ķP@/,n@0S 0 S , @ㅞ<ゞ< T00,0Tx  T,l 㝷T/0p0WL<0S 0 S,P<0S z0 S ;0S ,o , ,0S HQ;0S  ; ;RN<;PH ɝPH0S X 0S D fP 0S  $ ] YP@ 4 40S pW%,hP:00 h:p) ,00|S D ,0 00S,x  *0S:`: ,Bf0 00S@:, N80 00KP0S;0 Y0 SIBBP0`0 `.0: S )0S009 H9@T 0DS0 0S 000WQppY90  p@0 S pWPdUQLȟ80OP< 80S 80S4(T0S,T0S X0S%X07# 0C\0\00|7XK |ǟ0OT0ST0S X0ST7?4077 !P`PpÙʈ70S7 60S 60S/ƟP*0S'60/P0S*6#0 CR 0R00`6 00CS00ä0w46V 0 S5 W W,`V 0S 0 fPPU 0p P@0S@0 fP,80pS,5p05 080 VP00P0  V[5#0 CR 0R004囧4XK 0O 50S l40S p40S X$T0ST0SX0 SX0$ğ@04 l P`L0S 000@20 0 CR 0R00V v V 00 CR 0R0 S 0`0<3P@ 42p`P0S CP *|0d30S2 20S 20S*"T0ST0SX0 SX02#0 CR 0R00~P2 00CS00ä0s$2400@ 0 Sp1 000@ ,/80 S1p 1p080@Ǜ<ěD0SD 4m@ RH0S R0S10S 8 d1Rp ~00 0,K0 `p{K"s: 0$, 厉D0S`0d0D ~{l00S70 @ q<n<\$D4,L(@t xL(dH40L8 ([ ($dDP4 0@P@@80S 00S08040S4l 0S0SJ@< -LM0 S 01 `0, 1 a 0 S00SS  |0S$ `͟lP .HP < >¹00= =0 >K 5P 0S S0 L<0S$ L0S la < X}P(:$:a?B1cSQ8 PUQ  U@ 'jKiKKgK qK mKo/K=KnOK@ PW1S_1S\1SY 8 r!1 (,10$10 < ȟ4<K^ 4"<  0jKiKKgK fKeKKcKbK aK$K(_K,^K0]K4K8[KK ğpL0DS  p㡷 P1S00 0Sd >KP@0S S >K  P >K ) PLC P030 >K ئPxXC0r/K1 MP@S㉨PQ ZOK3(`K0S S 220S3 20S/H3(KKoK\0P1 \ S_K <@@PP 0iP R `2 0S82  <2D& QA Q^ ^ 8 0@X@B)0@0 0  $         $ ( , 04<8@@D  ! 1S0s`0a 0 \^$1  0S >K  P X@匶0P00  ,0 S,BT $g,dgfffL@T|$}~0gL@\g -0L,MP؀0p0U$0 D @KD K `ڨ@T{-00'?[\H0K @H 垥P<cq $0S $A$$, -LM@4 0S@0SA3@D -L 000( -|@0Lp0T\" 0S0LbLr0 0S 0b(r@(2(R  Q ,&BΆDQAφA@E0<1 <10@! @10D!D1t00lH1 H1`0L! L1P0P! P1@0T! T10X! X10\!\10 ێ ׎ Ҏ ͎0+11b0Ďb+ +⻎+嶎 j0S00 (P@(<@ xp4 hP<4P -LM`@00CS00  ä0 >, 0$0000ЕL(< -DL$M0D ,0 H 00 @ zP4@ 3#3Q040 3@T 30S 30S@@S0S;P 3t30S \3dT3 0S44P(nPP7Еc0@H ,0 P@ ,Õ00000 4D P`B000^Z,㥕82`D H0P堃㘕4"0@0P 20S @P10S {Q0S 0@T4D PK Q0S1Pb0S0@T 4TD P T0S. +0A0S1PC0S 00<K0  <0 K>Pe00S0  ?00S" 0,0S@0  4tpL8<pdd8,@x' 0-h0LM0 0PK!K0  @T0(0 T0d -/L`PPU1 1UU/0p0W 0˂@+.0PW0PdZ 9X0l000ͭPp 0X0U.S100E 00EPEW dHL -LBMAq0 S P 610S1  RAnK `F`F0X!P0 0cP0, ab10U B>K 0C0$  0 K(4 0BK @@ GPʰn00S0  HU 0K0 +PP@00S 0S8 > d' -BMLM07,',70 $'$7$ H , ̟'P  0 S606+ 6PP6@P6vP6fP6І@6@@PP6 6@6@堟P@ 0S )PP t"P \PP HPPP4g060 P5  t&P 0S50U0S 50@TI@]PP@ 0S P P ۋPP|ESt5P 5  `5X HP U P e40NBS񟗕,x4xxxxxxxxxx@xxxxxxxxxxxxxxxxxxhxxxxxxxxxxXxx`|xxxxxܹxxTx`  4K#00#0H3=0 0 0 =l343 5,3 <3033 SP#h3% '2 2\3 2L30 rH300000S 3V 3 3  l2 0"Hp]2202 2l0 2H H P ZȶտP BNK@D@D+T2@ D咒04SBH4 P 10H P4P@ 1v sH@1 0@$ D4 < 8 4D 0CKdAA A0QS R  1h1 ay0S 1 (P@@T B ?@l< 4|\x,|UHf}0.PrT\d|HL8`|>(,h@tLxh,̽< -L 嗑, p-LM P0` 0S @0S a700@PW岰00000S T@0S E00$0 $ 00`p< $ p-PLM 200CS00  ä0 10S A喜AQ WP ᲌P^ @0 SP00U1P`1t0X!0CS00Ӥ0# PB p?0a0S Q00Np@ P 0S 00S0T0  00S 0S d00 CR 0R00 \0R T L phLHD|Xx<,(̽Pp@-& @`QP 0R0S  0R 0S 0`S`PQ^pppܬ p-d d0LM\` X0X PPP0@T000pDx8dX$p@-AaP0$S!S0S S001  00 h!h1!Qp0 S S8  S0S00 S0000 S S S "S \S0S 0 0S "S P00P p4 0S00 S000p8$Pdl| -PLMp(M1@ 1QQ! a1~0p2V*Q 0S 0S H0`2V:6 iYP@U@p`0` l P \<~0< }PEU@L0 G8ܬh -,0ML  0}/}, -MLM , % 5 嘛P@ " 0S  P:?} |oB^KPEPE0d%T XP5P0S4<RNK@D@D\SP,KR5( K·.χP褟 P P  QC Pd TP TTP .㰇P@ TP  `TP00c0S .㛇P@ TP@i  TP0S0@S񟗻LP %Pf[5"啇P P t匇P L3YK0AAGP5?P %0SB[52YK0AA/P5?P{ 0Sw*[r20S} P Plpp00 P  RqXr0So Lb11@P@U pP ` 2000 pX 0 P0 1pO PpK 0S1 0 0D!!00!!00 00da11 @`QT $1p+ 0 S0TS 00@T1T?GP PP6@P20Љ0w| <0徉0 ,0St,8u .@@,LL| p-LM a00` 3p 0@ PS,P ppP"P@@\P0 p "P\P0 p P P P,P00Ppp8@0S WP 0S p< -LM 2@TP 00002Pb 0-0 L0C@R P3PJ 0 Q000 P0-L@ 0S Q 0PU*020PU:20h20 -L MS( 0$ S 33 P$K(K"$ 0BS (0 2{2 B0S22R(00S(0 2P 0Sp另,P 0S (0PP@20S 202 O{@ @厅2 @刅2 @傅1 @|1 u1P0S1@1P(0 z1d0S0`0XPV  OP@pl HP@ 0T.S@DpP0@4!zTp,, vP 10S11  V  `0 z R00 V   vP0z `<Lt@̧d|l0(M88H|T@$ 0 L@pt`l -LM,Qp" ,   /K?KKP2  2S 2S&20S" *NK"__K,ŪP 뢹Px202 -P2X"廜L2WB 2  @22 2S&P`y놹P`V   0Lz1Hz|@KP!O|PKRiP@|0[S@TB rP@2S卯 |fP@ 2SX倯 PY@TXQ $OP ¿W00S&p0P  ?0 0A` 0@P0 PCP@P 0T,0 St,I6d`!L|p@DxX< -`LMpPۆ0@T0y0 y 00@dP QP @T0P S00@@0 800P00D L(|Xx -AML83M4ß@0T,0 p0 3 0S 3@ SP @0S 0S 00@T@0SP@ 0SBi00SP/S  0 S R?VyDiBnK`F`F+l00S/S/00P+ebP?P1X0Q  \ 00 1P0S 00pSh1h!0?2cS XL100$R 1PBNK0@D@D1S00q0SX000x |P "QP@@ P0@0x0 ,0Sh,5< |X`0Td @(tdQ  L -MLMpp0 S( P`L Tq0SHHA0 @txuBK@@$!PP9 1$K R01000ӑa0CS'0t0Ex 0 \05x;x(0 S4(4(L|0T 0-0L0M0@PKS@,  0 J0S\@0S嵽ֱ 00#VPz ʱ 0 H -LMp0 SԀ0@0P`P P (KiV(0`P R rp000000S`P T 0S8@,w ㆽ\ L -LTMa0qS!0PPPA[ 0r10000S@ Pr1000PU@p LsP \1\}w000 00200`KdKhK\0KX K T@KlK , l0X T0 h0\P0 d0v.BL0 `0A BH0 0D @ 40 :epP X0S 0h 1 P@@PR50S1:P~P@ ~K Ol0 @KIl k5i 1@o0ef2f2c BDLP I0Ϡ#PE0l 2lADd`0 @c@K70 S00J<@,0 Sh,n0.A>P?,D.$,0ųL -LM0`V *00`YV@: H1 zPUP@b`VA0S,0 :p0AT0s 0S :000CS00  ä0#  ǀ P@| 0 @0 C\0\00 T,0p0S,0 `VL -L MD00 K4@剄p( P0 1[SP00~@Lht@ -0L M@K 0 K  ޓ -@4L|>LjpLp\p0g -L0+ る", -LM`POP( @(K,pK 0  (0@S( -L M0@p00 0Sf PP 0S nSW ={P0`0@Q HP QIQG  0V0P . 0' Y0  0000V 0`0 ,K)M, ?R0S@p @10"Sl 07Y000 LPH00D 0oSP  :gggggQ-0N. S$PP 0B00RQ  Q 0B00R -MLM0$0 sl`2^KPE+Cp@0S T0T0S0 0CS񟗉d4r0 %S@{Py0Si Pc 0K @88 `^KPE( PZ0H0@T (P@TTC0H0NK@D(P$0 05R,)P'00S# 0V 0 05R01Sh0 05R XO D00H0Q@ # )! $0S$$Z,,(88px -5LM@P  WOYO'P#4 4 4 t4 x4l4 F\$pc@D40@cTQ9\j$dP @aH0H0S 0H@V 0H0 6S  yPs0S00#᳆p Z3  CXPx=k d3 0000C<0PP<H P Bo0H0 &30SAoU 500H0 &20X ڜ+oUaU =0SL. B LoH <2p4() ,ڬPPWӬPP  ,K p (,Z,ʟ(1" 圃p@ D0H 00L 0 }|> (4  4, (4@T\|(0x,$d$m@ -,0LM$@ Wn]n},   p-LMH P0S 000` ph`H@堍,H0LH0000 H04 H 0 &080H0<`ph$  -LMH0@H XD0,0H00H 00(0 H04 H0 &080h$  -PLH0`@T Vp,<l  0S`0 $W@H 0V0H 00h1HS@`H 0 = 00H0 00}=0H0  00'<0 0H 00h|00H 00 H04 HD0 &080H D0,0h]HT $ 0-LM(PH0 ,0@S 0R⻆PzH00SS S Sq$0L+P 0hH0 xH0@Pl100 H0 0S10H0 0;S<00H0@2S0?00 H0@ 2S  0/"/0B1 0H0 000H0 0S10H0 000H0 0S10H0 00 0H0  0S1 00h0\l   -LMH0@<0 ,H0HP  P !1P0,'H0Q 0SH0H0QH0P H0 H00H0 0H00 0 H0 H0 0@ cH 00h xd   0-H0LPH D0,0H00AT 00߉H0@80H 040H$0 &080H 000h7$  -LM0p0S"(0H0 &|0PU  `$@0@ P 00+$hPUhF0 -LM0pS S S 鬀嬠ꨀ娠꤀夠(0H0 &0PU  `$@0@P 00 @ m~PU 0 -LM(`PH"2PppQ, 0R 0RP@$0 4GH 6;0S &0;0100 S+h10SH0@T 0S PhB@TfP@lh1S00000H0L<0,08KH,1 &P 40PP^p _  ẄPH000H0@H00S 000SP00H 0S@  0S 0S@h0 0bSpWhI@ 8hd0<H`ltT  -L"PP!婍1`0 pR "P@8R 40 y0 804 0 P@H Z0 0d1S 100,0S A!P@$# @ ,N$ 0@0$ P@$4$"$@1S 100l0S !P@( \ D< l( 004|, 0-LM(@H0 ,0PS/0 S (P $H00SS S S$qXH0P0S0hH 00(H 000hN0Td -LMHD @24 0bXP@m0S 20S H <0S0@<0H<0S 6!@0 <0H0<H0<jPTH@ 80S 6!0 H0 8ḉ80080H`Tq 68 0RڣOH0  6@禉@8@80S 6!080H0 &804 0 S0l080X8#8#$H@0$ ࣸ$H0`$p#及 !4H88<#8hcH\0%0@@8H0804 m  4 p-LMH0@P>H 0S 0SDH0a 0S6 0 (H00,H0gH0QbPH0  S00H0 0XbH0 0@X000<H Q0 0H0 H 0S 0S R0 0H 00H 00 0H00S UPS|H0QT{H 00H0P & 0D00 ph xd 0Lp$ -L M00PH$c(0 04 SSpb  6#0WH 00840S<0S 0,Q Z5PH0 , < H@0S 0 0RpGH0dH0QPD:H0Q,H 00u80S 6"0 5H0 8]80080H`! 680QڣO$H0 8M@@8@H0S d1 80 0S0`0808K /H0SS 1 0R0040 070K080KC<3K0S0``0S3 W08#8#$0$$43[4#DHL$H 0H0%@H 40880 8 (0S8($ x p-L MX`0P#DHL$H 0,H$0%0@@p4 -L~KM pGMpG`P@+@K娊H!@⣊H0Kt6 xF 6U 0e O 0 v>  0eO 0 v>  0`eTei鿂,$`tL0X p- LM0Qq`P$0  r$ 0 0 r$0000  K@ $K $ Rr(K0 (0 (  0p0 -p`0LH@d0&PR6W0Sx6 pC6 6T0Sx &00 << U $(  h(._LT -ML M P, ß  < 0BS8@<K⅂<0@pK@0 @G 00T`K0`T0 S" D 1 S@KHK0hPK0{h0 S X ( R $ R pzl` Pg '@H &PR 40S0@P 18SK***,+8@4DH0 &0@冡< 40!1ZsNK@D0 @D4 H08 6 64 1d1Z`P1\!sNK@D @D8'H04 &0!0 04 R8@Z ZK'P  0S '7` 0V' P7 {NK@D @D0h ᥆  T,0 S@, (@L ,` @H -LM( 0R@40 ,0 00  Rq, $P Mq0 X Hq4 , K 04 (pK0!=0 ( $0  `40`V0 Z_0  _P t p,K l(, h0K d$0 `4K \4 X`4 S84 O`V@Z0a840 -LM_0 @ 0$0 @ tp$`KP /E0 0 $0 k$4Q 0( S (K_(80d| -LMt_0p 0H0 &f@ p $@ BPP(p  (K>P00P@@TP @(@ $K ڏ ([(8$ -1L M0H`p6p0@S 6  _P610=S 6p1S&P h0AW2PP@ZFFLFV6 1 VHp@ Ep0@Ap@@61S2 @0@$S `S(+p0T` : $p@ !p0@p6@@ 0 <($L 0-T0P0LH@60S 6&016P1S060(-00S ^0 0-S_0 000S0 0 p-0LM0 S@PTl`d0P@wpT 0s YVSj00pLT -LM⁁@P4 8 0a 4 8`@UL87L87777777778L8L887L8L8L8L8L8L8L8L8L8L8L87L8L8L8L8L8L8L8L8L8L8L8877L877L8L87L8L8L8L8L87L8L8L8L8L8L8L8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8L8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8T8L8^@Th00pW 0< 084p000\  -LMP@T. p, .T`% .V00.R0SV t0000PtX0000P-T_T _TW$opV @ 0-LM@P@ .R r0\00000S0S0 S0 S K6PP 0 -PLMpQi@0T1* Rr000000S  0RQ 0 P`F0'S"S $S `S \S`F\000`F0@0T:V000Li(8U p-L M`PFp P 10p 0@ۂ<96MK PK0  ` 1Kdp@~0DST 0 7p@d(LX -1L M0!H0 Fy <00  0< P1<  0041   001 1K/ P!1`P ̌0\000p``| 000 000 h0[:P@ ,PK 0s ? DmD0P(P$  (` -LMp@ d+:P@ K r 40R ,m  d -LMb0PH0 pK F  @@%P񟗊\@LALALALALALALALA$ALALA?p@@@@@AALALALALALA?D@LA0A@@@?@$@@ALA@EAp!0:pa !081p!0*p!0N  <"K,ˁ Qt08  ;P ($ -LM@$`Kp A?@0CSP ABAQ 0($UP# :R :P $p l0Ph  $k RPD$.|   -LMPp`$K 0P P ڼ0p  PP@ 0$5P @T T @` V ~ ,P ;P @w p,($n @LXp 0-LM@PK\ 0P 0hPN {P `I B0PD 0p r }R 6 0( -2LM@0 pK`$0 # {P  PPD !㤀00 0 0 9 0s$ KK }S ^ $0SOVHP @pT 0 S  9wPW$0 H0  3@TV$  H0 00H0 PH0P 0 S  0R wP$0H0 L $0H0 0 $0H 0 0$0H0P(4   -LMP `K@p  @@PU,HH|HHHHHHH!9pPdH T0 4 -2LM@pT @pTP` @TP 1 0R 00 !00@0c|!S0"c1QP@T Q  D1RT0S000000@T^ ᛀp 0#S 0SoVjV@T P0  0Q0  d0RT0SL00S@PT,0 <D 0 T4 -AMLMPzK @(pGK0C 0C1 BS 1S @T0 ,0S,=P0-H0@0 80840400,0 T`:LXP -0 0CS00LӤ0Ta ^00# P 0 000t0 00p PPQ8 00C 0000:XL p-LM@T1PL1`P p001 0000S#Q"Q0P0`pQ q0 00000S-Q0P0`pQqt0 00000S T0PL0`p408 P,0`(0 00p\H8 0-PL0@S| p0 h0R`0 X0 T00040 ,0 T(0 000\LPH -LM℠0SxpxxPx`0 0 Z@^L0 D0 @Y(000H\XP -LM@p P p-LM@`Ppp UP\PP "P H0D0@T80T0s@D0   0p 8 -pL`P@xP000PP px0000D0SCX0 L0@T<0T49@D0  0d -pLPBo@P -P_P p0 00000S 0 pt0 000D\0Q`T0@TH0T@@D0  , 0h  l7) -LM$@" 0cPu< --LM @0| Mxp :10S \^T H <*10S ,,Q$n8p , --Ll i0T TMLD 1D080S ^$ И ̘8 --Ll C0T T}MLD 0D080S ^$ 㪘 㦘8 --Ll 0T TWMLD 0D080S l^$ ㄘ 〘8 -L`@PH pR %R0mSEQ0L osp` PD"@`PT@D ń R00鸅 --L@ 0C<0 ;/P@XG4P@`<?T!0@@0 (/P@4! P@-T!0D0 P@"T!0H0 :P@P@T!0L0 :P@ hP@ L;TT!`0P0 0` 4` ;P@ <@E0L!!!?!C!c,B^ B^DHL@PP 010000012c12c1 C @00012c12c1 C @<\ltH 0-LPleP@4 0S0 P0d p-RLMP@` 0S(0 h000pt p-LM`@ 0 cᩒPPh u 0 0bU *H{p0#S l0S uo wpht -Lp`P P@HY tT<U;t I0S E0#S hH -MLM$0KA ,0 `hQR Q Q d8 S)KAA ld8 S:qXlPP dPP0 l(KA Al K+B 0d(0Rp8:spP@ dP@ p(O>K0C0C`#8 =md8! SD5;<#iKA Act(d8!M@S:rtP gdP t( JKA Exd(0@R:q|xP IdPT x( ,KA A&|(d8@S:r|Pp +dPpz |(PゎKd8H@ HS( l;KA A01(81(Rd8@ST:rVc0P1(M (PUڈ< 8 I GEP(1S>K0C=PU!d8PS*g 0 ( hX d8 [P@t KA kKA A e{4 0 ,0S ,R4d4X 1 P-L`( 1ȁ 0@Qd 01 00c$PVq` Qxh!0 PTP Q@ 0O  Q0 Q@L00P 0@0CS0@0 0xQ 00CS0p@0 0bQ< 0Rh|hDP -LMPAPpC 0@ S 0 S`ev 0S쀟쐟0 !cPP 'Qi U`0$0O` $P@00Q(Q C | 0-DP@L,000 @@0 0 0 0t d0 S- L 0S S 0SP S  h p-xQxALM00P06T1 P!Q[U -LMHH P@000 00@@T|hp@-@@`@Q 0PA0UPEp(\ X X0-0PPL0000000000@g@T0tp 0-T@TP0 SL@R00 00000 tp 0-`@ 0PSLLH  0S0, Pç000w 00tp 0-lP@0 SLXT  0DS \P00U 00tp p-L M|P0x0 |@0$`KS 0S @p i0 0 $0 $ P-L he?EG0@6PZ ,<L\l|ĢԢĢԢQQQQQQ Q Q  Q  Q  Q Q QQ -LM `0RP  㰍0XSxS00@PGK GKk0p1h@  T00R00ST01@T@FK!1 020@T0 90R0BSbS0@PGK GK40p1@  T00R00S?T01@?T@0! P @T0H -x0LM0Sd@ 0 R<0<0^P he` Q-L@Pp`  aac@@0 0#0@T` 0P@ 0h_td@0 0#0@T` 0P@ /c l -LMp 0( PP`30K c 0P$@0 0#0@T@ bᐌp@ (0 S \(`VDT8PP,Kxl -LMQ0@ T< T: JP1 0S0@0`0PVppP`@ 0 \0 p0S00 S 0PVPBc -PL M@0 P2kOPR1P@ "댂PvZdBP0S P & P 0 RP0 P BXP, 1 0R S0`00\Hd \Z \L ,KPP= q, Qᐑ %bPtal0 Q@L00P 0@0CS0(A0,/0L00CS0@000NPUlxP0<NPc ,P,KRPPX85t |DP -Q00SLp0 q00`Ԡ0L00P 0@0CS0@0 w0Lda00CS0D@0`0DPPA- @0^p`P 1S \0 A\ ^@p P01 0 0CR  @-tt@ R `0!R 00S01S 0P 00 -P0 @ | |`@@t0t @L@0\p0CS@00h#0DP -0L!SPp+ EP@! /P`0!S PP t0 l0PhhcC`0 gZKLQK,h L`.,t 0H -L M@xp"Phh"0 `TS, @2@"0 p(2@ P`<B2  P PWP 00CS0A0T0 Pp00CS0`A0|80X00 S 0 ,0RS 00S Y 000 \ 0S 0 0)R00SX`00PY0H H, S00 (0 00cw<t DP,h| -LM`0S00CS00@Ӥ0t TG "PUʜŸ0  @2 ꀂtŸ0 Up|00P <2 Bp42R ,r0 0JJ00CS0A001 Q( Tx0 @ 0@Z P1 0 0T1  00(! 00S $1 RZ J  JKp0 QP\00TP 0 BP0R P0 ~:0IX$00CS00`Y O@R#<DP -LMP!\@`- P@#  /Pp0!S OP t0tp0P dAV0fID)I$ ⧶L.`, -L@p`0PS;T00T00S 0S00c`^ 0 T 0 0 `P @00T00SP,0 R 0 Rm< -PBuL`@ Xp0S PPEuI]< -L MS , 0 0 S@`T,x3@AP , 00L3TDդ X^00 @D S 00B @DPPx 00 S R"pWЂ W`l000"Pp 0"0C`"S0b0_Z ^UAfP 00 @G S 00B  Q 00, pQ Q@L000P 0!0C@!S0A0 0sHX00CS08A000UH00CS0p夐0 T`l00P 0l0CS`0E``0? <0(H,j00CS0DP -$LM` ,` 00CS00@Ӥ0xtV 聟 0R,0 !0@1   T`0 00 00qp0 RP\007P 0<0CSP04Q0 b0G00CS0@0K0 @,0` Vp0 ,` Vdl 0P00\GX08`0 0  HM@|x DP -PL`@pPEuȂ `V 2p W\0P0 @^R00S$ 0t CR 00PEu@0@0CS00  ä0 Ȇ0R P0\ CR ^00 pQ=0"#CQ0!-000 80 B1R0 \00 0 B0R0 ,00p0R P僆0R P{0Q Ps긠 +IP  0 jC0Q| 000Q P0RUH ,0Xp_0 Cf0pIl H'и -L|M, 0 |\50 KP@00  0RrS5E,%0p sP5   pP5   NxPL4d5\0 !0 ,00a,0 , R 00 -Q ,0 S5 00000 ,  B, A[TP@ 8[PTPQPNPOPP 4 6Xt`U<4P P@PLd0S 4 Rc (4 PP WPP 3 4PPu5 0u C0 W0S3 3P3>0S l3 d3P`4X3=0D#S4,#=ubB0 W0S2 2PR0 W0S 2 x2Ptl2= E0P`00@iL2 0R Sy 84"P0`00[ B=Z[0ST !=O!00,Q 00 Q,0S< h1 xlW00 Q 01 R.c+p009P 00P 00 !Q 00 G0 RMOKoqP0: S  0Y 00G00 <6=nul Hh L|><T  h,@t x .иi |X8\D ` -p@ `P0L0 %P00 00 ,S;S;S 0S0S0 0S 00pt  -LMtD`ğ0 q00  R 0  R3 P 0EUS<<dddddddddd0<000 q00  R 0  R10q10  00S u1  00S^U-U`F`u <pP ^U-U```\kP 0  P`P 0.U001``P  pP`P  0 ;U0 0 0  `0S Vl0 RP /UP` 0U00t  -`OLMp0 q00  R 0  R?0P E0pRphH$$\ X$͟ 0nS` lS0 P 0 R0= R =y P W`0pS`0= = P@=  P<= R8ʚPp̟0 0nS` #lS0 P 0 R0W0L ]< R 刯L⃯ `0pS`0X ˟ 0nS` lS0 P 0 R0;T R;;{ `0pS`0; Ro0q:0  00S` PpʟX 0nS` KlS0E P 0 R09: P1e*P+P&\!\\: R \t P Md:)9@ {  yD k`0pS`0 ] Y9 R ɟ, 0nS` lS0 P 0 R0 (00cS0 (0S 9 .`0pS`0"8 R0ȟ* 0nS` lS0 P 0 R0 (0S070S700L`0pS`0 XIPTǟ1 0nS` $lS0 P 0 R0d7 R 7`'A PPaT`0pS`0(W PdƟ7 0nS` *lS0$ P 0 R0t6 R 6p& P T&00SPALy`0pS`05 R 5 R5 RH0q(50  00S9 Pp3 0!Sğ* 0nS` lS0 P 0 R0 0S E 1C*`0pS`0p4 Rß 0nS` lS0 P 0 R0 D`0pS`0s0STß+ 0nS` lS0 P 0 R0 d3 R @Pgl`0pS`083PtŸ/ 0nS` "lS0 P 0 R02 R 2"P. P+M|`0pS`0r0 PR0& 0nS` lS0 P 0 R0T^ PS`0pS`0@G1P* 0nS` lS0 P 0 R0 1  P``0pS`0l||]@иi,h |>\  DdtpP0 xL d (t\L  <  \t 0?PR$dPPI\0 RA pW0 RX W, 0nS` lS0 P 0 R0 41 R PBd(`0pS`0|1P( 0nS` lS0 P 0 R0 1$" ; P@_`0pS`0H2Pp( 0nS` lS0 P 0 R0 2"  P ,`0pS`0,3 R4$ 0nS lS00P 0 R0 3 R 3 RqU ``pS0q40  00S[ 4 RD4D$Pp8L 0nS` ?lS09 P 0 R0-4 R' D0S!\  @\0S 5\PH 05 P C 05 @<^@`0pS`0U 0gS S 00C S =pP 4 6 p W 0 Rd6 R d6   0 S 0 S W0006P  PP &U P6 P7 00CS0W0vqW8f '0S00000Y00#000# 00 0nSK ClS ; X L7pPt. 0nS` !lS0 P 0 R0(0S 08(8 P`0pS`00 00pS0 000ܨ p P 0ꀇ9q00CS08I00p |  9  W- ` ppS rS0p00p0p9PJYPA9 R9 pW0: Rd ^ 0nS` lS0 P 0 R0 : R JP ;`0pS`0 /; R# 0nS` lS0 P 0 R0Pt  `0pS`0 +pWE;UP=GUgU>P3VU00GUX $ 0nS` lS0 P 0 R0 ,000gPc `0pS`0  qX QX} 0qD=0  00Sn _Pph L= R|QP=- PT 0nS` ElS0? P 0 R03N0S!\  j>\0S \>TTTWU 0d HP0P > R > RqXG ?;`0pS`0+? `|? R$! 0nS` lS0 P 0 R0u|?`0pS`0? ? NPD010CS0 0nS` !lS0 P 0 R000  Q0 P|`0pS`0< xpP0000  h  -`0` LRTLL0<SS,0 0Qڄ0 -LMܠPp@* W* 0 0S@@T0TbW`BPP l0 R   0 P 0#T 0EE@t   -LLM0 R8Ÿ" 0 q00  R 0  R1 A0 Sd KP& 0!S] 0SWʬaQQڌ 0  Q @0 0 0 S 0  {P,q$Q0L00P 0@0CS0@0 $0:00CS0@0 0`00P @@0@8|DP  -6LM PR,P l,K6\@Pp P,0 Q@i0! ( P0 S 0 !R %R  Qd 00P0\ST 0 R Rʤ5 }O5 P %Q00!Q`uTş0 R`l00QP 0 0CS`0e0 |809"00CS0D0e!0 0 Pdt Q`l000P 0$0C`$S0d0 =|00S? h@>3 , Q@p,  0 0,0P0Cs,0 0 00@b\s Q`l000P 0#0C` #S0 c0,0T5 2`V0 0 P-ꈂ Vp|000P 0@"0Cp8"S08r0 0*9l00CS0HPI 0SF q0 Qʠ0 0@T*0 0P T:0@00Pa Q@L000NP 0!0C@!S0A0 x40800CS0u`匐0 QP\00!P 0T0CSP0PP0z Lw0H p DP\  -鼁LMⴑ崡`0SU !@PO 0 SdP? pqP0002@T V T (1 BR A0 0 [ P`00CS0@000.S0 S&P 0 S R@ 0 P0`00t DP| -43L M0 00,  R W,T P@` ;PpX آ 0S2oM0@` T QڐR2 Q@L000HP] 0P"0C@H"S0 P4 000 S/ S- @PP pP `0S P@` @@ sP|0p p0Q @3T},@P0$ dи'W6 1 R,0  !0S SSPH4pKVP  0R1 !VP p PSSؚp|ӚSSX0U0x@=0Sa  (D,$幚  ,"<|     -LMMpA^K PE0PE` @ 0 Bp 0T0 PxphHP\0P 0 S @ @(u"< # #$# -QLM@l ۚ0S\THx0S@4 40 0Rh.J0< #0#  -QLM@p 0S`X H80S@4 40 0Rh"0< #<#  p-LM0AP: #:0$ h?`L3c0(  ,0D?B3c 0CP@BV;  {P 0S @0<0V$ LP ߙ@Е0V0 LኖP ƕ0-S xl͙@pL0S LDC4h Q 嶙@ Mb<H#T#`# -L 8xEP镕0 R  <l# 0-,@,PL $e! a!},x## -ML,MH:D:K@(L8:L , @0 pgS0K*K`ZKLHH 000ܙؙ+P0 K0L 0 0uS0nS0 0 0JK(@D@Dpt+P do+PT7K@ @JK(@D@DP zK0(pG(KpG 0p7P@ ?hZKK0T(PE(LPEL #% *01Z7P@0C0*K( B BS1`@ 10DES;;;;;;;;;====================<====<=============;; <<=$<,<x====X<=<<=<d==<==\=K@ @*0 D$-fpJKW(@D@D w:KH00Sb KKL Z&P&N|K@ @* KH KƟ@0 0 0 > 6,6BK@@+~* P#%^*,6 (UKJKL(@DL@D0.S 0.  0 l ba*00d5   %%000`%`5\vp@.D50Xa4(K0SjK(`F5`FZ 40XS4̔ 0X0Q000 0SJP$0s@400 yPMe pKlp$L003P0C SW>$@$@@$@hB@$@$@?30S [e {0S50-S 0S0Z0S000C.c:K(0C0CP KAA)P NK@DK@DLL`#0A P *@)P@00: SP Wp e@00: S S0S2"2P 0B0S 20SP dhZ+D20S BK@X+@t) 0BK@S@ +P10SOdGNK@D!@D0@eA P! !%*xA0S ڌ10SL10S  0@BK1PAKx AH0 P P 10S0S00S}P 0SWppyP`\00S }$$.$.0. //(/|>L/$$$d/$$|/8$(/$/$/؉0.T.l.d..,.CTC. - LCd0 -LMK :P @0S  [0R 0[S 0S$ -MLMh% dR pK9K, $ >  3P@50S"rğ0S ;P 40SK KP 40ScO[K0+K(PE`0PE,0BK` 0T  P 40S6N `V  K,0PS +B(3`30S`G30S e> K(AAᣴP3t(K0 : SKR SGPN@ 2P`20SK  0v dP 20SٕIK(@D@D9K) 4P Uʥ?Y00S 420S 0SD  ,>c뤑0SKK(@D @DK 0P Y10S$c0S1 R 1(K0SKh1 (0,  0$  Y9K$Y v ,NP Y00SnY$10S (K0SK(K(00)K 00S +K( B0 0C00(K B0  K4Y00S ,0 SP,~$$$80h0 $$$x0$0 p-PLM`P@S L10SO@10SK410S p 0@mpp00 0vP 0S0;0TPLQ ᗑPߔ00S$, p0Ϡ/ (@@#bCl(K( $ @  >P,Ŕp$$$ 000$Mb0 0-@LPd9P!  PD|00CS00Ӥ00* Pp@ 0@ 0CS00Ӥ0"* PpyT0,"| -pLQ  ,P@ XP0@S &P`PD1SQ0t -Lp@`PU 0 p&0f0@L&0Sr00a000 x&Pr0000D000 -L$MB0, S`20S||x嵐0, P P2c 0S ]0 S0 00000 O0<0 <0  P0K y&m/ 0 c&Pj& @0 ?@_&0 0 ,P@0K040 p0 0@<0@ 0@0S(R&SŤŒˬ0000P!&T zP@&0 0P@ @0pВY@ $01D1T1   t11 M-LM01, 0p`S  oM00S P% 9P@ %0 G,0 tx'p `0pS  0S P@P@0 ,0oY@$1,$1$1 - 0LM@ 5}2, -`QLMY0rSwS ?RPPU X00G 4P@@ 1,PP10PP4PPPPPPDP 0p000wS  @0P` H0090Ď`0wS  0  P  0 @X@H@L@P@T@X2 -PLM@Pp`(0S 00wS` rS`U |0 0 0l000d0000  ]V0K`-K}T@H@P@L@ -LM 0K# aP p-LMD0@S PH`U HP)ݰP0 D0 ` 0C00  p 0-LP@@0D0HL0 -RLMP` @10@P]T@TSQT1Tq 00 @0D00@Dt p000 V@O@0P00 V4|p V00 0P00 lpX  ec8 000DP  O0 0H$H@L@ -L Mp@  T,KPt $+K*K < ^' K)K&K%0K(K  ^  $ K` 0# KT, K< 080  4@ &0000 T  <K0 0 pS L@`2 -LMD0PSp NRL @T Q@H@)P0D0@ P`.  gsp0P 1 00P ( 00$ 000 P@D`  L`VD0S0S$@  g<0 cP@L@ȠR0@-,ȠP @ 0"\LL ^NNQ0RPBu 0PEu |2\x2LL7&c2c0T2RCV]EH0PE0 0  0  0  0   0   0   0  P @l1'7c2Tb"U cbUI U30 0  0  0  0   0   0  0  PE U @PEu 0PEu 00'7cb2" cb0q[ -`PL p@$.0(Ã$H7c"( 2'H@`c\@^B^BN00QA>AAQAAq 0S 000  b0 QŒ00 , P080!Q,000SꐿJ$  -0L0S錿  p-QLMP@`p00SV@+00$0!0$D"0$0!0$D"0$0!0$D"0$0!0$D"0$0!0$D"0$0!0$D"0$0!0$D"0$01`FV$D#V 0 0$01`V$D#p錿 Q  0 " p-LM`P@@Tp -`PLCM p4 7 0 (1 0JK1 R0ڨKKK 0SK p ?@`PK  R p ?@`P4!' P@-P $ RS΂@ 0p`809 PL0  (,08<lPP- $P Q <01 Q0C 80<<ࠓ80 p-RLM@` @0S01RPPU pPp(0 PS00P(0,0S00,0| (PpVF20`f$00FPS0,0$0p040$`phx0%0 0X00L0 0T00P0X$X, -$@L40pS` $P0 (P4(Q$ 02(0,00( `cV:4b3(0,0000004PcUP!f 3`V 4f 3(00` 00( 0S00,00`S*0,0 -PL,M4 8 ] $`VZ 0SW 0S0SQ0 S 00440@  < 8 0JpWh: 0 Q7h威pG:hQ D*00 0Rh S.0L T0l pl0T/ PP0L 0Lh 94 094 000`0  h0S*T0 #L B ,K 2+[0SZ0Jp[PW*Z 0JpW:+0[h pc8 VP0W*Z  0JpW:h +0[Rpc8 00P(pG*P0W*Z  0JpW:+0[8pc0P⨁pG0W*Z  0JpW:+0[8pc0 P⨃pGh` 0S|PEu PE0u h ` h0Sw:0S+ S 0l@LT0l` T/^p0PPL Gl0`P00X0d 0XpPP0L 0 64  03T 02L0C0,@K ^1+0[SZ0Jp/,0[S ,000 /[0 [0 20C"[0L3  ?1/ [+0[0SZ0Jppb82[+ [@0,0[pbS80  0@54 00H000HQ W*Z 0JpW:01@ 0C0 @ pa800X 02P0C0,@K 0+0[SZ0Jp,0[,000 /[0 [0 20C"[0P3  0/ [+0[0SZ0Jppb8,0[+ [@pb8&2[ D0,0[ 0H0HQ W*Z 0JpW:01D 0C0 D pa8H,0@D 00lR0034 0f@Qt H D0PaS<@P c 0 PeU(0@Pb40e0eU P@@0UP!0ee@0@ 0<PU0< @0S @ RK @0< B0< @ 030S4 WZ< 0JpW4H@ l0@H 0Q00 < H0c 48(4<,(<4 <@SH  14 000p00 L 0L0 <4@(08SR :%<,0RP0 e0e 0L P0l0W0e0l0 $0 4#u.4p$`0% -L|Mp t x0 p0pLK W R *t0  0 Z00: LK00SP Y!Q | x ,@K0P00@0,0K0 2K+PK0.x0 00(.P|00SP| |pY100pcQWWQڀ p0R0P0SKKplK 0p Wj0K Z*t 00S 0 000峠 Z:p\ \   T#T3̠ 0 @@  9x0 p [S\!`0|p  0 0 l0 Q0+K,0KK `0,0KպKځ 0,0K0 "K0 | BPPd06 ,K -U G0B @T0DLK `0`0C`0 W< 00t 0p W0^ \ l0 R|00  *00cQ0 R:p [QR! C x0  00 0bC10@0 V,0K+K"K# \ 0S x  p +K06  ,K - G0B @T0D```Vx010 .+l+--X2 0`,.z -L -L4M@P&v0oS000 gR   0尖mS000 0fR   `X0 T0 P H p&epH0@ 0S񟗇@LXdpx```H  P 0SB 8 1 -R1 0@cTQ6H0SL P R/V``X00L` L0 @T 0 000CS00,K 0T@0S0 t,0 R0 X@ 4@ PL hPP `iP@ 30C S((X(x(((H RI 0S 0S @ R4 @4 L00L0@8 L00L0@ L0P D嬆`0S @0SD UP Z 0S0SPQ TX a2P ZTX >@0<7 Rjt l`T0Sh <`S0SP 0!R0P0Ss S4K8 K0KY1P0 #80@ 080 Y`V+ `000CS3,K@ P@*0S ,0 R D@ @ = P *9@ S"006P< @@ +0S :&@P` _X 2T .P@ 'pT IX 0S0S0L04]@8.}%% %%33@Y3d3 -LM0@Sp yKdP`^0   K R W084 -L M0@S ?^ 0 K R 084 -t0LPd0 R X0XP PP00LN ㆾ@0( 4P000(%%}T,$4%P4D`4 p-LM` `P0@0@\  0S 0S 0S p$, -LM"00Qp,0 w$Ps_`0@0 P`O 4d[$K4!04  PN \P4 T勏K` D*0S0 0 (P  !0S0 R0 0  0@ f!* 000'P0S d0 ,0S \,0S 0QO+++:$ -l2LM 40pF ;;S0SQR0SJ R, 0,0  0++PR- 0\ )0S(dP! ?;?00clcQ/\ 0 8',0 X0000000S0S0.P@0S0 & 0 X@0@@@080   0 0S}z+$0@-@ 0!?;?0c\<`?* Q< R:8\0P0S000 0SP P Q!0/S0S*U 00SS 0 S /S R0S00++  -MLMp0P@AnK 0 `F`F R 0%U0 U 0S l @!0S D 08: S0  ܒ$+$%%L -L@!x^0hFSP7 !0Q0 0 : SWFH` d参Q0 R TQ 0S 00g0hxX!P h nRXP 4h@,%L%+$%*H%<%P%h% -LCM0`,$0 (@ A/ K0 0R00P00 P0eS&0eJ/K0P 0 0p 0S0  0A? K   , (U 0SD0 R0 0  $0 S $+*+p% 0-(P, L@ #P  $0 0 S0 000+* -LCM Ml$E~KpGpG 0,           `$ \$ ` 4* R@ R  d$ 0S3 R 0 P, 0S ~뤃0SZ3 (K 3P\4 4 XT @T40 @TP C0@: S< 0,e P,0 S ,3 2@.PP 2 P2R( K"\$ XD @A08"X2 R0S @lBNK@D@D~ P@6 qd4 S00C0 {y !0@00e 000p?y `  0000S P0$,I~s '0SPY 0 PQ 0 QP@ d0SE (~B< @0S: P7PD %Lx%+*&@,%%%%% ,X$,& a@&X&l&8&&&% -T0L8M<0 0  8 @ 4 0K0 , ( $   H@K0 -CML M☡0PP,0  1Q  0P1#\Q:,0 S @,xEKI I0 0`$ @( K@X d 8 \ `0@0 BNK@D@D 0#P  @00@$;D+t+& -0#LM0$,0 P`P 0  Pp@(0S  0 2 ,0S ,8 "P4 42((0,00h0O0 82 008"Č Rh  0P1OP5~:\z:00/0SIOK,%040#0PS<,% 00L0TO:0082 S0,  0P1OP57:\3:000PS %01 R |@@`P0, P( ,P0h0QO 400Lh08'"i 85@0 L0P ]%0 0L T: 85@0 L0~+ :&+&& 0)-Lg1!1Q@@ px`0(40PS #% 04L0T;:0000eW+ A 00CS00 0S 0`00D`0` 000`0 ``< $0 4L T:+̿+$, , -@LMT x00C0h@-p0\ ` L00n^@` 4K0CB4  0D0 04 01@DpPÏPoD \ 0 ?00S00X W 0t/1E $$pWR`P1 ,0S , 0 P  `0S@.{P1)O  0 Ppz@0 `( B0B!O{0pt00 S 0l X 08  [D@ 0(@_R:0S:P h0S+''''<, -MLM0lC\\#, 4 @(  P@[,4(0 B04(  3<  400T` t00\F" $p`"0t/AV#1%Y X @0 0  \2R_ Q0++:+Y+):*|+T))}:(( * X( h, p-L@M P`K0S 0S  p* -LMh@ PX  P D P80S P oLjfc -LMؕş QS, @i0S 0S]p P0S l5 ,0S `,TL%0@D%S001 0ş0S 0S5 R u0DS F0S  0S  0S E 弄0帤`8 pb# $0(@2fP1\4/ 0A!b!L@ w#0S ğ$00`0Q0S #P 0,0b$@0@@40@@@80#c!00acQDß0SdS0S|X3 #@P@@@p0Si43 R b0S  P,0Tp0 0@"d0 #: P,0Uh"0rSX00R@bն@Ҷ@϶@P! 0S( 0S1 R8HtP (uK3P!0S s4t( =K8 @ < q/P &t`1 GP00v@T v@T Fthv@T Pv@T Fa4vZP`$v4ss ss|0vPss+|+(*8****,,x*+++;gfff8;+8,*,4,*+<,,,$, ,*d*Lj*+H+P+x++++++ ,`,T*L,x,( -80LM, ,0  @3!P+ %h; -L8M聟 `,0V!0 00!V0@@T Q?>1 D@!T  `,0V04 @@VT Q?>1 D@!T 0 T0 0̀0P( X (0KP L H D @ < 8 4 0 , pC뜠0 0P,0`U0@T UP@XKP 0 T `,0V00o+,,++ % -LM0 0,0 0p:40  6 6< 00`<0 @0R)0S&6 RtF p 0d 0gP 46 ,0S <,兺0 ,  u pu4 0S R1 < 8 0 B ? `PP@404 S S` Q V@1(@Q0 T `FV@ 0%0tPP`@T1X@QzTP $0000 00SW4 Q4  A 4 4" 4  R 0s 0 p00t 00pPd4d$00i4 00$4040$0h Rf   #0S 2r 0p$0h0fPR <0 00x3t3   RP 3 l hP3 R! Ht2 R4 3 R <0 R 0SR;Sh0S)|0<(œ R:0S:\4h0S1<  0@#? S`& @CT`0t0@DT `4"80d a( Ÿ.}P^1 R  p (Ph0<0 0<  0 0PBt,1 R 0t8tlP  0p4< <0/410r($0 P X P0S 0S 4 hP P0  } D K j +0,|+$,,0);*,++ ,*+%%,-*(-D-P-h-+*;--$+T+-;. -LM@P.Ppe`VWY!?> DR.000 0. $0`F0V$0@\ P0 S00*$P ,@ R0 0  0R 0S R0R0S RP  0 R pPd ]\0 S00Hō<<? ,,+T1%,*-D-.+.<%$.. -80LM, ,0  @P+(%; -1L8M1q1!00( T (0KX P L H D @ < 8 4 0 , ,0@Q 0PU `TP@  @0U ,0X00P @0P@ XK0S S *$%+P(%$, -LM`VPڴp崀.@PT 0S  0T @T R 0S `FVP 0  0P 00$%,T1 -LM$$ @0 @zP,%0%; -LM88 00 @g0Sh8,%0%< -MLMTTE0,0   BR$L\ 8P % P80  4EKI I4zZ0ğğ q`$aA4( Kpp$p4pğV`$ 0d *MKJ J0P000Ss`V:ğ $`0V0 *D0P00\'`V:ß0 q`S00*PP V:MP,0 S |,0S 0 P00S 0 S s S $#P # 2  00C0 "P  000 00C0  SV;;S T"9(K00MKA@AKK@ $@0 \4  X$ iBNK @D@D0>1 R" 0̠  A0S0?0?00 R=P0 @`n0̠ L8{ 8I  0 0` PPR PP 0:0 ) g $,..*p,`,%0%  ,... a.D* <%+H%<%H</.<.\.%D-t.. -ML08M (8Rp, (`  Q 8 Q753 575$\C0S P W0 41 R77 (K(K  (K0AO0KKl,0S`7(K (K ( K(K0 00RP^^x>KMK rP$ $\0S#  R0.S $0&$00\ &"F 00CS񟗍DD$0SX ,0 S ,,d00  & Y05 R E0 S %G 00P%00C0 @0S$ $\NK @D@D0@S^K PE0$0%B5 R ZmP $\00$0S0 R$ 4 R4 R$ hP 0: S0   4$00^$\OR$ 0.SH00P[S0 41 R33 (K(K  (K0AO0KK,0S<3(K (K ( K(K0$00\P000 Q0hNK0ᴀ$00$02  0`0C0 @@\+0SP $00$0P l"00C0x"f>KMK Y6P8"V4v00@;P \ 3P !?^0l!00S 0S ,0D0P>KMK Pe$00$0 1  0`0C0 ,崀t$/v@P_ %l0S 0x0 P\0 R\ 0SY <00M0 ++*HH/+.T/$,l/x/d// ,//+p</*//0 a.0D0x0000 1$1 $$0c -LM$$ @0 @Pp,4%|< -`!LMX0P!1pCH1W0:<000@`V Q 0 R 0pGW* 000 R PQ 0 R 0 UPy`@uPl000`0  00C0`0 0@0  p,*x4%$,,@, , -LM$$ @0 @P0,8%< -L4Mtq lPhh!0$0 @P T0 L0 H0 D0 @0 <0 80 40 00 ,0 (0 $K# a Q @L@ 00CS6PP  0QP 0S P0@T000  00奭xTK /TK% 0STK@ <0 ,0,TX8%$, ,*h%D1P1$1 -`LVP)P>1 1ER# @T 0S @T.!0EX00C0`FVP 0  @00ET,,*+ -LM$$ @0 @XP@%<%< -MLM0,0 K0 HK0?(@DD@K8K @nK ? x_R@X\$UUd?(K1 U5U3HHKKQ, P0@@?|\ ``N A$e @e?AV@0p`Y/110S(K6$ULqf QKPTPK XP58K1\@@?NA`@ 0|0l(K0(?K!d $5dKS@B@h@$5A@l@0` |  ?KAd@KK\ d0Tb 8KKP=aHK0(K( B@B8KA =K(@0@ SHKAX4 ZK(@ @K!HK1  0 K $08 00C bpX dL?>1 H!X 4,(<(,$<HK ,0PKK K K!(K!40(K18K1T@8KAHK@HK K˟HK0 0 (K 0! 8 @˟0 S 3 S (K8 QHK@K0 $08KAK KP HK,0\K0CQK8KK1Ab KK e$5S8A(K!pK 8K0K $  K,(00@S0^ TKHK(0 , A0000@K  0RP04080<0@0D0H0L0KKT08K !L5KsHKɟAÄpX3L Ϡ0.0CSDK000KHKA 0 I0CQ(K!HK 0A\00> 00c@# XpK\ K(0SK.!0\0@0> 00c# K 0X0C 0KUB8p WG?>1 AR!?> p W ^$ ^"KG$0KQ0$0HKA`0.!008 > b0Q0cP8K! 08HK@ Z $5S,Kl p@h0PX`P ^ $%^ࠡ1(K01!p@0SX^ $%^ࠡ101v(0K f(KHKA8K$P @$(0K 8K1HK$A (K(K0(K0(0K HKKAP3P B P5 R9 K8K DK,0QKR$PPL5Ks8K0@P5 m P|,0 S ,劯(K P K40PP0K(K8K K PHKAXğ0 S(K!KT0K0(SHK@TT08K 1 P HKAh P3 R KXK8K1 SQKHK\0A00RKHK\0@00?0p00S @@THKAK XHK@X(RRKK`000QpKK`000?000S @@@THKAK XDBQKK\0$2RKHK\0@8K  P' HKA4B P K0S(K K\00SHKA\08K pRKK0?\0<000S4(K08K0 RKK0?\0000S4g(K08K0 \K8K1 `K8K1 ++*<&<+,,<%@%`:$,`2<*<=8=+\=U ==++==+=2K8K(K =HK@T0\ S(K KT00TSHKA(KT08K @$(K P0@@fK@000| T(K!p0!SKKT000T  000| $@P:0 0` PE,(K!0 SHKA2X0000000$%R8(K!?l>1 @  KK 0h2RK`00 ?> 00c# 8cW!(K!0K"0#>PK1(KTHK 0AO K0@ P54C0SPXPr 0S 8KpP0@@?|`N A@?$%ARP `A?AP=L0@Po4D P  ;T3$5SDD0S Pf0S`P Kt4 $ X\0  0 00 --L ԡ, p-PLM@P`l0l R T D0 Rp80g 7 0  g㭡}2 --L  --L  -LM@rdx h # --L ~ p-LtM/Pj@TK P0: S p0`rSS R 0-/L@iPU+D0 00Y/00(+=+900D%2 -LUMpPKP峆P@lK8ᬆ0S-0: S  SU P U@P P@0 R000K@ሆP h1: S@ /gc$^qdd23$3 P-L P .543 -QLM@ P T 5æD3 -LP 5T3 -^MLM= =@, @= _K A=A`P+P^5: S  PP PDx-0S< l= R0 X 0S4= &D f40S 0-@,=@(-(@@@ @@.0 0*0S P ,P(0,<00iPIl0Sd<@T 4,0 S h ,}(,-K B BP 8 HPd5Tt5x%0%#,0106Pd5@T˟˟+; Efd5T `m; R0  V$+0S 0h$ p , L+0 t'#Po70Cɯ5@"%$pWZ0S[0<cQM0ZQڨ0Qڼ /0@L@0S Dc0*0S2 P. 0$J QQ\  000S 0 )c)0S P  00H0cQ  000cH0t)0S c\0S P  40L0cQ  400cL00S ` b(0SX P X,5S05S. S ( 0S>0S b(0SbP 0(<Q  <0(5<(0S b$0SKP{  hH080@_Qn d H0S.0O 0S b'0SV+PR  gL0@0@_QE p L0-0O@'0S b(0S. P* 7 W0S0,%R0S0L%r 0S 6 R @vP `P3S x 0pVPT085"d@00PgS0$PP Ve 00 pWD&00/>10@B\6PPF 6E646P(@ ,6P6 $P5& 0%@U5 @E00 0%S P 4|5    dd L``P` `$h x (4La(0S? $0 00L 0P5?T5 V>X5pP0@@?|PN A@ ?$%AR㰠 `A ?A=`L 0D#D3 P 0S U0 00,%0S><0(5 H0S.0O "L00O\P p"000D5SL000<5S,2  2 }000a45 SJ]H0S0O L0-0O021  1 *1  1 |000h1@@4P  0<0|P 00t!0S0c[ 3t0Pc4`: d|c,`2 Htc <<`*+,d3D-*++3@,4,t,+3(,++3333>@4d4444|+8,+ >H>6T>x>.>>>?1 1FR#  800g\0 8 a@T^ 0/.!1CQT^@P0 0 ! {0!S 3S 0^P @ ?>1 A!  ?Q>`0 0 ?> 00c#^ \0008 W0$00C0g0$0^++8,,,U :+ -L8M0@K00 , ~ -RSL4MP @`t pq\d1  BRP  T 00c0Q3@T TX0X  0S  R1 018Ġ77800CS`, , L, , L, L, L, L, 0S0 #Q00 #LQ0 R0S800CS - <- - X- - - - - 000 10B0  2 R0  00800CS- - - - - - - - 000 10B0  2 R0  00800CSh. . T. . T. T. T. T. 0S1 S20#B1  0S 00 -LDM@PP @ <P (  P0P fY sY !1 1 !9p10S  i P| 0 @PX0P @PP8 L  8K0` p  $( @8 4@Kp`,PL    0P ,P 4`  00UA,AAB B8B5 PBTB2 3 C F -p-L M$`K 0P$0 P @ P00 0 P MPp -0-L0PS @ CQ0 1Ñ0V000S0 --L IQ --L =E --L M((K0(K BA0 R  -LM@XpB -LM   K 0KK >p@VB -LM @ \K0   KpyV0 B -L -LM@@0S  h. -LM@Wp$ SpQBB -LMM B~KpGnK0pG`F+`F(0 T+PrPÏ˿ PP"KAA NK@D,X  4h 0X !VLX|,`4 0X DX`L$BpDa008 =YP6KAA 4Yp@U0S' T 880S@VT 0S 0@T8800 |  Spl\T(0 SH(b`$C`CCCC7 D4D5 TD p-L$M6 P`*4@K P 0` ,` 4P  *10AS1 0K(0 $@ ` (KhWd\ {p H<0! XPd8K Xp@ TU0S  gpRT80[S [@7VT80SS S 0 0R0<0 <K5`!40LLL Dp``DblDDD5 DLF Ea.> 0-LMP0@S P TP 0@PT 00,0l0SKt00S0ڐ0SKt,0S0ڸ 0SKt(0S0+0sZKtP40+0SjKt`4S000Հ[0S0S0Qp P!4  O$PK^  X<NK@D@D0%   OjK ,H `0V00S00  0 PM KA P0S\K|Y XKK t | SKDR 0P \şU00  xş4T, @P`0 3( / =00r01 S90OKt(0 S;30> :K0  0K l \bP rP"M(  ,~M   oFjKPt Ktp *KP|:A}K(pGpGP`)   P `V:JP @`0Sr0@0 0S P  T N0`Vj?0ZL  AL  9!1KAOop !h1p PNK@D@De/ K>K| jK0C^(!t@P(`K1( K,@0) 9 0 ɠ$ (PKp , }mX.L.\GGG2|.G,GHH.0d.0H@ld8HtHHHHIITIII@vuuII.؉ I lIlJh.@.J2$JHJ`.D.\JtJp.JJJJt.K0KT.DKXKL.YpKKl.K\.KLjx.LL|>P.@LXLxLL^KPEPE!07BNKK@D@DP(!01+K1NP!P1!*K'Np  UP>K0C0C``11 K00aY1P=@1!TaI2P xa@02P<a6P2P\"000pa&2Pb2Pլ(b2PչLb 2Pհpb2Pէb3P՞b,3P8bH3PTՌcެd3PcPb|0S @3#?UXcwP#000IlP3#@ =c尬3Pn40c奬4P Jd圬04P<A,4DAPP Pd劬l4Px/td偬4P&du4PոW 0  00- L@PpP`0 `R\ 000yDP@< 0-N(,edA2.Xv@v p-d0LM0`S@P p84 0SNph.gdLL -0-LPP@㑇$0 Ե ʵҵ} 0-PL0@S00  ; xl0$ R 0TST 0S S 0S #ZL. }OP,DP -LMPp`p@? P. $PK` fMp $0 P   0$0 $#40S$0 ld cU PD.LP$ M\PhPl -LtMK@rlPx0  P P P 1 pPP -L2LM<2< 1  424p, 1   p `PPR K Z C/K iU@= W3T#1 ,0S ,Ȍ 0eP|M`P㕆TMUP 0,w sM EP  kM ?P bMꈠKZ 5@Kl p0  ` &P @ W !P 0hL?M P 47M`PPHPpmPPPPLjQ -LkMl0`d$0 PP@ 0S@AsK P $A1" P 6^K2P@ P1*$0 S $3  P*0 S/R ` d P*P< ',X`@l QdQ,Q8QTQdQpQ -LMp0PK 0 Ht0t `h ,@0X @ H` 0S  ܐ0333QQ -LM T` , p(4 P  ?P>P >P NK0S h_.0AUwʤ> >pf  7 h> d>R`.`pT $0 ,50(5P ( 1D= @ M^00 00 Rڨ R= =$ $RӜշڰ$Rӌղڈ000 0400 B`40AP HL0Q 0 R$:R8R0H0400cL0 H0S.0O L00O PP00Z0\ʠ ZP00P0 0T 4Zʠ ZT00T0˟ T00S1800`0 8Zڜʠ Z`00`0| P80S0P5 00#1t0`+003x0@4|0d0 |Z;ʠ Zd00d0JT;\` 4@8@帊@Л0P4@8@@00" 8 000P|0@8@@000 夠Zɟʠ Z000 0B00000S010CO 00pǏ| tSΌ/1`G P$p`Z`Z 00 0` |02X3 X3嬠S  ʠX30X38 X3S H܈P0`x@ @ⴐ P00 )1 @@ T` TBP K0|00  0  X@< @7 0 H 0S S0$5P㸀 0P @@ ?|`N A @?$%ARp0`A?A@T0 S< R{`P0@@?|pN A@00$/>AQ@0P[`?P?T0 0 00S000ʠ $FP 剐X3 0X3@ 0 腟 80080`00`0 80Sڴş4 00RK 80080 `00C`040040 |00|0l0 0 E0 PKOP? UpxP开 0Eo0 50 0ЄD5P0`x@!@@b^Y l 80 Si  Vg  \TbN0$I<4@ ɐ00 000@80080 `00C`060 PP0@ @?|`N A @"?$%ARp0` A?A@TLßPp @ PK0?P_xP0Eo0 W500 0000000 x@43!R@@ऀXPʸPB B0HHP帀PP2 @B 0 P <3 RRR0S mH聟 @ @0 R0dŸ  Dp@ PK0?PxxP0Eo0 5P0P10`x@!@@@Tڴ00i 0p@PK 0?PP0 @?|pN A @\?$%AR㰀` AO?A@Th0 Sd` R`ڣ?/0 0 332,3L.@.d.h. 3$3Qx.P.QQR(R\RRRR S|.VUUU8S\SxSSSSSSt.0TXTD.`.TTTTU\.(UT.2`UlUUUUVDV\.p.l.03:X.L.T@.V(3V3\k 3VV(`P0@@?|pN A@00$/>AQ@0P`?P0@ @ 0P0i0p圁PK0 P?xP0Eo0 50D@ 0|0@ `|nP00 T DHR0S T0T p 0@TG0G0S0p P0@@?|PN A@J?$%AR㰀 `A=?A=`L0`d 0S2$0@$ |0&P| $ Q0°0Pè Ű R>3 3  3 0L5 @5LV>00h0Ph0 S:h0PŤ0S0X3/ X#0|`0Pŕ V>T5 @T50 \X5 =L 0OOT0T$0 $F0 X3$@,@P,00,0@`0xQ0000, B` PZ0 "@p0`S$0bZ/0A P+U 8@P  PcUcP#u  R  D YYP@ u:  9 +B6+$0| $ D@$2P4/룿/ X0,0p`!P4뒿/ G 0p Dd`Ÿ`0d |P  B 80lcD80|00L8P@@d D0!{DI~ S|0` 2Q@500h0TXdh0 0Q 0hh\D0`40 SHHQD@!@LD8ID0S nWrP T?/0 0 Wq0h0 ,5<0 k@0 00Ϡ΃4 `>W8W3\.DWxWWW X X@X`XXt.XSXXحY -LM, ,P@, 0p0Q"0$ `,0 V` e0e\0 40 40@44 ; :,0Œ8 ʟ0p:0 , ,00CPʟ+0! * 0`e<` ;pʟ1 <0P0 `$5S@8p 0T0T0 1X0 PX00\0 0\0/>`$5SYڴ 0|/`010Ch0 h000h0h0$%10l0 @0`|/l01d0 )d 0R<ʸ 0,0\ 0,p8.!Q0σ\00>00c 8p W 00C 0pd(@`0xQhW%00PUDh% *l 1 D, '&0000| 66 ƟRT000T000@|0嬠  P`0 0p Pe<@6Pp Ri  00050 80 Y0 (00(0%540( 0l ( 048@Pp- | `!40040\%4800` \@4 45.!Q0σ`004>00c 4  P $00$044 80<0 SlP 8y@4 R`0 \0$%R L$?>l 1 D, 4$0000| Qß3 RT000T000@|0嬠  !P`70 0p Pe)PT3Pp R  000 3< 800 S<Y#0i14  4 "2.!Q0σ`00>0 0c x2 <$0 Y0$0L0$%R0<0 plp h@\P@" \ !0$%\ 10 10S1p p0W\ 0$%\ 10 1tt!0 00T1T0$ <08!00 001 0008,0 0 0@ dP0oU yX@@@V pX@@@ 0|e/`01d0@?]%33(3U 2TY -LA^ p t00 000 R6Pp04WP㌠(p`͇L|0P` 0O;h0d4 ND400ptL.2h.,23,3A -0`A VLP|`A@00000 0`VpcPBO ` p    ,3 -L M0 d@Π , ` t3 R =@T 0X3 _R`0@P08 P0 8XP43 03`R`0XA  $5S ?l >1 D,  00C0 00C0"00C0 000000|2 0000| [D2<2 RT000T00C0@|0 4 40 *P`@0  0p Pe2P1 pRU 04)00C0@, 00R> 4@P180 0` @80 0` 80$ 0` $ 800`4  4 08 P ?Q>`0 0?>0 0c0@8 T0 d 04X@@@ <33U tYY(3Y -LMpnQl0A d  al1 RO 00C 0@0S\0000 10 d0 l 00C000C0P`,0W**q0 0 0$@Vxd`0d C0XKB$PE 0xF 00 6)  33U (3Y Z -0LM`pQ  X0X07!h<0@ L 0PP " L.@.d. 30Z -0LM`\0p l0 P X0XN0PP ,0007 h $ L.X.@.$3d.PZ -8L0@S% H H H H Р 0S0 #Q00 L0 R0S  pZ, -8L0@S!긡 ԡ     000 10B0  2 R0  00 Z, -8L0@S!ꀢ ܢ ܢ ܢ ܢ t 000 10B0  2 R0  00 Z, -L M@H K0s4 A[TeP C@TP@ht@Y -LMP@ȿp1儑儡`px!pP@4 "P-h \ p | 0`0``p0 PbUA40Sh0nw X0W 0 Rg.D343@3Z83H3<3 -,bp0LS2 R 2 pRpW PPs ء P@c #0B SP   T    D   0t 0S@ dP ! 0S P  |  0S R R 0 R P U>P 0S=90S0S@ $P #W90Sm#   43@3<3H3D3@Y -LpMP@T `KP 0 R 90S =0S@: S! p0S : S 0 R !P =P 0SB P (0 R H343D383Z -LM쁟0Q@(0 Pp`i 0: S (0 S (允 0S   p` Kp 1 S!3 {PpE 8@ IP  P =0  |0  ,P  P0  P  P{ MKP  3 ZZH3$[ -LM@`P  "Vp@0V U@0 @ PPU`VUU -1L$M℁PUp$ `Sd1 R 0: S P$0 S $$ŀ4K3@c+[ Q003 Kp=@`D<00CS00Ӥ0 PpP @00CS00Ӥ0 PpYU00yU ,@3<30[.,8[|T[ p-LMP`P @4@P0/S+ /=P0.S P0S@p0S .S0S`V d 00 Q P0S0P,|   @@P0/S H3`[ -0L t},[ -L(M0`@/y=d#P000LP<xm[m@x[\@\ 0-0@LP R% AR@ : & x"t00CS00  ä0 H9 <0h9 $ $A0h9H\pd\h\|\\ -RLM@p 0S   9Tc W@` 0S] |Q<0 CR P00 R%  B02? X 0, CR 100  \ `0 CR 00  \ R@0> CR 000Ri 0 Rd \ 0R  R R0R $X,X -40L R(0$0$   $s|T3\,\ -L <0 R4   0 WP3p L3G - L|\ -L\ -LMhq0S \\嗚PPL @!PD 4a@P!@0P P00FP@ @3 0 0@@MPp@K;0$!  P 0P 0;C 0 0d@d @ˠ$0K $ @8rl0]P3,]L38] -0LS \|0H0  00S_\-\0S H] p-LCM``GOK0PL  r80 Y 0S }p`]h] -LM$@0 S A00$p] 0-D0L R 4410P@@T00t]X7 0-LBMdP0FOK\0 P 0#4 0S 5}0x]]] p-LM`@,0 PUphL3 p-BMLM`0<@KP0 B<0[ES FS AS  R0r S00x>;K30 S X|pCNK@D@D 0)<0[FS 0  ]] -$0LM K WP [L3 p-QLMP`@00H@ph0PE S U@00p]] -LM`Pqဋᨋh!vpXq mP pP P@(@ >w!0AT3 T`7 ?@P0/S Z  1P0S@!`P X:p`8  @@P0/S Q@  q.^|>d -LpM`@pK4@3 00RPPeVP0: SU/00 ¿ XO30S U P 30S  7d -0L zp},^ -\@LM80(0( 0IJJ JJ -LM` 2P( S l  Q Qq00  R( \ 0S#S 0P00 `  (0^pPpp(Ȉ0S 0H00S (S 0S(0 t0W0 S񟗮L D h x  (0\(   Q Qq00  R( 0000((0\(   Q Qq00  R( 0;S`( \ oSf  ,da(0\(   Q Qq00  R( 0\S  G(\(   Q Qq00  R( 0S: * D((0\(   Q Qq00  R( (0`S0Z00 0Px(0\( h  Q Qq00  R( 0S 0(0;Sp  ( Kw (0\(   Q Qq00  R(  ( K\ 0S (0\( D  Q Qq00  R( , 8k(0\(   Q( Qq00  R( 0S  3 @T00u#(vpn1޽( 0phe`d(( ( 0\SS. (~P(  L( ( 2P(   Q Qq00  R( 0;S /.(|)(0 ( P(   Q Qq00  R( 0;S S ( pIQD>(*(YP( p4  Q Qq00  R( 0,S00\(   Q Qq00  R( w(%P( pd  Q Qq00  R( Z lp7|^T^^^^,_<_jD_P_`_ J l____`D`X` 0-LM P@U W \UXQ UM  0S 0[S: \S1 0\S \R 0S 0 0 0S000 00\S  0S  0\S0nS 00  0[S KP@ ($0x`h!`@-@000^S00]S00 R ]R0 0[S \S 0 R ]R00]S 0nS 00.^ =^:^00 ]P P 0]S0PP -LMMpNK @D0@D` 0 BPU 0 K0S0 t U P T0S5 0S 0 ex  J`` -L M@X, 02 ,0 p1 100 ,0 0;P0S4P  \S  RE ZQ@D0S4 0bp00 g R AP\0 00 P \00, 0 S0`B 0V, 0S`:\Q&Q\00 S SP+ 4  0bp@, 0Jq?`a(aDa -LMr ` 0 ( P0 (PpŸ  Q Qq00  R( 0gS} 09S,1SUK A A 8pP@P@(S S (0(8 0 S  ~w;SpSF wSP( <  Q Qq00  R( 0NK @D@DS  S ( 0(0S0R0 0PU ( p . 0tydu00U0P0h(paaaa J b -MLMh P( 0\SSN ~KpGpGPP(A jK$`FP@ `FPP5 0Q Qq0  00SP@T 000S0S   0S(0 S H(v8,bc JJc,JI$d -錂LpP0xSM @:S=d0SX20 #R. @U<ŸPE$ R R 0 0  00 0 0 0 0Q00 00 00 00nS1  paP X1 0S7 S Ha  P@  00 @ 0Q 0#S0nS0@0 P0 @0  | d0P@ 0X 00h+圷0 0% JxIIJtI|IJ0d  -LMb0S!lRhPdr 0SX2X0{ 00CS0r2  p0 +70S 00,K50@ @C,  02!刁000 00CS0 0Ӥ0,pXqHQ$gԀ0S P R" 0pW ` 0@ ,0 S0 ,o&0SŲ P&PJK(@DP@D *00\ 40 qؿ0iIJId$d  -LMr0@s `PR |R0VQPq`20  00SG \PD 0, CR 600`0S0$ CR "0000CS00  ä00@F&0SI ;& \0R0R P(0\ CR #00;P 0 C0 b\ 00`0\ PgM)`0R]t&`vdP fL$ KP2[S<00Z,$dddepuYht@ -PLM؀`pP@) T 0 S R@D @00U00  0 GP P #D <0S1IJ J`e -LMP, Up & &U0 \Ud 0SDb p9  0r1 P`0@0S*,0   y000PU@0S*00K@ 0@ @K @ 00s0s\U @0S*P000K@ 0@ 0&S\SPq(00  00S00@J -LM@P P`p W00  0 0  N P0-L@P 0wS! sS @T0 p P 0 0$Ұ0 d[{Sp zP00$幰 0Cb00 0-PLP @gT000 0-LPjgP@0 0R0 @@0#Hr 0-SL@p  P`gP@4 U@@V@H hrP @\0000Q00bg -L,MS @D ||#lp LP ?PPP4#0SA $GH L Q 0S 0S"0S P0 "PPe2p D 2`b`" B@ =82@ 5$2$ ; 00 , G00 080 4 嶈ȉ >(>DP  0p00  00S& @wPp6 P`7dEP`2 Lo\v`vpvLnH|]TriotrL؉Pgfffn vTpd 0-@0PTL 0Qfc@@04po -XRLMP"@ac?P 0A`V PU / 0S x0S >1 LPl 0S0@  $0 S  1SqQ0S 1女0Sl= @P@c?0P0P00S` 0+0 0K@KKV0?0 0K00K?V00O0@ ;0 QB KȀ0P@@ RV  0徂 㲀 @, 0岂0=(LoHvw$p4p,wPwoXwlw -PL@p` bp lP ?PmPp`t 0P0 PP =*0P0 0PPSLow0fP p-0LM` P@yb?P 0AT K0/3\0 S0 1 !0l p$0=p+=$pLoHx0x -LM0@P,0 #Dbp ?P SPP,0 S ,a3 AT #0 P 00LS!00LS0B \L < p \ p]  Qf` ᐯXIP@PR  Q8 儯P3 0X0C S() h( h( h( h( h( h( h( h( h( h( h( h( h( h( 8) h( h( h( h( h( h( h( @) h( h( ) h( h( H) h( P) 0) PI PQP'SP0-V +V ,Q@ >P \ \ =V1h0l+P 0a0CSX* |* |* |* |* |* d* |* |* |* |* |* |* |* p* |* |* |* |* |* * Ispmk@hjphU @@K`Pp 0 0=00 b200P B\,0000D<ں<3Lo r@xTp4xHxLxXxdxlxtxxxi p-(QLM !@5a?P< 0aV< 0 0K.P( 0Q0 R 00 0 S   0S  0XPpsy P;P< (;phpLoHn$pL 0-PLM @`?P 0PPKPK@P 0@0 SR R 0LoH -PL4M0p @P0 TP XP $ `p, rP' ?P pPLKJ=PX Lp;sP uP`PX  L K<PX L <Z;0T0 0P0 0!R40*X;$Xd?@P` 00XPT0Sc 0 00 , 0 00R080 4 x 4`u U 0S C0 P0ŵU u 0  $0StP0;0 T0S H00c RHKh[pP800c R8K^[`Y U u P2 P$ R X; P PX2 RP0\U00Su US 0"0  40VG 0S 006|0`71 R,4 }P# 0S!eT0S Xu XuX<<\00 000D8D<e  0d U0S4V  V 00S`FV 0V0 R efPF\`0  @0 < Y@0p0H0 D 4:Lo|xss4m$popTpox 0-lPLh @e_0?S L0M0< 1 00S(0( 0hW0LoH$poPpn p-ALM!P?_?P4 0P@ P 0SPU @Zp: _:sP``V 0-S PpsP@P At0S,9p0S`LoHTrx$x p-ALM P^?P`p0AT K7\P 0 ! 0 rR @0S MXWc@P00`h0 R 00C8S` RV 0  |9LoHnp$p0x p-@AL M8!P^?P`E 0AT00  K\P: Q40 R 08SS#  R 08SQ 0S 000 0 at:90bPW L0/9pQ 0`0049pLoH$pxxF p-LM 0S@`)p KZP'0S !0P@PB LY0S0eC10C0@0S0$0 R0pp$peoPp -LM`p  ^p fP ?PvPpp 0AT W @zP0 [ yQ~@T 8)PLoxx -LM\` PW  u`ONFd`@ePX OD%BddW_N( FVe $P @exh.x -LPM@lPK`ᄀdK 0hp 0| 0 0n8 -LM`SK@P /lK]KZ0S@ #3````0SS?KS?K0C0C0`~#S?K0C`VK@ K;QK8m 0h  l0R=9B\! =C ` \1 `! 0` d 0Rd! =9B@Kh ZK KP T1XbL1Pc=9 A =X T X! T1 PVK0 A0@.U A 0@#U A 0@l6bhX 0 P< 0  40  =Ch! d1 h0  cl0Rc=9 =\! \1  A0` `! \10`! S \1 =9C`! =C `! \1 Ũ `0 cd0Rcd! =9 Ah =h! < d1 d1h!0 SKZKh! d1 w=9C |nn?B8xLnxyyyy -LM] PJHJtJ -D0D L0\0 P E TJPJtJ P-L`N \ RT LR0S0f0QE$@F0t0f0Pp F@Dtp 䀟 ` x00H0 0 c@BTT@@DtP @D tu@ @Dt00X0 0PPu0UJPJTJ`JhJlJ|J -L -L -LZ 00PJ -LNy - 1 LP@8 `00Cs0䠟p- P P r0 0  R0_S $S@@PP P  q00 0  R_S $S@@00Cs0StPJHJtJ -1L @\7 `00Cs0ࠟp- \  r0 0  R0_S $S@P\ q00 0 R_S $S@00Cs0*PJTJtJ p-0LM@P: 00P:p0@ph`P0`P* 0B0R0T:pp00U0TXJpJPJ -LM@@t @Dt 0-@PPL 0PS0 P0 p(0  0 P00 -hP@L` P Lp0T*0V  0S 0T*0V dJ\J - PLM@ pH 0 0  R ^T@?hh -D0D 0L0Q0 P`0TvPJHJtJ -D0D 0L0S0 P0<^PJTJtJ -p0 @L 5`P00Cs0 U0 T  @R 00Cs0(0壚P@,TJPJtJHJ 0-0PL@00Cs0 tϠ Qd0AQ 00S 0S0@0Cs00PJtJHJTJ - L 0   TJ -$0L; m -0L?o -0L6(p - 0L0@*tJJ - 0L0tJJ -D0L R80000 ,00@xJootJ(p -0P LU:0` pUh0P0@  ` p0 ՜` `0. 0Rh?$ o(pHJTJJLJXJ|JPJ-000 0 0 bL1C 00No(pJJ000 0Q 0 R LTJHJxJ -LCM`0JK $0 @ PTJ P/,1 P0' )S S1 S (0KU*0T0`pP@ g0^S@ (@T$0 S `$KU 00eU@    JHJ -pQL@@0 @dT` :%PP 0@DT*d0 XD0@ @0@^S@D} Jo(pHJ 0- L^RP@ |P00d0 ፊP0 -p0xP @L@b\`00YD0 <0 40,0 !TJHJPJ\J|JXJJ -0L,TJ -0L#HJ -L -lpLMP\r\`  P0 0Rs 4"42@PT  0c0@0d0CS01 1E D 0RI 1`V# 0@S0P0cPcTp!h0 0CR& 0R 0R>P*Pt @Dt Q@0T 00t0T 0R P

R0@D?R0 00$pp\0 T 00 0S< ^00,P@0 ?00 00 1 @  ?>1 @ p 0P UP SC@, < ,Pd00@TTPUX~WT$ "JhiJJDJ p-LM<8!00( $A 0 PP Ġ00 PPUP` 0P4GU  @PĠ 0PPUdP@ DyP80  p,pPDJJJkJ Go@-?>,1@LQ 00JJ -LM@Q  Q Q Q Q$ h0 PJJ p-LMP` R @0@0R@PcPbV6@ptJPJ -L0Qh0 PW񟗩ꌤ d p  ` V񟗜Ԥ  <  0 D P 0 ( D T `X 00 "" " V  R X V X 08.0004, `@[0T. @0T* @(0V0 0 0  00 , n004 080 PL=@` DA wA0@0@0@0T * 00   < @`DA VA0@0@+ 40 0c0 0C Vm Q 0 R00S 0S,0[W 剐Q   l!0F]Sh @ @ @ @ @ @ @ @ @  @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @  @  @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @    0   0 00S 0  0 0 0 `0S0000 > S<   0 0  00 @ {V @ 0000W(  0 8K KP ]P 0 UPuX p=40UbP  @0T*  0@8@` DA KA0@0@hb0`0  `   $00(   0 S 8  b R8Kr<P00 0S )00 HKPp 嬎  000  $00(   0S 8  b R8K><P00 0S )006 0 | dK@K 0p000 <^0@S 8  b R8K<0P00S00  00@0 I KHK 0KPp~ WX  PJ ([ 3[0cഠ00@ 0 R00#0C S-꘮ ܮ ܮ ܮ ܮ ܮ ܮ ܮ ܮ ܮ ܮ ܮ ܮ ܮ ܮ ܮ ܮ ܮ ܮ ܮ ܮ ܮ ܮ ܮ ܮ ܮ 00 ?00A `@0  (CXUl4*p-Z C0  0A 0  00#0CSO İ İ İ İ İ İ İ İ İ İ İ İ İ İ İ İ İ İ İ İ İ İ İ İ ` İ ذ 00)  000p 40Pj]  H R000 0p 40Ps"@ 0 ]E]0p00 0 40@U S d  Xq 0 ` t0|`0 r)` np H0`VH0 f R 3[SD0 RD0 H p00C0 1`VQ 3[S ` RD 3[S0p0 >QA ` :D  0SC' D 0`0V V    0Svv  D gD3[Sp<0DWF `A 1F`pN 40 U B GH0`VH0 `Pク ,M o$pTp.rXPp,<@@D@ Y@P08 @WPL -L MPpQs 0#S  `P@@:T 0ş00 `@ 0`S VPT`0@@T*TQ%XJ K#XG (5  0S8  @T000@ ğ0 @" 0 R +X 4 R 4R 00 @T+X lY@-X=X ?X @4R44@T0@@Z0=X['P 0@S*S0]S =X Z[@00  #0HSص ص ص ص 2- 0,0 0 4 RbZP 0/Z40 0`CA 2020@S@@F^,0\ *000 4  @0@S000MŸ  10,0 0 4 4,0\* @ 4 o[0 @` DA A@,@ 4 0 0 T`V T0S@`@@T 0`SFP[qP 0@S*S0]S( @T*T0 @ T00Q00S V 00 8080Z[l0`P`.@aYL0 0`S`Z Z Tp$poHd -`1LM`p+@Q``@NP`@ 0S $Kn $A@4P P   坱2@#00@0 R0PU 0S 00S 00`AP@P,0 U$po| -L@PἊ@%Tp? #T U@` :P`T`T TU@ :P@T0e  m&8P@:p`p k:P`DT*P@: ^:P@DT*$p p-LM 0CP`CA)P @0T *00C TpX0 @`DA A0@@0@`Adph><8 $p -0LMpH`C 8 @1Sx7<,8K]wK9RXz Pono$p < H hopoHPpo؀Ln؉LP -L,MH, \00 p4 L H  0S 0@S \ |<V zT,0`S ,0 R V 0S ,0S ,0   D 8@ RD00D0  1S4 `0 7# RP Tq 0ǟ0 ^7 0u>0 0 R^ D 0`;VL@Q D0@ 0J 0!RPU7 ,0S 6 R /σP0H, , 00CS ( ( ,4 0044 |6 D/, 0@3,0 R,0 R @ ,0y00 ~040 0,0 0-PLH P 0, , 0 @@ ,0  00x5 p0S 0@SLUD0 ,0  ağ#080 , ,0#20#0 ,< ,0<0 00yP@> @48|$,,#0< <00, 0< S 0DS  <  < < < 44 4 c/ 0\.a,0 , 00, 000,,0 1P,00 3@  00 0@(x, 0T F,0  ,0 R  : ,0x.B\ 00 2,  0 p00 0S B @JJ <$T,0 R X0TN:NQ`R$ =PV ,0S ,0 R ], 00D L0 W ,0 0H0 1RB ,0! Q5 ,0! Q7@4||!4pP@ p*TH  0 R H 01` Q H0, ,0S ,0 R 0` i0S00p000 PU  , ,0S,P |1opLn؀LP؉@Ppn܀4o$pT4p`H`Kr|A T? Lo$yЁ p-LMP`PQP@ 0ST 0S`@0 0@ w0 $ 0 0@n 0-L@F 0FPP$ 0h 5o -0LMp@`T P FP L 0V0R00S@R F 0 0 $p -LPp`CF  @0;` 000W DM0  0S;0FV0 0N p-LM@`P0=S\ *SZ +SZ@F F 0 ` po -LM`pE2/&PP` @0T00SK 0 H PTF 0S 0 U @' TL2L2@ 0P ,2U(.0 00 OP2P 0 PQ000Y @ @ Q0000 F0P9U&10T00S 0 PU10T00SPPU00S U EPP 0 ㊡P 00000 0 PP 0`BOTPX0P 0 c0 E@RonHoKoX|H po p-L M PK`pEEP@  V 0 /R 0(00 0p po -LpMPK`@ PpP@U WV 0Sp : S  S pp@Ip -SLM0@< /0P < P  H1  000 , 900PT080 4 4 :4@pW7 `eW 80 0c S8Kډ-@ @/0080  cR8KPw-@  <4 zP 0SPU4,44`,  阂p$p -x0tp00lL @`0PPt60D01 @G700000,K  | 㦂P[X`A00 R  0S AQJP ,K {Gb X 8>b 0,1!w0  ,K{ &b0 h 0 } _0< Y}9K,K {lc,K {T00 !HhoHH؉PnKLKLKXtxvȈtn 0-0@ LR# P0\$ 0S 0S0Q RT p0phTd  0X00\ 0S@ 0S@K0poo.lt| 0-LMPK@ :{80@0S 0@S -{0hoK -L M,K`PD p{V`pUF 0KP@3 X XT ,40#00 V  @  00CS0<0U@T@T 0 t@T  z z000!(@hoKntn -LM pK` z@T P0S 0@  00CS0<0@T@T 0 H@T0" zKhooLn -LM@K 8z00 \000yz 0hoKK -LMQ@P 0= S< 06 @`쀟40 0Qp@Q Q 0  T  0R@QT t3 0R0   0S 8)@,i$$KKKKK(k00 000S  0S$4 0S000[K0p -LMP00좟000 SQr`Q0 SV Q  Q  00. 00 R} `2 Ry 0Sv QDbj @B%PY 0SN P 0S? "a 0S0;004 S 0S# ( 1 1`@ 0S Q !|! Q 0S V PP 412  00S0  | 0  <|_0 `0P0h;0l`0P@j 0`00@0000@00Za Q_MoopKLKxvn|nLnTr0 -LM0` V 2 0S{ `VpK뼠K  PPhڸpK`V 0@T 0S @T`VH |V (0\Q=9A =C 0(l0c (( Q=9 =p 0( 0b @(( Q  =9A =C0d0  ch  Q=9b @ =  0H b|00 0S0 0SS0000000 K0p?BK p-LM P 00S QT 0PS4 0S 0 S0000 00CS A0Sa 8 R 0RS  @ a 0S0 * 0SD 0S$ 00S D1 R 0S 0S RA  Cz 0 0S 00S p 0S 0 U  ,00 000ppphP00CS000$phpoo$pKKKXd -L`\MD0V ,0 x 0 #@003# Q Yt +0 0Y 0-0p0 0PU5 0@STE DG G G lK@ ThV 00Ul t "Va VR tŸTp"p Q0l KPx "U 0S UxQ1 ,0S ,O"0 SVt  V  PU 0S0 S t\h10t"x 0P@LDTi"l0[S (!T100l Kx` \" W" p0Q"V 0SlK~ lK@ N"{0l0Kx @VT0 SS 02f 0lK2a R4P x X""KHĉP̉L Tr|] -8#0L` %^0?SaI (J (J (J (J (J (J (J (J (J (J (J (J (J (J (J (J (J (J (J (J (J (J (J (J (J (J (J (J (J (J (J (J (J (J (J (J I (J (J (J (J (J I (J I (J (J I I I I I I I I I I (J (J (J (J (J J 2P Z0010S P 21 @T 0S @Tjp1@PT 0 XPX@TX Z 001@T 0PU pjXP XPU@TZ 00Q00I2p @T 40S 0S @T@T 0S S @TZ0TpK -p LP00 X R 0S R 0SRlKKo -L,,0@ S00 Ы Ko0SS 0SSS  000Q  0Q0 0  ` 0ST 00C0H0H < P000P00KK0pKKKK- RR  RRR00Q00Q <R 0S  R 0S K p-LM0@`TP 0S@TpPP -/LM0弟,0  ?@ 0@ t2 |" 0K/KH" 2 x pB 4|20 2 ϟ? @p@嚯K`!200`d"  `` P\P 8ϟ 0S   X X #X  $0 0$0.0S 2   hb  P\P Ο0S00 X V V0P.020c RK:p VP S Z ` a Pa a b tc hd d e e = R $010!X00Sx P\P ͟0S0P0 PUf U00 UPP!UK u -00 P -U u ,00 PF u,00 @KQ PK P\P ̟ 0PS  p PU U U U P-0KT:"0R0 KBP; AT 0 !R 0(000 < H [X @X*X ?X+X !X 'Xk V"XE \X \X$X   - P\P P˟0S00  (X {XJ [000@* 00X  " b RKep P\P ʟ 0S  00   00X    20c RK<p00X  @00 00$0000K p P\P ɟ0S00 :X %X#X 2 Z 0`0 K r 2 Z 0 K    P\P ȟ0S00  P\P ȟ0S00 t (X A 2 Z 0 00 0`d K 2 Z  0 2`0c 0{ K `X2 Z 00|7 ` R< R 0S BR RB B+R ' Kf  P\P $ǟ0S00  $X "X 20c RKcpX 00\00" 00\X `X00" Z@ `@ K& \X P\P Ɵ0S00 X 005 2ş Z  0 K  P\P ş0S0P0 P(U 00 u h2 Z 0 K "`R 00$7P )K P 0@S " b RKp  00 R<4✨n0(20 00 < b K0) @# )X (X0000S0C P\P ß0S0P0 6 P)U0020c RKp/KZ V`>X<XBVPW U V00W00SZ x=)X O&X+  X"t2 ,0S x,(XT2 R P\P lŸ0S0P0 P(U  P\P Ÿ0S0P0 PU |X&UF ;X |X 1&XK;X |X0x"`ྦྷ|q0FSGLAz@T *Xl (Q dzX0A0EA0US2 " / AE'2`A2&  ]'P@ 0 0S 0S <0S 0( @ 0, <0唧 `o$poohnnoo Tp$p pKK8(AE 'P@  P0R }R\ f 300T*X 0S0 0 0U0`00C >X000 P\P 0S0P0 PX< <X>U&P 000 0x&l1E` P\P 0S0P0 P-U0 0 0&U >X00  |U00S @0<X00>X'X2 JZ H ` 00C0 K "Xy2 JZ `00 K}X]2 JZ `0 K0S a b db b b (X( "X 'X @TS2 JZ `@| K p 00000)X \X  00C000"X \X0 0C'X0000C`X  " \X P\P H0S00 6$X "X X\07/0S\X `X2 JZ ` Kr(X000 )X00CS0 P\P (0S0P0 P)U b@P aw000( `p 2 JZ ` K5\X 'X "X 0 0j2 Z   &`000 K"X \X P\P x0S00 $X "X X  \00\X `X 00` )X |X (XL 00  2 Z 00` K 0 00T}X |X (X0 00  '000 P\P  0S  [X X'00C0A p-LM0P0`0@V:`p0T:po -LM 0, !B0001 < 40 0 408 0<0 @ 80,` pcP\P 1 R0P0 PUR W U p0U <00c R<KW @P`S UU( P\P 0P 0R0 P U<K U$ <  b R1 @P<00c R( @P8 0 08 @@0 `ʤ0 00C00,Ko$pKL --hLM 00CS0< 00CS0$@@ QoHLn p-LM@@`w0DSp0P B    $ < (`8 , 0 4 p<408`\400,H p-LM0`0T- X 1 R$ R 00S  RXiz  0S 00S 0S 00 z(1  )tX0001, dP  0R@ S 00@,0c aR, ,@@D0S    $0S R;T 00S $<0 0 saono@oTpTop 0-0LPp@OP0@0l -0@L MTP@ T A,S-0<,N- 0, 000 C d@TP0H , N 0 0@o$pptpo -!MLM4ʟ` ,  PT( X8 \ d  @ 0 S\ @0S 1 !KLLl dQh S \SP p\Pc !P@3 X00 SH X\ h R$ 0 B 0d h(R`80`8 0S X\ T8Q ,0`S ,.@!P@ 8!mK `F0`F(0 i_XPX\d h(R`80 0(XePh` @Q 8 R!0AVS񟗄Pu u u u u u u u u u u u u u u u u u u u u u u u u u u u u u u v Hv u u lv u u u ?U< [U) ]U" |U )UX IyWpGY00X00S |OP X pX Y X R0!S@ R0]S@관 -RPL MP@p`R *0U5#SP QT:U0S d?S^ *S 0TQ T PE0 P0PS:< S P, 1 0TPES% ,0 S Z0@00  00\ , 0Z,0XP , 0P,Q vP@QSSڿ0CS P, 0TPES,   U0@00  00U\ , 0Z,0XQE\  D0x U ;P r, 03Pk sP, PEU0  g 0@ P ,0X , 0PGZp@-@^P`D R6 R0 ^ R 00 Q00S @^0]STp0-S0S \ Rp0 \0]S[Qp0  R   R( !^` P-L@Pp`*0S @T: `)\ 0W0|\00S V  NP``Fv관1 -LM, ,0 i?B10Q , ` P@BpU<:T P @DU 00 00 P  00 U 00 6HpG@ , 0hC1 iBS, ,`   P 060  PM 0 0     -LM@`Q 1 PU$ 0Q-P0 Q -P 000#0+P0SPU00 -P  0  0 0:U?U0r ,U00;UppWj#Uh DMPc :P. ;P, ,P# #P 1\ !000p01S 0!0 00! 001 p 10 R 00%1S00! ;Pp :P 0 00 P# 0?-00P000:S00P 0T HD0L0-SX^U0 00 Tp.<HX 0-LP0 S@5 0  0S0h0S 0\@ 'Se U 0S C  0  00SU0<0he4aP^P0Tp-/n -LMh4 4  , 00 @媑4q8 aPPP@aTX` U`V`P40cap0S0W<0 ^ ~,@\8   00@T pWP8o饑, 4 0, T < 0$p\08H -QLM@ $_Pp `PP*PU e*0S _0S0@e PbUp:0h0 -L`p PPPZ 0#S0@Pʤ@ -LM @mP 00 mP00 p-@LMTP`  TP pU NP0  P000[Ȑ`$p -`<LVM`0 0 /Q40 8 , P80 0D .Qq 00pW8p  8 R 0 S:S0 0S:S0S0g0 080YS 0/S , R 0S38 0RY 0c0 0 @ cRP @ U^ 0 SP/R/00040  N @0 bRP =^8 R00 4M0 cR@P ,&^,  P0 S/R/000.S0S/S  8 H0@-S`G /SppW @/P/R7 ^/ .^ QP R/R0 00S/S /^^  .^0/SSQ000 QP@ Q AQ0/SQ.00 /R P-Lp@` }MP0 Ulp ]T X0T L0hPӏ0P@@oDooH$p -LM@OM|0     埏00 K 0  P 0P/0000 `ࠏ$p -MLM0ܑ0c0SpP, @ PT? 0/Sb S: /"JP`dU VO V> 0/ c 0 0c RPBNK ` P@D0]@D` 3`P0`(K P/R P PP X@,0 S ,0S 0.S0.S U0u/S U0.SL`0/S < -LM@p|0`00 0,0< (p0P TP@20 P00S 0`` S`` og kp$pW@,$p -PLM`lp@82 T& V`0 0,0$ (` p ` P zkꘀ[⍎x0\ⅎ00@0P _kP PP PPPP$pL -pPLM`l@*$ T P (0S0W< 00$  `  k\l kP P PPpPPPl -L^M\pP`@)T0㠀 0WB , 0 E 00p(Ppp PPP $0BRU@Pkpl@$p 0- 0PSL@FP (oPP0 , 0, 0- 0PSL@ +P o 0P 0 P0 0-0L@P  0S0 0  00 0,Ǎ 0- L @ 0  0 0S[ :Q0a0 /Z0 P0    0h $0 0 ď -@L P 0 Sw p   0:0@ #  = S , E@0  d0d@0 0 90   0p``V  ˄Pp``V@ 90 00ꋱ0S@ ;0傱 0W$ 0  ^000@p$00 @؏ -LM @   0S9 / &:0  P J0S0 0S0:00;060 00$ 0:p  "$00  -LMP `p* V# @T T@ OZ0 `d d0V0 pX f0;p @T  -P Lp7 WpG2 @Tdp) @T!  ZP @0a@T@` ZpW00 V dP  X@9( -LM @T 0S  0C 0 P 0S < 0-L@P8 50u  0 Q)  Q000  0QS 0*A0 0 00: A0 PA 00 00Np  0S T p-LM @`A v" + 0`KS" PK  ?P P0S   ;00 $0p  $0 0\  R 0 B `0p   l P0-L@P H 0h0 -LMP `pZ XS@T 0PI T@ Y0 0 d0 `dpV&p" VQ@ [@`T`d  Pp@`TV  X 0 0f0 遯0S 0 ;0x 00$ 0X ꘐ --LM 2 -p-PQ LP@4MH`KH 0 0  @pĐ --L4M@@K0B z  -L`M0VPD ,0 < @  @T %T  R 0 B @0D  D @T0D |8 ,0S l,M@T 0DLS                                                                      @TYT A0DS 0@%0DSSk H 8 8 8 4 l 8 8 0 <0<00 <0 d0D,pK< S/ 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 Q a@ @ 1!10A00R0guT @P-0+0 0(K0gC Y @Ѫ30#0 P0S X i @ = ShC @ @0@X+YD D I0S C  0  0YpIXDD 0S C0 @0 HXʨ}D00hD0 h0S C0 @0 Xj-P+P/ P- 0P 0@0S# 0C0 00 DIYpD 0xS0S 0C0 00 D p ID 960S 0C0 00 DpID $0gX0000gQ 00SN 00!10 ! g@ \pGX0x00<0倠 8pK0<0 8 K:<0p (1Wp< .F08@K8pK,}<00@0 <0@0<0 t@Xqhnlꀠi@fd0 b 0@D@@ @0  @10@00C @0 0@`FQ@ @E CTp 0-0@ LP0 SlPl0  R0S RR 010000 oL|LL -L!PP@`p 0S 0|R0P 0 T  0e@aP00|PLL -LPP`p 0S0@0 p0T d0T 0P <T2Pg@XLL -LMp, PP0@07 T`( U FT&T &T 0PX W  0pV000 ;T`,0S U(0P @LLo p-LM@0S( 0 ER p`0P0 Q@@Q$T00 0h 00`S000 L0RP4 5*p000EPLL pnp  P 00DS h      T \ 0  0  0i 0S|  @t t ` X X T L L 30#0P ꠓxܒd `0-0L@P^$,@0h'S^$!? -LP`p@ TD 4 H   ( < L     W@ `T"T $T \$(P 0S)P$((P 0S)"p"p${P @T }@T}P(|) -- L 0 -- LP4M@@K B 0 0p -P LR`p %R s R ;0B:S | | | | | | | | | | | | | | | | | |  | | | 0 H ` | | | | | | | | | | | | | |   | | | | | | | | | | | | | | x |  p0  ;R   Z @T @DTʜ @D T  pa@p  p@P 0Sx ?dRX`X@-00dpPg 0S` -PLM`G ay p 0 S P 00P @0S`Hy@PP200P @0S`4y@PP00 P0 00000SP p-LM`P@ex phF p-LM@`P0 S` h h < <   p     0S Tdp@P0SVU@ PEP0TVU Sē 0-L0MDPK@ B 0 P@ 0 0 L     4 D \  0$(P 0S)$((P 0S)${P P P}P(| -Lp@PUjEx0@S P q q ! -PLM@ 0T0   R0 0Q [R P@Tp-0S00 0\00 Q\0[S 0S0 [S ]SQTp -LM@P0 0S00 -LM@P  0S 0=S   -1L M 5q< ,0 0 4 Y ap`VJPU 0 0 S" `VZLY4,0Q *00010 0 `40 %q0@` DA qA@,@ 0 4  xL@T   P000L@T0 4,0Q* 004 0X0@` DA pA@,@ 0 4 Y0<0 $p 0 RVCP -LM@8 $P 0 L -LM@$ P hL -LM@@P:9 9 T: T: T: : <: T: T: T: T: T: T: T: X: 0<00<00 b0 <00 <00S B>@0T <00< <040 0<0L4pP,poL p-LtMPy@P ; \; ; ; ; ; ; < << X< h< x< < < < < l= BPt^00ipXPpp@ 42 p0<0a@ "@`@0<0p0<0y}pyp0<00<0xB!0<0]pY~p<B0 ! P 0Ӫ0p p0  0 S0`P50@/SIKPKֶP0: S`pLo000<0yD0 b< @0<0knoXLP\nooL -LM@@P-D> > > > > > > > > > > > > > > > > @P000h革told0 hh*<@P po00hnHooXo -LM` p,0 :0W0 PU 0SPU 0SU 0S  o@  )0 A?U0@0 pP0@ 0 P]P [P P]P Ra -LM[@)0Sd 0  h$p -LMpP-0`KW1S} @1Sm넕 -LM Q#p롅`a0S  @T 0 S p@t 1 R Q 0T2 0T/ 0T! :P{ { yut @ XQ @ 0  0 0  R X0 Q\@XP Txeem0U -|XL0@ S4C F F F PG pC pC pC xG G \K 8h0Sr P0^@0[P\ XpR 0ǟS7 S 00BS7 0GSWW0 iP@D C PD C p7 R cQsQ CQ  P  700BP@D D PD XD 6 R6  00P0S P 6  B P00 P``V10@<&SL00@``0  6p@p P 0 Sx @ @0 @&+   5/T ` `  P{ p%0 0  R8% 01000C0E0 %0@00};10@S0 D0 0$0@0T0 $00v 0rp$0 0  R$LQl4h4   PY 0 $000 w($0  #0 00 B3  7 P00 PppWP  0P``V @T 3 DTS @ 0 0b 0  00 m@0P 0PV 3'QP  2H 2 RD 0 0S: 0M  0 0-0 @0 TT 0 0S 0^  0(" 0@$ 0 0 0 00  0R 0 @ꠡ괁1`V P q0@0  R`Fp1XV P q0@0  R`F PPEU q@L 0PE0`U 0 ` 0 0` 0? 0@T 0 R`@0 p0 l( 0&00_ee MPeTeL@]0UMDrdMM`rmD]LoXe p-|0LM@`@P፰\\0P P0D D0< <0@#phe@]e<]eeee8]P0 0 .PP `r p-xLM P00PPPU@C H4 R < P ,ğ0S0C00@0 00C 00  c 5= 3 ppß0 Q #0S0C000C0  0P0 0 ӷ0C 0 p0P 0P 4#0SP(3PT-N O O O O N N O O N N O O N O O O O O O O O O O O O O O pp2 S p2! RHR0 0CR0$b 82Q@  0 @00 R 1 0 S0 00  c< 00 0 0St1 `P`1   \\!0a00cSsS CS41@ ph`0 RA 0@  l l<0 0d c 00dR0c00P@$h@0S\0PpH0P0  cH<0  A Pme0U@]p4U8]<]o8UPeTe -LMPP`0  @P0 04? R 0LyS{4U @T S S 0T S S S S ] S ^ S S S S S S S T S S XT S S S S S S S dT S S S S S S T ] S ^ S T S S S S S S S S S S S S S 4U S HU hU V S V W S S HW S W S S S S ,^ S W S PX |X S X S S Y tY S S @T S S [ S p] S |Y |Y S S ] S (Z ] ^ S S ,^ S 4^ S ^ 8_ S _ _ S d` |Y S S S S ` -0S= R 0R0B00\=! R  04=" M  ⚁P 000k ,000,0 P 0?PPPlNS|P%< OP@,00X @< T \,0S000@L0  , i0PPS 0 ؋P 3$P 0S  0R '@Q0 0cc ci  pD700@Q@@@pp` 378i @;+;@@@;  :@G: +:*@@ *@8J0 0 @0S0C0)UP d:P*00ePc(j@ErP00 *, :ɟ9@@: @P9)i9@ HPPEU@T 9 0S0C0U X9<9<)0)0xY 4@0 Z9(8(XP HP0 0H0Sڈ8x(l8UPe0e, 00e0Th0 RV 0   QPc\' 00^P@0@%SP@c\Uy\ 0Pc\q7l'h7H7g0WSwS0 q@70  00S0GN q00  RcRP 0 @ P㾬PGUFN @P t r0 0  R= P; Q @P6L%5 0R00 Q q00  R PP ?P  0S0C03PPU0 Q q00  R ^^$ PUD! R r0 0  R PQ q0 0  R PP PUP @84$4$ 0#S0 00Ue3P_CcP  00 {CceP  eh#t3弣\#T3 0dcS000P PPEU eX 0Sg 2"2\ 0 0SXP0  Pֵ 000C] -2 R@ \2H"D2@@ 0Qp"`05X  ' U 1 R1! 0b0P0U1! 1P%@$0 0P 0000RA 0S 01 !1 0QP`!0T00 R U@`p开P0 |0  0  R4 0P0Q 00 00CQ00P000`reeoD]leeXeeetoooĬHeH]L4UPeTe0Uq00  R 0P0QP HX@ 000 7  0 0 0 00P7 Pb 0P0 P00S@K -LP0Lp`tS񟗀g (e (e (e (e (e (e (e (e (e (e (e (e (e (e (e (e (e (e (e (e (e (e (e g (e (e (e 0e @e (e (e (e (e (e (e f (e (e (e e (e (e (e (e (e (e (e (e (e (e f (e (e (e (e (e (e tf (e (e f h (e (e (e (e (e (e (e (e (e (e (e (e (e h (e (e f (e (e (e (e (e (e g (e (e (e d (e (e lg h (e g (e (e (e g (e (e (e (e (e (e (e h (e (e 4h (e (e (e (e dh R3 Q PP3 P@0P 0U0P`P 0U V P 0U0 P@ pHXWVPPUZP P FP00fP``aP@@P2,R@$0 PPWT R2 Q CR!0 0SgWP 1 PR!0 0SdlP 0CUx0 q00  RPlR !0 0SeRࠟؠ0 RZ 0PSTZR㬠0  RK QE 0PUP@hh0 sRD 0 0S3-0 PPPUPE%0UhLe p-PLM@@lPl` R  XP0@D S<0 0S0C000pp`@]e8U0U-n$0 Q 096HeH]0U[P(P)P{P]P}P 0-4@4P0L 60 0 00Uem, ,000 0 50Ume p-\`LM@HdPDd %20 0 po 0-@P L2 0 00h 0- P@LTd0hPdo -LtQM0l!d1d `1`@$K@` ```@ ``( 0 Q C$0 P0b!0 !0lq00 c`R 00CR@ 0@0C 0c0 c 6 6 0 0bd 0C0\0T0T P0pU0UT4U\eeeeeeoeeeme p-QLM@PpR `0 Q 0Q 0  ,5 000ppD`  0S0 c5 00 00U p-LM@`@P 0S d 5 0 e0b 0p0Up@-P @Q` L| T  0P 0 QL|VT @pppPZ0UE-@A`0 P.`Fv+ Qp0 0  00  0P0 q00  R 0 PP0`Fvq00  R0 0 q00  R0 P0UTp@- AP0P+PEu( p@P$0 r0 0  RP 00 ` PJ 00 PPEuPJ0 0 |0 0 Q 0UTpG-$P0 P1PEu. p`BP 0 r0 0  R 0LP0@ 0  P0 0@PPEu P0 0 q00  R 0UTpA-@P0 P)PEu`p# r0 0  R0 P0T q00  R 0 PPPEu0U0@-@0P%@Dt" PP J0 r0 0  RTP 0 r00 Q@ P@Dt00UE-Ԁ@ 00CP-@Dt* p`P 0 r0 0  R 0APXP P 0 q00  R @P@Dt0U Q-LP@,0 Q()0P!`V Ttp@! 0P0C 0 3 ,0P坩ee0Uܕ -PLM @`; 00CQU5 0U@@A^S`00 PpXץҥ`P@ 0P0C 0 2 00TU (Pe0Ue -l0LM` `0@  4T 2404 00  x xeeeeee 0-PT0P0L@@P8P 00` r00c00%eee 0-pPL0 0S0R@@0 P0 0B0@ T0Ue -LM̠0@ `T,@ Ppᨐ0 g?R,`,@ 0p0@ PT0 h?R0` 0 0 `?R`0Ue -0LM P@0 s0 -L M0, p^P"0p @7 0^40U0 ^00S00,0 0 P 0W PPĄ^00 pW@0 0Ĵp02 0^U Ÿ000C,0 0W 0!^0  ^!00,0 0W000   0pW 00PPEu`p @ 0 PER` \0 S S v000u@p 0 00S  R+@S<@P0S 0 1v@000,0S o"0Q @>@h0 Ru M00 pW-00Ĵp k  0pWure0Ueeeo p-LM`@PT# 0dR 0@P0@pv0S0C0 vt 0S00v0S00<0 P bPuv0S00ee -PLMpA0S_ PWa$K@0 (K,K @yPPB H1($01 $0T00 (0@cT  R 0000 0 0@@,0,0 +{0S @TYP p300(Q 0pppM0UeeeTee(m L -PL$M@`P㼒 r0S㨒 T0S PV0 ,K0K4K8@K @0yPs Ve `FVV80S940qI`@M,03,0!0zP00SP 1T0 S/R  P4y|1|!x1l1l!@@4@Py1UpU 4@y02P PU48 ^v4fy540P``p;yx0 @ x00qQk D0@@ P[  00Mp0U(m LeeeeTe -L$MK0 K @KK @xP@ vy6 0 RPPo -T0LM @R 8 TT^htt@@$t@o0P00 ͽepe -Ltht -LM,@0(S]0000eo -LMp@PZ` !bdp s1 @bTQl@0S.S p10  00SS ! \0 B2?@1cS@`F0S.S.Q WV$` p $K%P 0P00P p0  00S 00Aq'BQ`U@0Q qd00 @ 00S 0S .t gfff -0L  Ⱦ}, -LF -GML M<2 88@Pp`, $"cp fPp` iPp` 1 @bTQo:*1IKaAAPp4: S Tc녾iBKHH+ P: Lf8d0Y/S/00@Tt p/P`` 0SP :0/S$ V:0/S `FV:0/S`90 SR0@T4 P  ,.P40`FV:0/S vv cv -LjM M(kKH0 H`p,0 BP;2Q 7P2 R2 RVᡆP,0 S ,*Ӏ0S  |ل6: S" KA ABP L6: S ?P $6: S V /MK@D @D&P1RuK@PKP$R7P KA AP]NK@D @DLA D>= P@n=1( K ! Q@10 `E P00CS00Ӥ0 Pp @00CS00Ӥ0 PpyZYZf`E7PRL 8 vvv4<L\pM.,8[|" -0L$M@  H0 < H@PPD@ <_@- Pp ePbt0Sp h ᐢ@T SP 4@@nP<<@a<D0SFHP=00LጀP)$, 1ϠA/ 0(@@lN#b8K@80 4 0@ , Z-Pt<P @@廃<1P$<岃@孃0-S @奃L0S @坃H@@ 0 R@參@勃0;0<`H0P0JPrzkH D a@p}vvMbvȖܖ -LM0 4 P; ,K 㔂p# ,0.#4 P ,K あp ,0 #4 PPlx,l@ll 00廀\!8,$@4,4 00媀  Ll(btx 0-,@,PL $    }, -LM@P 0DP 0-@LPU 0S1P000 -LM0@S hp@-0PS00p-\@@T \ P`r00 P 0 R0ATap -LM0@SK P  00 -LM@08SK  !p 00  O`  0-0PSL@0S00 RP0P 0S 0- L0@T  0P0Q 0S =S Qh0 `0 00S<Q  !Q >Q  P4P evvvȗ -L5ؗ 0-XPL0S S 0@ S0 00vv -LOM\0X,0 0P S ,0 S ,,)OKKK`VT oQP W?K+TwPW?K \!QH1SD1 L1@[0P S Tb818S <{/ 4v. -Lp`@T TT#6P0S! P T0  0S T (@T TT (]4v -Lp`PU U @0S P U0 0 00b0bPU U +4v -L MP`p@T T T TT T$KPKP@ (KFP; 0D Sꤚ p Ԛ $ (0Rpp`$ (0Rpp$ (0Rpp$ (0pRp$ (0Rpp$ (0RppGE0D Sꌛ p ԛ )Pppý)Ppp ))pPp)PppӤ(pv p-LM^`P0S p.T@0S 0S uP0S v p-LM``@0S pP0S {@0S tv 0-@LP|UTp0 \0@ R0S<i6|SPP.vv|]d -@L8Mp` M\l2` N\X2@ L")^p5&LKTpK`H P K0T L` {(P@P00P0 孾PP2 P 9*0H P0 T @@^(P |'M<K %P800 pS080 80W@:0T@Z >\)<\00S#\! D`K 0  \C0[SD[0 CR 0R P 00xNl~0 pW@X D00CS00  ä0 N|>(0Hp -0L 7o}, p-0LAM @P` v]p sP` /0 @bTQ!P <PpCGOKPP V{.6PP{L -0L }, -LMnQ@0,T  hoz00000 0 000ᄢ  -LM0p (0 dP@/UoKK/ZPKU  S?K\ k0SKK,L1 H1 D1 @1 <1 81 41 01 ),KeL0=# MX7(0 S ( -LaMb>K0C 0Cp( @Pv$6: Sg  SPW(0 S (KBnK`F`F|!|1(b0S^@aDPP$[NK@D@D  AP62W>C R0 RW W6/~ z0S )@PPW d~BnK`F`F+M0)0KW IuedA@ -LM@X 0s ]]]T06at -SL Mp@Py00!1/P`!  SVx y0S@ 0P' P* <W@y?00 \@a` X0P' P* "W@y?00 .vuu\ -LM@ K K 0K @@&P -LM8 < @ P`pm 4K=P@h 4 0R SB  P`Z 4 "40@#[P0PS ,KL PP 0 P@ U10 v |PP 00S0 K^P 0 R ;;S fPP 8@P ZPP 0< @0T NPP#V h ut| -ML M0$ , p P`:x?000!1 ,0S ,AP@ KP 0 4P x0S08x0S !0BKHH F!0@CcPP- ᎛0@S" 0S 0S+ 00L \ 0$ 0:ex?000, 0jc$hșH aܙ -L`S$Mp0K,  Q Qq00  Rp0+S-S-S +S 0+S-S QN QLq<30  00S.^A0.S7 Z0PC Z04 "O1@K00K @0KD@H L P K 00K\ 10(O @/w "00Z w 0V 40OSl,0`( &"0K`PP, P0 Q!000ӑP PUw"00 P pL1  0P81@@K1`E% 80 ,,8 p0@0KX0 4 Wq0K J40K5 B"0@Z$$ `JPU *0 K0 ZP00KU:@ K00K ,@ {V`})V` -L00K,M,P0K?Op#$pW4 @@K0 PX @P Oß$ 4Be!5P[ 00Sw"0 0 /";0@@De#%P[0SY8<!!O1@K0@ oP P`O$  !5;B S<0 8 N 0,E @,P00Q 8 0,Puڼ!@@PK0 4K !0% 0d|8^,Q@00 K00cPE: UcU pP/z{{H>D>qgfffQ p-PLM@`PC ph10  00S H100PC r0 0  R1.\P' *\\ 0SU 0B8 S('08C?PPPڌ@PEUp pT00  0<0S000PC r0 0  RL>N> -LMp`#0P@ r c\P \0 P@ -"P@2L MR0@K0 p` UsLz\Ō\pG   a 0a>Ìp4G6pGƃ??p`F R bЮ?Ф@A P 00Q00S Q b`.^L2a?@ C_`0 `Px 0 aP0x0Ńƌz(p , 0 KV10U0 0 P@0 0 0 ? -L Mp`@P@<K4K0H0S񟗦t  ( H 8 `  \  8 ( \ H L d ( < t  H 0 t  ( H 8 `  \  8 ( \ H L d ( < t  H 0 8D3#cX Q0@ 0 KD0  DK5P0S Pq!000PKp qDEq!00CP3L#cX Q0@ 0 KD0  DKP0S +q!00 ND"q!002cX" 00D0 ?0PKQ@  DKP0S q!00h )Dp!00ŸH2D"cX 0QD0 @ 0 KH0S DKPp"00p"0020K00!1cX! 0QD0 @ >0PKA0S DKPpp"00lp"00ht10 KdQ814!cX 0QD0 @ 0 K(0S DK|PLp"00Hp"00D00K000 0cX @ 0Q@D0 00K DK\P,zp"00(vp"00$GĚ̚Ԛ (08<@TX\p@@@0D cX 0QD0 @ <O0 KX@0S DKPx0 R 6p!00 YC-p!000g00KP0 cX 0QD0 @ O0 KA0S DKP01 R p!00l +Co!00x1900KQ1!cX 0QD0 @ kO0 KA0S DKP1 R o!00 Bo!0002 00KDR\2`"cX 0QD0 @ O0 KB0S DKPb2 R o!00Z Bo!00Q2ݫ00KR2#cX 0QD0 @ O0 K8C0S DKdP4X3 R ~o!00, Buo!00#3诫00KS3#cX 0QD0 @ 0 K`C0S DK6P@3 R Po!00 sBGo!002聫00KR2"cX 0QD0 @ 0 K0S DKP&o"00"o"00d20K00T"2cX" 0QD0 @ ?0PKB0S DKP1 R n!00 !Bn!0010 KQt1p!cX 0QD0 @ 0 KdA0S DKPD1 R n!00 An"00v000KP0 cX 0QD0 @ 0 K@0S DKPY0 R n!00QL An!00HD0Ԫ00KpЛ @8@?G?m!00 a@5m!00?0PKh2d"cX 0QD0 @ / @Pځ?0KtB0S DKPm"00 m"00o?Ÿg/ 0 P0 K05P@Q1!cX 0QD0 @ K0 K0S DKP1 R l!00 ?l!00{S?0PK,0 cX 0QD0 @ 0KP0S DKPa0 R l!00Yp ?l!00P 0@K GD@8`Ȝ$<T\d@x8<$@h0l cX Q4O0@ 0 KD0  DK?P0S Zl!00 }?Ql!00@0 cX QO0@ 0 KD0  DKP0S 7l!00H Z?.l!00 >xk"00&D4$cX Q0@ 0 KD0  DKCP0S ^k"00 @ >  }>Qk"004C3"cX Q0@ 0 KD0  DKP0S 7k"00@ Z> V>*k"00Bl2h"cX Q 0@ 0 KD0  DKP0S k"00@ 3> />k"00A1!cX Qi0@ 0 KD0  DKP0S j"00@ >L >j"00`AD1@!cX QB0@ 0 KD0  DKPw0S j"00p@ = =j"00c0 0cX 0QD0 @ @00K0@0S DK|PLj"00Hj"00DD00 KTX@8@G?$P80< cX 0QD0 @ DO0 K`0S DKBP0 R \j!00  =Sj!0000K000 0cX qQ00KD0 @  O 0@K DKP3j!00p-`P@0!@`Pp -P@E:::LCLM/\p, J\!h1S   00 \ 8AS, 0110 p0 0 10 46@ d,0 "&`'@0@p 00 `P@0,!O3\ \0 uL03  1S@ԝRp@- b@0`P \02l`1^1b\@0pRp@- b@0`P \02loQ^Qb\@0pQP:  -P@L1h Q\ Np`'T<  0 p`@A 0-L LP@^\4 *0%0A -LMO@i0S  0-H LP@K0S0hOp0 -LP@,M⌥0KQ0 @ ,@ WSO@S`8 RPRI*R4%0 0 0 s 8 0b038 b&xO@[(8!8HT*@@*TI2@0@b8PD8@8#8XU*P@*U@2 ȀP 0&@-O@d4xB 02d @-M0Ѝ@4=> 0 5 -L MQ@0K00#  0 0T0P00S00#0 -LM K K!P -LM K K!P -L 0KM#*$ -@@L0MP0  0 L0  00S00 K( KGP(b00P> -LM`Rp @t%  P`F @pT`P0AS Q)0 0  00    p-LM @0`SPR0 S ࠹   0100p 0S Q0 S  0S0 .R@- P@0@ .\Q00Q0S@@ 0S0 .R𠁢Q00á? P   $ , 4 < D L T \ d  plhd`\XTPLHD@<88Pl؟<d 0- LM@P K0  0 p0*Q@-@Q*\?\ [\#\ q 30  00S+.10#0 \00S#10#0 \00S.20#0 \00S  \  0LS00S qX2  00S \\ 00@M \ J | | | | | |  , < L \ l | | | | | | | | | | | | | | | | | | L \00n  0000D0\  S00000\00a \00b \00t \00v \00f \00r  R   ?\*\ #\[\ 0 \ #3 00000 00@\00M0 0qL00  0 0S-00 ^0\0?0@0\00s  p-LM@QP`0 f0p0  Q -LMP4 Q @pB8 | Pz*QP*Q?Q [Q#Q p10  00S+'10#0 Q00S#10#0 Q00S'20#0 Q00S : Q  0AS00Sp1  00S( \Q PQ T:`4P00 V Q 0K0  jQ@80c@ T4:@D`0K0  j` VPE  @` -@TL P`p T0g0 0l 0 e@DT * -ML M<$08,0  ,PP^ 'P@cBnK`F`F sP 0#S   P< qP  kP33p 0PP( BNK@D @D 44S ?R0Sp  iPP  44S ?R0SpO/2 ,0S ,>BnK`F`F B`rP 0#S \ 7L 28 -P  $PP' BNK@D @D 44S ?R0Sp  PP  44S ?R0Sp BNK@D@D +< PP A0S  PP0SU|0S  0S  0Sp 0ST P@008  @  o:f`kc -40L R4P P00 0-LP$P P$@ \P00 0-LPP P$@ GP00 -LtM@0SK k0錀P H K 0S x0L: S< ]O00]0P04  -LM@0S00 -h0L,M80 \0 00 T0@4 , (0 $@ 00 8K 0  #鴠48 4P0@-@P  0S ^ 0S^0 @0S SS00@00P0!* -QLM@,0 pR ;P4 i 000 h 0p` V Vᘦ%j:$,0P  0\0 p` V000S00 YB080 4 0\08 0\0I` Vp Vᘦ%.:"0\0p` V?`Wpᘦ%$ 4,0P 0\04 0\0Y4 @,0PP`@,0PP`\0 0** --L]M qPM?KC/`KK \1 4Q 0Q .  =K0K0㑟0S cK|1 1  x p@ 1P|ޟP 0S L |1S00\ 00꟟0|1 B 3*y0* -4LMQ<@ 8#8Q8:0Q 4 %*0 0K Ġ̌.Č#̌ !o Q *v* -LMP -LMl"  2 ,  " !H p ]0P2 0PP 0SC P P 0S  $481!`)!<[0`X0 `-0ᕯKS/K ڜ1S9 @T  0(KQ QMK0SMKP"3@(K0SS SQ  . .OK @D. |}P-?(K R!  q}0S -?(K R2S "RםK d{K\ǝZ0 4  MK0iPMK* P+ 1dMK  PZ ib Z0S }Z L[* 41`BnZtLD - hbZ0#S ^Zd < R@]K 0@,q"|@B"2@@P 0S"2P0lx,Dm` ,Xl.Р8 -L,Mp`@ KD0K< 8 @ 4 0 , ( $ ҤPDP@  0`4PP @TD}Dy鴴 -LMp@P `p08K8 (P , 4` p7K0 8K (0S ( -MLM Z,   4 `a V $ 0P@Q X1X1 - Q#Pp' B^KPEPE0$!@|ÿ`|V INK@D@D~P 4: S  R 0 0 ,0S ,嵡aPt $R 0R\ 4 L 8凿` T>4@Xl -LMh@pP` 04K4 $@ ( 0P `3K, 4pK $0S $n -LEM@pKK, 4! <K081 P@  #R 00T-* R+ R) R' r0 0  R r0 0  R0 Qh#0000ӑ000\*0 S S S0\*0 S S 3000 \ *0 S S\*0 S S  \* 0 S S S R r0 0  R> \*00 S S SP\P 0S ``Pz0+Sd -S D 4zP0+S0 -S PPUb ?? UP[|,0 S t,宠0S @S P K?KN)`0S @S K?K@)0SP @S  4.P`8~ 81S  K?K() 4t8 0SP @S 8~ 81S  K?K) 4\8  -LM8KKPp <, PP `P@ ,0 S ,4P/K%>KH D LB @B Ȣ -LM✑圁`KK <, ````p@\PPB <PPOP@EP/K%>KH L @B ll -LM젟OKpP <, P  B0S`& U0S,0 S p,vKK,0 P @0S  \%0 0 L p-LM@^P`   ^ 0l (P030#?p00SU?P ph00Sx -LM` 0p@᡺ȺPP0SX P @TP@ - L00S8H p-LMPK@AP`P R 0S Q@`㕿U`p0UQ  p -L0M`Q<#p %PP P cP 00T0K 1P P@T P8P8P Pxb(PuHqP$lP /0S$" ZP 00 40 100 4K0, (0 \WU 0 &P@1   P@  З0PPS@` `#XP 0ST/ZP0 !00 000/ZP  0 @0 LK0L H D < 80 T 0PuUTp;cPJ @$`p|̰ȣ,   0-L M4PKP@ 0S`0P00 e0! 004 0 $@K0 ,0 ( pB8P0P001Ԥ< 06U -LBMP0J_K@,(0 TF Tp0= 0@_'P`20#$0$ 0Q UP(0 S (vT00S00@p@ "48<#80T.00p0 -PLM0 KK0 00   0-LPS0 0p@ @ TPtT0S0S 0 x=k*ih*0 S-`L hTS00:W*)T* -0L MK, K 0 0 0 P 0S$00$0 $S8* -LM KPwt@ 0-LM0P [[@[0[ P@0H -PLM@  Th7WS/00h -L M⠠p@P8`K0 (P PptP030#P0S  [ (0S $(~'S00 , -LdM0p ,  |0 x0 t0 p0 l0 h0 d0 `0 @`P|K 0D0c!1@#T!pP@1SuP``@Tu w Vpw Xp.K\0K S\`K@*wB T@0T=T4 V0#03@T00Sw 0S 0 S*\ K0b@S@\K L1 ,0S 8,R00 R*:00` R:0305`1:T  R*:00`T Pf1 PP`WX Xh h0R f P z`uw w VpPo80 * P0-L@ 0S0. @ 0U0 CR0S/S& R R0R/S AQ0Q/S0aP U*h@ w00&R@?00/Q,0 @  BR0/S Z 4b14c021b!*9  0*"*j*'*+*** -L(M00K/0[0 [.[-[$(,<4&[%[L<,[+@[*P[)`[(p['[!4Č"< " D.l* -p-LMPU/ @0  0P0S0c 0`PU 00 00p@ K$ K(0K ( P @ P&P$00P 0 }`\$7#*8 * * -LM^8K- 7<K@ K0 <0 Rp` P" 1P-DK@ T `@K vD@K  @K0 8Ky 묦@=*** p-LM@PP! `@0  Q,00R0  0S 00S0 ^ @ 00p鼦 -QL0 M4 0 0Z000(K00) TPP9 0 P0S pЀ`@ 0S@ ` P p WW0S 4 R 4 000Z0 000S40S 040F*C* -LM`t:PPdq 0SL0HH!pP0P00@(K YP(0 R 0SMR- $GR R !@Qʑ T!ppx!KRdpKXpAkR gRmR,pFl.`0Pd%*** -LM<`p@P0$ P@ Pp?(x -LM@` q00  R@P pK ٷ P00\0SP:Q UqD0  00S0SPU@  -L0St -ML M0CKJp`@P J! ,p P`@ P ` ޵PE~KpG`pGf P\ \ 0 S RL\  \*B^KPEPE \4  BNK\4@D@D<0S J "00V:`P@ `8%0==0` 0ɍ @ a0AS"c c c c c c c c c c c c c c c c c c c c g @0>0@0 @ C. @ @00p+WP -W=W@0D =W << D @0 0X0C S񟗖d f f f f f f f f f f f f f f e f f f f f f f e f f d d d e f g g IPI< @\  @ R  @0<@0 X V:H   ₑ H lP@N  j 0`@C80@ `< D0R0+W00=WSD  V:H   ₑ H FP@(  j 0`@C8@ <0X~ `< V:H0 0⃑ H0 +P@  j 0`@C8@ 0c` &XD =WRD0=W0VD0 :H ⌑ H P@  j 0`@C80@ =`< R V:H0 0qH0 P@  j0`@C8<0X@ !`0S ,S 00 Y ꒀ;I9 ឌI 0@'͌@ I @-gQ@ =Q +Q -Q \ XQ0R0- 0+oQ uQ\00@ ! 0 00 0 +^00 -^00 =^000 0@-P 0+S -SXS S5 0+S -SXS @ 0-S" +S XS00 T-00@P^+00P\ X00P0  @0  @0!* --LM p-P0LM@`P8 4T  4m }, - 0p@L` GPP0S @TP@ -L 0Sx\> 0-0@SPL((ٮ 00 00  0-0PS@L喋PP咋 PP0P -LM0`Sp (KWPP (QC 0#S@ S> 0 S RA(  #P0e(0 (⌋P@} ( (0PPP@ P0 S S0 S S  P0P0,K ,0S ?R0Sp0PB U 0@S  R00 RZ@ T 0S 000 ! BX @̯P@ (PP 000  bG0@NG0@00㮊P0 P 0V \>0\> -L>0S\>\_*;\* -LM,4C8̓ <.K #h, ?KKK@D3 0# p @ p> -p`LFPP wP @P oP 0S0S p> 0-@P@0LS00f$ 0000ᕫ0 Ьp> -LM(@0S0 G000p> -LM0St (K Q@`Tg ( 0 S RL0L(  S *5(0#` @Rq PU`@0S0T`Å᪬PP `0 S S0 S S ᛬P@00TP@ 0U ` 0S  R00 R@@TP U 0S |00x0V:\nPP 00PP@Ņ,,ǪP048HМЬ @-Mp` @0\@X\x\@ Q $Qq0 0  R#0C'  Q .Q0V42:ЍQ q00  00S 0gC R17 1RTq00 D R q0 0   Ra0LA0L** -PLM`p D000@,K0K 0 , ( @@p0 WV0000ɆPP0  0 @@p  C0@C0@* 0-! L0TTc!P@CT @@ T 0C0 0ܜԜ -LMp`PB@匀T ^=0S0d0 @ȥX00U@ <:((%""C؜ܜ -LM@(@T0 @ ؜   B00! RA R0000000000000000Z* * ?0-1pQ LR@` 0S 4P @@ CZ0@< H0k000S@x ?0-1pQ LR@` 0S P @@ Z0@< 0 000S@x 0-LM 0x`r.0l@hZPTUX0 RP 0 PP@ D0TL,(P p-LM@hP`3\ 0 @4)Tp`0@ RLd 0-@LP 00,@r.0  0hTL,( -rSLM"0@P` :\Bp 0P QB0pLB p-LM@hP`M \0 @4Tp`0@ RmLd 0-@LP 00,@r.0  0hTL,( -rSLM"0@P` :Bp 0P A0pA p-LM\@0PSP`PP \@0PPPpPpPl h 0-LP(bP0@P @[0Ld p-LMDP0@S8`p$0P@@@깄Plh -@LM5h2L -LTMF\` \ , d h g l 2%0S U@T %0S :Sd P0@T @T@KD\d QR dPPDDDPP XK 5X0S p00R0Sd@\T00Q00S ` PT0PS l  R T@0,S SS S UP0T0 UP004D,0 S 0,jUT@PPh@T P@K0h LK@&Ph Uh  LpLP Lyh00fs`V tCDK0\HK P@KLK @zPULD0LP 0H3LK2 P@K@P`֤P: h0S@- ƒh@ )R P  T P@ 00CS0 0Ӥ0 P p )0+S:P P P ㅤP TKC\ d0@RSA00~h PlP \QP!00 DQ0SG d0S7 d,0d LKP@K@sPPP L<LWP0T@KPT sCoCkCPP d@T XK X 0SpR`@@K` `0Q&H0 /Php ltPx]*x*$* -LMğ !  \ ,    !4@R@ `h4@K K 0  K K ,K  K K K K KV0 \0 x X0 T0 P0 H0 D0 @0 <0 80 40 00 L 0 0 |0 t0 p0 l0 h0 d0 `0 \  !@0pCⅠK  &bPP.0[  R) R' T*00K[p20  00S  Q"0000ӑ0K[ Q"0000ӑ0K[00W?L0@X XKK, }PGK K K K ~K zK vK rK nK jV0S x!@l0S3 0CS/?u@41 ,0S 4,^ KOp>0S   WKP7KXKL00L0 60[S0X K60K#:>00Hfp`> 0< 8 0x0 -L0Mp0P 0 `@ LKL@KD00D0 Q Q >00 0 S 8 ݆, Qt,t,t,: Sb0 d Sc0 ] Sp0?0 0r0-00w0-00!=@SL CS-0> X! r0-0 0w0-0R00 &R-0! !r0-0 0w0-0R0 R-0 00 0 R 0Rt0T0x00 R 0Rs0S0x00 S ! Ss0S0x0 Sd0 Sl0  S-0 Ss0d*K**%*o* *R0S 0S0S0  R00 -MLM00  0PP `P@T T 0T,S 0S P rr  0PU  0PP  0PPPt p-LMP0 S0 `@0 P P0Syr0X S0L@0Sp00hr er br$(` -L MpȀ@0`SP(@ &\0  7P 10$ KvP(KF4P  (,D0  $*r|$`|ts(ܭL@-0S@ @ 0 0 0 ( -LM`Q ^( @`p$ 4 0PB ( K10"P; (P6V00T00S(0V0T00SW ̘P P0 $&@6$ 02P $ 03q$Kⶒ`|ts --LM -L@`p.`0 XXPbT  8R8 $0Ey  Qk},i --L 0-<0@ PL,,8T R 0h}, 0-0L@P 0S&P0 CR 0P0 00R P". 0 0 -L M, ,P0 `@ t00  R-T0@40  +T4 @VV0TP V0T ``|hp$t0 0Q0@Dt0 0Q t0 0Q7 DW D@T\ W00 T00SG' -p"00@40S\00pgS \,00E0XSxS@`P -PL4MPL p` 0 S@P X 0 S @P L0@KᲶP\!H0KQ, < 8 4 0 p4@HP D `` @0)Sn6 0  ./ }+0U# >E0CS <0pCaH0S  j H N a 0H0 L0U 0R*0 0\){} 0-@PL0\*ql0  0!0S T000@CT00^00S 0 u -LP0SPp:qP`\&*0^S00p\*0]S -S \0* ]R S*-R P0]S-Rx \*0]S :0SS 0 0@SJ0  t0`2  00SH@TZ 0S?W"  0SJ 0 @@000l 0\0Z 0  00 0 B 0SP  h hb  P  000  00 -00-0 -  Pz00 -00-0 -  h00 ]00]0 ] h P & P0S1*8  P+ 8000 -@PP050#-SL [S0 :Sa =S1  pR*0-S `WW  0 00 \  X\*0]S -P0`0 `0S0%*00-S]S P*0S*0=S .0]S00$P*0S0"*00-S]S 'P *0S*0:S 0]SP*0S05l:o h -LM @$Ap\ *P q00  R@ `ePi P0S PP PP  000   PP0S ?0PS, -LM@=>0 00  0- LR@%*0S*0[S 0 0.Q00PQ*0S*0.S [00]S00Q R* -PL@  R)* P*0PS 0]Sp`ePV , rP0 R 0Spx0   0 R PX 00p , 00  RP  p-LM0K KP` 0 ]0@K0K KhP`p -0L `@8pP Put00  00S P h ]0S04  4  p-LM0K KP` 0 ^00K K]0 @0K K$P`p -LMP`@p0SGT1 T00W0 W00Si $ $ $ t t t t t H t t t t t t ` f 00   f  f5"  A,  i f0   f  f"  A    @`pG f 0  f  @D @D`q0 S d -LM P p0 0@W` 1R VNg@0S P0 Dg0S 0S @`P  R Ϡ>1*!">00c # Ϡ j @ tgP@ 0^?>1  ^06g0@WgP@ 0@0'gp@-0`@  ^R *0 00  n^ :0E\  00C 0p -L M, p0 0 S@"* 00T0R00S P*`P0 00 R0#S P: P @ T:`@ T*,,0p-0 R*0 R:@-0@P*0  \: -LM@`p嗼0 00R0XfPU@  P g i霹 0S  Pi}ff- 00/>\ 0S0\ 0@- 00>Q\@ 0R0\00 -0LS8p`0S PU`P 40PU040@0 S @TP -`RL@PpR 0!A000 p-LM0@S`P 0\ 0  !p/ p-LM`\P p@  A 0S0 0H0SHP Z  e! B 0A0S 1>3 01 0-0@SLP0 e0S @ 00h 0-0P0@L e0S 0 0 00 0- LR@00>#R0 (R" R @0Q@PR@P05eP< @Q >3SAQ 00@0QLR RRL>31>#R R "RR R(00(000S0 0>3S S S\(00(0 P L -LM 0R  @T p0R000PP P<PheeeddeE -LuMp0 (, 1 dP`` dPPR 0@x1 0$P}K@{K 0 oK. ́ ȑ q 励uK %P? 1 p~dP@ oK 0 ,0S ,i0 ]10Sdd H0 @Jd 0A?,  -LbM⸠0JK(0 p @)@KkpcZ_K`\!P TjKjK11 P 0S(0 S (i, -$0L!00  -LMp(̷ -L MR, 00 p[ Fp} P,0w,0 +Rr -Rp-S+S؅, 0 , S00 0R%00%0000S0 RR`5 \ Le: !T5 -Q* D%<5  Ep00 Uq 0 0 a0b 0 000000! 0S,P tT0s `$0s00T4 0S @0-S 0Q# 4 1P -Q  -Q3   :Q ,P ,0 0p@ 30#0P@:T0 -T ,ȴP} 0WT00Q00S 0;SK 0:S #0 R00 02"00 ŸR0:S" 00 S012"2Q  ,0:S x",@0:S:?00D"<0 0 P1 -Q 10 R00 S0101! Q , 0:S !,@0 ,0 0@o-TT0 R H1 R , 0:S 4$1?@0 R0000SZ0S'@0 0q0  0 0 a0b0000d@h d0qTP0 @P0s0p@P{>|>. -LM 0V -L M@@L -L M@@BX*tU*R*PO*L*I*3F* P-L h/00 -PL`0\p \=|# 0 0  R3 @ 勳h P1@rT%0\ \|h3  00SWpG3 /\00\0S@.\ \|3  00S;0 0/\@- \ V t0j T ڊ>j1!W pG T (00 0S @S@S@@@0j!T@QQ10  00S V؁P@ h P1@0\ \|1  00S\ Tڹ`\!\1g0XSxSQQNq$10  0D0SE W0P 0\6 \4|00  0D0S+ |  0 0  R \ 00ӑ@ ṲdP`a\ h000X0 WpGk 0002XpGHht@T -LM0  Qĸ, -L M@ 0@A,R*Z* -QLM  0K  0   0-LP@p P<p U T 0\ żpP U㺺d -LKC/JK X1 0Q ,Q _?K A xA tD0 bKd1 t DQ + 0S bp $t{** -LM@`p(]PP: 0@0@@@@@@@@@0$` $0 P oP@0 hP' 03`P,YZ#| WP ` 03$0  < ᖺP$00$0e]]]  `0S $ )@TD0 003$  3S03Y`` 0SV,0`@,@ ,@ 00|0 0.H -LM( Dp$ ` /WPP P Pᣲ@ (@00 00 0S p-LMP`P 3@S0S0@\3S\P(P#x\$0 #10#0V@@Tk\0pf\R0`\P` $0E`U\ -@LT` $0* 0QP3 Q# R 0PU@G 3\3S3 3S S  $00 S/0/R@0( D  P 3S 03$0` ᏹP3ա 03š0 #0$0@P$0 :.$0P[3s7 0$ @Q$0@ 0 S003P $0 :P3 $0p P o 0@i@$0 @2 u[ @@_Q $@ 0 0R 3 P0 3L00 <P  *PP$0   30P0K0 8PZ3 03 PU 0  PU:$000# 0B8S 3S  $0H ɸP3ԡ 03ġ(0 #0 H a R-#L 0 0 :Q0-Q@@TLP`=p@$0 3C T TP+ U$0P:$03PS0 /R $0@  h qPp P600H -L,M , 4 `PV , R0H0  $ 0S0H0 L ? ,0H S@@PRP < <0@0 4 $$00 S/RA  0T0 /00TT 4P #0 ph0 D 8 Z }:PP $0 0.S  P@y Qc*D #  00S$0H:<0S HQ 0 03#40000Q08 8@ @0@ 8@ H R L0S P P $0 0D00$0D00 H Rں#0B8RSH00CH0 0( 0 DT Z0{ 40$0:$0?00puP  W $0 P T 0phTPY0S 4 03$0:$0P 0S[ 040. ScU P0SA$0 0YXT0AT T 0@0S ,YQ4 3S#$0 Y 0SY00 0 ,0S4 # P 4 #$0:$040 0`0' 40VP @   4 <3@ 03p00 <0 |@h400420#4 0 BH  L ,0S V4 #Q400 a -LpM$0@0PK@P0J 8P10: S S 0  S00D00.S, 040  3S,0Q  3S000P0 E0S D040. S00` Pp` p h 0 0pP 00 -0LRP@` V P  0V @T` 0@T000(00XPpPppX -LM$0HPPp`XP@ 0 $ 0I00D @0(`޾0 -PLM@ @XT 0-00L@ :0S00r?0 00X0XPP 0S PoX R D0P00c00 R3 SD0Q00c000S0 3S 0-@PPL0;0UP1S -LpM$`@P R KPp 0 0R, 0R p00V@@p  ፵PP p-LM` PP p 0@0W WWP -LtM_p`  KPP0: S w0 0 p( 4WP@# $0 0P $PP 0 Pʼ;#;S + mWPp  P`P*7 WD @ -L4Mp, &$W, Q< , R0, & BX 0BX0 嗃#(R@40 T P?4 P0`Y 00  Y 0AQ0 X`P&TP @0P UR PUJ P"0Y<0 00  Y 0L\0 `g@g' 0L\0 Y 00  Y 0L\0 P@g< ' 0L\0 < RV 0 b0hP,0P㗃#40 Y0`; 0@P0 4@d0fgP!P Y0` 0L\0 ^ T.4 , d/'  0  0L\0  0@P0 ʿ,0T`P0 0V*@T%Pg PY 00  Y 0AQ0 @' 0AQ0 P`0V: 0Y<0 00 0 0  0 P Y0 0L\0 0' 0L\0 ' 0AQ0 4 4P4 P4 40P01@80  8P@ Ph PZ 800cD0 @ 8PP? P10@4 ` aH 84 HPa P4 P4 k4H H 4P4 PH4 40H P D D0P0 PD D0P0 P   P P  `0VL *@T%Pg PY 00  Y 0AQ0 @' 0AQ0 L`0V: -LLM` d d@` @d@ h0 \`K$ h0 PpW:` <Q U@ * 0dR @T`05<5:T 0 00` 0 0Pp$0(0,0 0LPP d0S`@H0SW 0 P0P00 d\ Q D0^ "0D0^`H0S0 t `0L R0Sf R0S]  0_P@ E U 0 CPU 0; HP@ d\ 0hc/0cOdP^*hP@pD0^ 0  d0^p@P:PPTTTPP\zT ;T`@L  0%0D+TPc`H0S[ZTXT`@0\ jPPBp -L M@0TP 1>3S S 0P>3S ? S S 0@U S SS S 0P` 0 P Fp, @E  0@ PP, P , 0@S8 S !S 0P` 0 P Fp@E  0@P 0 S S 0>" 0c O 0 > 0c" 0P` 0 P Fp 1>30@C0  @P @p1>3@!>#"R@D 1>3PLSJ1>3P!># RA -L$M@ ,@ 0 p RP`A>3S S  S PU00^ PE0A>3S aSV 4S1>  0 0r% 0 @Q00dS0  0dV0  ?P   1S P1S 0sS ,1V >3,@0ca0 0@P@D ,@  ,00C ,0 ,01 , `{S@ S > 0  0cO0K ,@00 VP000 KS>30@C 0,0 @>P0!@># R 1>3@!>#"R@D 0a @ K> B000 K@K ,00Ps000,00 P>30 z V  VR  0R MS S  V`EV V@*0 S=090 0V V0V5:-0 SX S&S- S V$ V*  R rlA 00  R _Q 0VV r, 00  R_Q00  V V*0V S VV r@ 00  R_P V5:00 PA >3PA>3 S>3 2 V  0| -LM0Q, `Q0 AϠ lp 0 4 00XP40`l ^0p U40 @  U V  Vs T e42W  U' u "0 0Q_U  V v 00QF_VD  U u!0 0Q%_U# A?G0CS >2,0X  R 00  @P4  0  @0W  V v 00Q_V pp0  @@DTʎ0 00\@\ d0Wpp~ 0w0r ,@pn 0g -LM, 0 0Q0 `Q0AϠ l040 0PX`lp U@  U V  Vr T d02W  U' uŸ 00Q_U  V v!0 0QE_VC  U u 00Q$_U" A?G0CS4 ><,00  X^4 00  @P40  @E0W  V v 0 0Q_V pp0  @(@DTʏ0 00\@\ d0Wpp 0x0s ,@po 0hG-Q0`A $ P !>3Sy < S7 S S S Q@3"Zp0   S S0ZS S S0>#0S S S S "S>0!># R0p !>3 S >3 !>3 S&S S\0X0>0400 S2 aB0L~ -LTMd h h@d @h@ l0 ``K$ l0 PpW:d <Q U@ * 0dR @Td05<5:T d @@Pp2OP$ 0 0( 0 0, 00 000  4 ᭺ 0SPP h0Sd@H0SX 0 +P0P00 h\ Q D0^ "0D0^dH0S0 y d0L R0Sk R0S`  0fP@ E U 0 FPU 0> NP@ h\ 0lc/0cOhP^*lP@pD0^ 0  h0^p@P:PP$NNNTPPYN$N iNd@L  0'0DYNP^dH0SVNN$Nd@0\ PPnp -L M@0TP 1>3S S 0P>3S ? S S 0@U S SS S 0P'` 0 P Fp, @E  0@ PP, P , 0@S8 S !S 0P` 0 P Fp@E  0@P 0 S S 0>" 0c O 0 > 0c" 0P` 0 P Fp 1>30@C0  @P @p1>3@!>#"R@D 1>3PLSJ1>3P!># RA -L$M@ ,@ 0 p RP`A>3S S  S PU00^ PE0A>3S aSV 4S1>  0 0r% 0 @Q00dS0  0dV0  kP   1S P1S 0sS ,1V >3,@0ca0 0@P@D ,@  ,00C ,0 ,01 , `{S@ S > 0  0cO0K ,@00 VP000 KS>30@C 0,0 @>P0!@># R 1>3@!>#"R@D 0a @ K> B000 K@K ,00Ps000,00 P>30 z V  VR  0R MS S  V`EV V@*0 S=090 0V V0V5:-0 SX S&S- S V$ V*  R rlA 00  R _Q 0VV r, 00  R_Q00  V V*0V S VV r@ 00  R_P V5:00 PA >3PA>3 S>3 2 V  0| -LMp, 00 Q,(P4 0 8 0 Y=0000AϠ0 P0P 4 < 0Y04 `<0P 0 V<0 @  V X  X T sp2Z  V' v\ 00Q_V  X x$"0 0QT_XR  V v 00Q3_V1 A?J0CS$0, Y00R0S0 8寱0 4媱0 80P1P<  0P00 P P0Z  X x 0 0Q_X 긠00 P@DTP0y 00\@\ d0Zo 0h0c ,@_ 0X -LMp, 00 Q4(P4 0 8 0 YU00 000AϠ PP< 0`Y V @  V X  X T 00 P@DTP82Z  V' v$"0 0Q_V  X x 00QU_XS  V v!0 0Q4_V2 A?J0CS$  0<S 4< 孬P ,Y 0 8°0 4彰0 80PDP< 00 P8P0Z  X x 00Q_X |0wX0X `0Z@n0h0c,@`0YG-QM@p(,P >3 S C S> #S S S P@Ѝ3"Y0   S S0 YS S S0>#00 000S S S +S "S 0>00 1>3 S 0   0S0 `>3 S >3` >3 S 0&S Sy`0\00 >00`0 S00h0S0`@Cca@-M ^@ P`pX\ Ѝ(@ \@Ѝ@@Ѝ@eE1* -<5L|MHK0 @K0PuAe/ᙴ@ L L R *0S0L  L 0|S :S 00$@$@@L KPڄLFPX00 LP`: @PX0L0P K@X0pP0<T K(@(0T0X K@00X0\ K@,0\0@L K40PL d K@p00, d0h K@80p408 h0l K@<0vp6[>lp K@4np7[0Pt K@4fp7[04x K@4^p7[0| K@4Vp|00 K@P0Np00 K@T0Fp0: K@0>p0,K: 0墛 0K➛ 4K⚛d>F`DX8FL^d3FKD޿L^*FEDԿL(Rh@0AZ0\<(^\2:FPX' D帿%P@@`H PL\ T D P( )ED塿^KHPEPE0!  P@*|1 R H dPD %X(L  P 0忇Pp KAA CXPX E0帛`@EPP  0P@( @<8PFPy`` _EP  ̫00`HH L  ̹Թع -LM@p$ u$`K ,PK 0 p P , 0S0$ 0C0 00 R0S   \ 0 S @0:SS |S0:S|S S  0-L@P0h -LM<@0S00( (0H00(0$, -ML$M0cßS0 S, 8 < rP "0S0@05 KAAgP@R 08 0 C0\  ||20  00S X0 S\R000:S #S $Ÿ ^0 S\R00KHHpP0 :R0h;cp0 \ B*K08AWAP=|gP08@0pC0@.š 81 p p@qBNK@D@D0 08 0KA8<(0 A@;0S@ 0 ,0S ,I:80@ @00P dgPP!0<{gPC0( $,  -Lp= P@ dCP`$ d0:SS ^S \S $ @^ 0:SS00f^@A`8DP`V DPfd,DP `d P00:P\00BS1P0C@ 0 0/S7SB0@@2S?갋ċ̋ԋ܋ċ̋ԋ܋00:00 0 0 00T 00S:S00ov -Lp= P@/ dLCPP! 0d:SS 0`e\d@ 0:SS00e\@APCPPUaCCPd P  0-LP# P 0R @ 00B SaBQABW0B\70BS>. 0 XRxR @@00 :S0-LP 0:S0@0N@0- 0 Sn@S> -LM K"vtO*$* -LM0`=S`pP,KRP@; U P:0P00@S=S 0S=Sg! P,@BP 0 ,0RA 0=S 0S0 0=S=000P0 @0S 0S` `00cC QBP@ 0 0S Ш0 @0@, 0@=4 p-L@`M@PKP 0! 0S0 p@= 0-L M@kH0P (0 $ 00K K(0@  0  ,P 9P 08 B*A`*#* 0-L@@-@0S  S 0Sd@(Τ*(Ȥ*Q0 {b 0wb$h﹤*$%ﳤ* -LM< 08 rSwS@T 00  A, ,0SZ 4KߝPTpPH P < 0rS <0@4喻,0@, P,00,  4@00@T 0}@T< 0rS 0t4P 80MKM4d0@4`T B4W0U,A,A8b̰ -LM☀@`T 0S `@TT $pK pPj0S V0000sAu$8 -0-LMP0 S@   R1 00 cQ  R!,0 偶 0S ~F0@= -0-LMP0 S@   R1 00 cQ  R! L 0S IF0 -0-LMP0 S@   R1 00 cQ  R! 0S F0 -0L @= -BMLMh#0P,0 0L4  0S 00,3 ,0S ,E/㵓PL$H$ K>2P@@ᖖ00 cBK J JH 妓MK@DPpP 0Sr|`0CK0A S A P2D4 H2@ K0C0C0  A  ᐵ>00C=S񟗗$|0 S  1S!00 c0T p7C0L4 dPnL$R 060S3/ $CH @=b@-@^  0 S SS00N0 --L ! 0-LM@P᳓0S 0X0S Q0S  K\ 0 @@P -LM@`POP pWW0S `U @YT :0S c?000@0PTP:@T TW ?PP  㙪 04, -PLUp`@: PP@ U:` `       --L p-LM@P\0X T`T < 4 000 㣡ׇ ph鮇},iP 0000ӑ p-LM(0`S/   P00 00 @T_Q <0@T_ p R 00c@_ 0(pP@ u0 0 -L '* -2MLM#0@,0 k0/S  P BKAA g+ }p Y W3*WY 0P/S00@83 ,0S $,C/ YP<P"P@aTnK`F`F v0Z0pd  1 0 S/R  Rm/0 0 x2(K RW\IP LDP@ Y 0C/0h@+!PBKAAP@L<: S< S0< ?nK`F`F!+PP|1@(K /R@ Y!Z 0 S/R 0 S*>K0C0C/  +Ɔ Pp* +Րp?00^ 0@C/Z0@h>00SZ I, D\+㰐>00S8 B>K0C0C+< 塐!PH a p-Q00P00LMSP@`P 0s pg=p[(=P@`I00p 0S S* --LM  -LM0P\04#   R,0 p 1S018 `< @T1 tT?   0 R 0S0q?  0 0S 0 0C`0걓P %T 0S 0S0 0C` 8,0 S |,/BᓓP 8P@pzT|بPDDд8DDDLdtд iz 100Cu@ <# 0Sq 0q;  0 0S 0`0CS0 P MTꤩTPZ  @ T *000ɒP d X2 `0 j 0 0 43 0P4#83 04# `83 Z  KK @0S 0 0CZ @ S0 RT `ꌒP T4#0KK@Q4C @ 0Z0C0   0S 0 R@X 0088 bP XZ @&43@4 0qL9  00S 0Z0C0   0S;P 8#0d` 08# 0\0q8  0 0S0Z0C @0 SP x8JZ!3Kg @+0DMSaįdįddدددددددddddddddddddddddddddddddddddddddddddddddddddddddd<3S<  @00CS0000TZ I@XXTxT@ ;6 3K<# -43@ 4C  43 43 8C@8C 3K0``@  43 @4C  43 43  43 @4C 43 43 3K<#Hv3.KXXoRP  <D%00<3 <,00S<3 ʔ<# R  &3K 00X< y4JZ!3KL @+0D:SF갲tttttttttt̲̲@00CS0000?Z  /@xeTET& 3NK0d@3K) =K43@ 4C  43 43 K83083 43@-x4# 4# @x3KXx3.KXᗐP    9 S9ᅐP @< |KKp@u@r@phP@0<3 f倐lP  43 @4C `z 43 4 `r43 4 !@43 043  43@ 4C  43/43 W43 4  43/@4C `H"@ 0@@ < @" t00  0@P@o\ @-^R  \R n-\ @\00]\0S  R\ A]\ -LMP pR0 0V@ @000媏P`dp@V 0 0 f0 0  f] -LM, ,D0 ` v00  R-V`<  +V< `YY0V Y0V <Q +. 0@K  0O@K 0 K@@K 0KP@@K 蒌<00 KSP T@0PiPepv$B 00Q0`Fv  00Q[ v 00Q7 FW F` VM\< R& 40S 8@T80 W V00S NO"00`D@ 1B"@$$pSƏ4X004 X 80W8@<0W V00S pD@ 0B"@$$pƏ4 X000Q \,0 J00 K\0XSxS`I -LM, ,`\0 4 P u00  R-UP8  +U8 P4 RR0Uv 4@T0U 4 4@0K/0 㶎@K @@K< pu 00Q0PEu P!0 0Q4 u,A 00Q7 EW EP4U%\ X  W W0 < U00S p"00PD@ <B"D@p$$ŏ X008Q\pw0 R \,00F0XSxS0P40 ` -LM0 @0pP `冀7PP @ ᔝ00@P0  7PP 00_0 ;0P`0@  `VZP p0-LP@H l1 RV 00S  R 1S010 :000P0S  0S 0B0PB0000P 00 0R0 P0PS 0@ <08 0B0 0BP00 @0 0ʜP0000";lB 0-P@LT a DA0DSR0D@TP0 \(ˉP.T.Q0锼 -EMLM@H$ 0r/, -'H4 YL h Pl4 Y t7 ,0S p,;!4 $Tǟ8(<,"(S\$ D ` 0 l OPpDP 6 0YY`  \4`$ P T  S\4`$0Cd$ \4 V:l6 D 0 l NPpXD(PR `V)*WP` VX !*OP`V H*HP`V x*X4S TJ `\4CS\ d$R00V0#02S`4S T PY? L ""`$00R00S Y! 0S L0  CKA A$H܋D4p cWHD4 0D$ YYX^ X$ YR X Q V@ Vp XVp0% H$] Y\ YY d^`` DUPD3 WX^/ `P" D4 0b3 RD :dd nl3TP:hQh ecT4  T4 ZJ`D40D4 D40hD40D4 <K 㞛<0S80S40s?2 D4%]8YDlkUP%D4|H$D 0 l MPpDcPdd ``QD4!0 2P^D45p#04P 5wy DpCNK@D@D 0MPp:Pd40d4 D4` cpWwD0l D4 D1PP*CNK@D0@D 0MPpPd$ d$ D4P0P ֊D4`p0D4 ϊD4p cWdd Ų߇D$H0D4 D弊D$p0D4 0H$ VYFxBdpBxXd 0-0L@r/t'PN0s 0  0S 00FxB -L Mr/0PNp X X0c. 0qP  q30   00S 0@T tX3  00S.Q q0 3  0D0S}:\D ,pKn I,0[S6 `S@ 0fS+ "bS @TV0S 3P Ƞ 0]EP 0S` 4ySX`{ ,0[q0@T t1  0 D0S:R .R 0P.S  SP,h!hh1H @0 p@@81  :ƆPz0P.Sl  RPp,ἆ < 00 @p@0 0x@v+h0K ^EPP'\0 s/00c0[FxBdxpB -BMLM3@0r/, 8 Mp XY0S XY0S R0s R S 0S S X X0 SBKAAX@ Xt BnK8`F `Fn H2(K Rb 0pS@ 0fSU LbS @TW0ST2 ,0S L,F82P< Ƞ@ <4CPP&@$< 09Pp Q<2  G!0X0P 1 8$0  0 0 <2ySX p  b0 υ@tP. K`g0 , !НP@p PPUZ.0K g嵅p00 0  0 @ 寝\v/00L00SS (  hFxBpBt 0-8P@0LS((U0@0U  $ 0-,PLP 0@T 0o@ $ -L M0r/븢4 0S ,K UP@ ,0 S R@0@,  S*h Y,0`` @#R ##P`,VPP r` IQP], 0 S S 0SN ,S!0p0 0 S S0 S S 1pP0`VPP 00U 0S  R00 R@@TP U 0S @@4 0 0@+0K 0 0VP4tVPP @, PPn4 0 ,  P H0 DDTP WFxB dxpB  -pL` 3P@ 0SQP PP QP 0S t0 -pL `P P@ 0S 0S 0Pd -鬁L0M 0嘡0 0` px1Z>*pUP@P7 P O0 S S0 S S UP`@ 0 SP P`+U`T 0S  R00 RPPU@ T 0S PX000 R X0W@4UP@ PP $0W`4dx< -L(Mp젟0 S( PQP 0@`8PK P@˛P00囆XΞ    t@@0p!lL0\S@0 !$ 0^A((PG-@M`@<T8 40 ğ0,`0#0c0, `0cC 7?04 #/(00 ( ~- 0 ~ " #~5 ~ !~7   ~9 / 00, ,: "#:0 :"&!* 1 !00H,x P `@p` Ph%%),%\P0!ē @ 1 )Wh _)| 0* 0 ` 0+p0 `08000 @`@1p0lPz0p[0ˌ0 00400@ЍP< \| -LM`0(K\p@P.  r($ 8 ( #"., K00K, `0@,<4 Ġ̌(<"4!Č <.̌ (0 $ Ks( -LM0`$S@ 3 R (PK0000e@SP0m _Rl zP `P;@ ZP@P5@9P-P.@0zS `S;0C ZS@S50C9S-S.0C0p 0@SW, K00KTPP2,pŸ * =? 0 7?0  ?0 4 [,  9?0 &?  3?0 ? 000  6?0 #? ?00P 0zS `S;0C ZS@S50C9S-S.0C0 Rp 0zS `S;0C ZS@S50C9S-S.0C0 Rq0S  0P0S 0 e0#R0L@0SP0SH@ <~@a 01S (,@-!P.*@0 S0ԧ S ԧ RQ 00C210P*0SԧQ <0 C120P *0 S ԧ R 030P: p-@L$MaP2 ` 0( X%X@ phd -LMp0@P 0 0`K 08#HT UPUP#08  0 S  /ϒl -BMLMr0D`K@P ,0 02S0$S aS@ l,0 S \,/@0$SHP 0KY @] P TKDSAK`Z0(H K:K4H  K@TK 0i TN:B]KAKx1 (PE(I(K @PE6I @T@ @?T@BKCK!"41"",!1AK1@TPZ$ @20@0  @*K0 "TK  tK @TK  T:m|pd(0@-"Q*|@P0#!0\ "0'*0#" \ ! *0##? 0 \0:00000E-0``&&&C&̠O 1t@X 00#0P 0#P%%%C%̠O 1@x 00#0 0#`&&&C&̠O 1@x 0 0#0 0#P%%%C%̠O 1@x 00#0 0#`&&&C&̠O 1@x 00#0 0#P%%%C%̠O 1@x 00#0 0#`&&&C&̠O 1@x 00#0 0#P%%%C%̠O 1@x 0 0#0 0#`&&&C&̠O 1@x 0$0#0 0#P%%%C%̠O 1@x 0(0#0 0#`&&&C&̠O 1@x 0,0#0 0#P%%%C%̠O 1@x 000#0 0#`&&&C&̠O 1@x 040#0 0#P%%%C%̠O 1@x 080#0 0#`&&&C&̠O 1@x 0<0#0 0#P%%%C%̠O 1t@ ̐0@@0#D 00#P%`&P`E-D0``&&&C&̠O 1t@X 0@0#0P 0#P%%%C%̠O 1@x 0<0#0 0#`&&&C&̠O 1@x 080#0 0#P%%%C%̠O 1@x 040#0 0#`&&&C&̠O 1@x 000#0 0#P%%%C%̠O 1@x 0,0#0 0#`&&&C&̠O 1@x 0(0#0 0#P%%%C%̠O 1@x 0$0#0 0#`&&&C&̠O 1@x 0 0#0 0#P%%%C%̠O 1@x 00#0 0#`&&&C&̠O 1@x 00#0 0#P%%%C%̠O 1@x 00#0 0#`&&&C&̠O 1@x 00#0 0#P%%%C%̠O 1@x 0 0#0 0#`&&&C&̠O 1@x 00#0 0#P%%%C%̠O 1t@ ̐0@0# 00#P%`&P` tH0@-@P!0\#0 0(S"Ƞ0 -L0M($@KP"h0dp 0 8#x "W 0@2K,0 00 p,K0K  H,0 0("x00W0p@d  608 0#H,0T108#xW -L M((KⴠPp@"hh   0 8# "Y 02K00 40  z000# 00 s40 0#0K4 K40 00 0("04 Y @  X000# 00 Q40 0#0K4 K40 08 4#H00T108#Y p-LMH`P*$H ph? (-"xPUL`@: 08#XU@: (-"xPUL`@: 08#XU@: -pL MW`,*0K0 8 Ƞ<̌ Č40 ,K ,0 0 a,00 ,@[0P[p#Ġ"#" #8"(W0@ P`: -pL MW`,*0K0 8 Ƞ<̌ Č40 ,K ,0 0 d,00 ,@[0P[p#Ġ"#" #8"(W0@ P`: -pL MW`5*0K0 0#0P0 8 Ƞ<̌ Č40 ,K ,0 0 ,00 ,@[0P[p##Ġ"" #8"(W0@ P`: -`CL0V Mp@CPC,K0K6,K0K08 <40,0   Ƞ0̌Č  0 )0[0"[ ,0#40, [ -0[0"[ 00#400 [ 0 0#0Q`FVPE@D08 <40,0   Ƞ0̌Č  0 )0[0"[ ,0#40, [ -0[0"[ 00#400 [ 0 0#0QR-D?0 \ !Zt -LM@t@ğ0 8`, z iP 00 0S$S 00R5:0PK c z z K z  z 'D\@ @'(`@ ?0(LX\ @c@@ '<@<@ (H<@ [H@ @D@ - K(DH [P@ @L@ . K8DP [X@ \/ KX [@@30K`0T@ 0 KP@ L40K, 1K2PK 84K ,0(S(h ,( 0-PL@U !", 1#80!"$ 11PX 0h銎0 -LDM@@ hKa p0(h0 0'00 * 霠 d0  (  ly 0)pgz p`00* 00H '臠\  )  $0( jX 0 0'00 * 霠 T0  (  x 0)pgz pP00* 00จ '臠LP  )  0( jH0 0'00p * 霠 D0  (  Lx 0)pgz p@`00*00)COH臠 0'<00) 00 ( j8  '  ܗ0* 霠 40 0(00w )pgz p0  *  0'臠,00)00pd  j0*00(00LP 靠 0)00*00(w< p{ p 0'0 0)00hh0(0 0'00টT  j0*00(00༖X 靠 0)00*00vD p{ p 0'0 0)00th0(0 0'00T\ j0*00(000H  靠 0)00*00 vp{ p 0'0 0)00셟4h0(0 0'00ȥ`  j0*00(00कT 靠 0)00*00uH p{ p 0'0 0)00\h0(0 0' 00< j0*0#00 < i 0)0#00ud pz p 0' 0#00Xh0( 0#00 ꤠ0*0#00औ4  i 0)0#00thpz p 0' 0#00dh0( 0#00H ꤠ0*0#00,\  i 0)0#00 tPpz p 0' 0#00샟D h0( 0#00̣` ꤠ0*0#00ଓ i 0)0# 00spz p 0' 0#00t h0( 0#00T ꤠh0  (  0 0 i *s pg{ p00)00舠T0  '  ̢0 ꥠ( ଒\ i 00* 00r pg{ p  )  l 舠d 'H0 ꥠH00( 00$ i   *  r pg{ pP ) 0舠400' 00༡ ꥠX0  (   i <* tq 0pg{ p`00)00P 舠D  '  (  0ꥠ    xjVp $ν|*ƇGF0FؘiD\"kqCy!Ib%@@QZ^&Ƕ]/SD!7Ç ZEogL*B9q"am 8D꾤K`Kp~('09|eVD")*C#9Y[e }]O~o,CN~S5:*ӆ*#* -L P @ 0T `  p0S# @T 0R 000 00 @0po P 0p 0 0R @ Q-L@ 0Q`Q p 0R /0媅0 0 0R P  0R0Q 0-LP@0T000@T0  R 00d0R00 R 0 00  0wP@0 -0PSL`p  |P@ @P@  jT0000S ]?*0<* -LM0p@ LP 00 00B S0`Ba0B\W`BA0B0S7`B R Q\S P Q' D((0DDD0U0P:0`d00c0CV0`ąrppp0d0C0pp -LM 0@Q`pPT*.X0 R0""00 0PT:400 30 SP:00 -LM0@S 0ہ000 -WMLM0@P=KC/NK, h5 @A (K  2@2  0IZS"@@"@@@@@@"#@$$@%%%%%%%%%%@@@@@@@@@@%:@:@@@@d5@@t5@@@@@07@@9@@@@@@@@@@:%:::L=%\=@p=@=5??@?p@<7@@@@@.(K0S 0(K0  00A SPڅ 10 A0 R0PC$^ 2S12 20 2 2"S 0c" 2 i eb\ R \ 202 b K).K?K W+ >(K *Y 00I SP100PC0 I R$Y 0U@@22R SK).K?K .  00A SPڅ 10 A0 R0PC$^ 2S12 2P  0U@@" B\ R \ 2PB K).K?K 202 P100PC0 I R$YR   } 2S"12 2`202 VgTB   00\0S㬀K& Q; ':Q <r`>(K VR  "202 @"PaUU&0 "2 0RPEK2 " pUʄ6( "2 0R2 " p>(K R ?K 0C0 20Q2  pʀTp PfUUhE00@ "2 0RPEK2 " pSU0 "2 0R2 " p@ʬ" n` "2 0R2 " p\ʬ" "2PcUUş00 "2 0RPEK2 " p=U! "2 0R2 " +ʰ2"R2 S0K 2 K7P P ?KP Q02 0@,0 S ,o!KP PK KPKeYU K/ PQ3@ "2 0R2 " p>ʘ"2R @ "2 0R2 " p$ʜ2PCUoU C00@ "2 0RPEK2 " pU0 "2 0PPK BKPKKP{K"Rڜ2RS20 "2 0R2 " p>ʘ2P`UU6A00@ "2 0RPEK2 " p!U0 "2 0R2 " pʬ2 p1 0 2Q02  KhP0KcPK )AKZP"K20 "2 0R2 " p!ʴ0 0 20Q2  p K 0C0K@ "2 0K*PKK#PKXH  0@ "2 0R2 " pL@" "2 0R2 " p9ʘ2PcUU1ڔ@00@ "2 0RPEK2 " pU0 "2 0R2 " p 20 2"0Q_KPKPK \AKPKKP~K2Sgڤ1. (K K0 "2 0R2 " pN Kz/O P 20C0 2"00CQ2  p ʆ?K0 "2 R0 KzPBK2PCUUڤB00@ "2 0RPEK2 " p U0 "2 0R2 " TPK $CKKPK00 " 2R0K8PK3PK C P`UU'C00@ "2 0RPEK2 " pU0 "2 0R2 " pkڠKPKdPK lDKPKTQ K00$0(0K0 "2 0R2 " ?KPK'PK % >&B`Ph( K0h`C1!`P0h" 00S00 0hV0 q0h0 p`PV P00 U- >(K Pu`  2"S 12 2`0" 2 ~ 2S12 2  Po " l2 "  2S 12 2 Po  W"@ 2S 1 2 2Po"  2S 1 2 2P2S"12 2 2Po02 )   2"S 12 2`0" 2  >(K   2S12 2`  " 2" "  2S 12 2  P` "@ 2S 1 2 2P`"  2S 12 2P` 2S"12 2 202 P`    2S"12 2`202   2"S 12 2`0" 2  2S12 2  P` " 2 "  2S 12 2  P` "@ 2S 1 2 2P`"  2S 12 2P` 2S"12 2 2P`02 X  " "  2S 12 2`  000S" "  "" "  2S 12 2  P`"@ 2S 1 2 2P`"  2S 12 2P` 2S"12 2 202 P` 2SK 12 2`  "  >(K t@ GYgYT@y 2S"1 -K2 2202 -K/P K/ 뤃P- >(K ` -K-Px2KL -K<KK 2  GYgY|\ggYEeeY"fY \  ``y?(K R- >(K {\0l``\`T ` 0`L K -2 S``2 2 KS12 2  @]"*" l\2 0 z Q 2S12 2  2 @ 2 KS P12 2 202   2 KS"P12 2 202 y   2S"12 2 202 c  2S"12 22 /202 N04t2S 12 2 2  092LS1x2 2  P`" 0" 2 x 2S12 2"0X T "  |P `hV`xl`",9D $Y K >(K`2S0 2 KRP 2;&KHPK0S"O7 00 -LMĉp㴐K @4KP  , 0 4pK3pK2pK1pK0pK/pK.pK-pK僁`9K  0Pڸ0@%SP@D @ 0AZSEIIEIIIIIICEIELDIE E E E E E E E E EIIIIIIIIII@EGIGIIIIFIIFIIIIIFIIFIIIIIIIIIIPFDEGGGHDEIIHI4HF`IIIIIFIIFIK 00B S`ԅ100C0 A R$Q 0Z0 W pKK0̠ P0 @ W p ̠pKK*Q 00A Sh00A Sc 00B S`ԅ100C0 A R$Q0Р P0 @ W p РBKK <100C0 A R$Q 2/  0Z 0 W p KKk 9  0Z KK^  0Z KKS 0Z KKH@ 0Z0 W pKK80Z KK/0Z KK&   0Z KK   0Z KK   0Z KK 0Z KK@ 0Z wKK0Z nKK 0Z cKK0Z ZKK hR @y lR t r  0Z BKK 0Z 7KK@ 0Z ,KK  0Z !KK  0Z KK  0Z KK}0Z KKt0Z KKk 0Z KK` QW?P$0Q0SJJJJJJJJJJ`J`JJ`J`JJJJJJJJdJdJJPP^ 4 K^ 000 x,0 S l,)PȀ<0  yĐp X8 -LM`PQp0 @  xp@   }彣@  b~p x0s 0 r( -LM @`PfT40 p ETeTpG/  P090 ,K0K0RugTGTp400  fT@ J P0@ 0 R*00SC 00 0:0 g 00S 0@8 b P0h0c -0`P -LNMp0Q 0 P-0 +0a0ŵ0ť \00 K0 ` l@,/C!bL0 Rn000n^*0^0: 0eR  =gfffL 0-L@!0RP0L1 0 000 0P 10 -`Lp@P8#8S"!"81 ("((^ XU 0V1`P` !@ xp -Lp B/ bR@P`0ڃ0Rʙ V0P0 P @@ 0 BPU@UPe 0 BPU98 88S00000P0   0"108#8S2 "$"""!    -LM@:00@ -LMp`PW, `pP 00 R!0 0!@0 < 0@ , R40 @*004 T:aPX8` 4P @9*0h&hV 4@ p(8#8"(2, !#, T x:p0#h 4@ pP %82! 8"(#8P2! T, x:80X:0 @0R<  0>S000CS00 0>S 00, 0, -LMPp&EQ @T` P 0`S @c0`\0p0J@`0 1pDq0 -LM0b 0PUp@ڂ Uk R0  R00@ d 040 Q2 :RP 0E0d0Q0: P!0 <01R\3# -L@PP`9 @P`` p0@P `a(8#8"(0b! aL8U0CȠ: T * 8#8 "(L8 T0CȠ:0>S0>pGS p00`@-@0!"** B\0l Cʠ\7SL l0\20 -0pQ`5L@A 0` P0U 5 \ lU2><``6> U ` 6> 2.0 -L MP@4Q6%z00 600 T`,@ ' ,KP0 ,0 `100 ,02 0 000S  @0 W 0C>C5 `0C0 C>@0C!0B@`@0K00 0 @ -L MP$K`@0(Kp{ 0$KP N0bŒ\0 :CQ -L\M8 4 ] 04ޏxCPLP PP T T0  q0 0  RT  T 0-S +ST T 0 S/ 0Sw T0`/RX0 p9R 10W0C10W0`CT@p /RT@ 9RRHp  @EReR@@ 8L04T  T @04  +RT0  -R 00B S4T #0R 10BST0B0 /RT0 9R T@10 0C/RT@ 9RT@!0aPS^@ ` @ W @@ @lH@@ \W  H D EJZD0 SD@00 HLYO2JVP@ 0 $OWl aD@@0dPU 0 8OPV MU-L"00p0lP dvhtprlptn8QT  P0 SrNX@||@??ER$ U@ L`@P 0 NU`ʄ5I1 0 Na&j0jV0Vἐ5XH 0_l ll0h  ! 2u , K00K^d @@p T@,`l0L! 0P`PCP`P`^CN@6@lpP`U࠱ࠡ^ࠡ^pn`nPnQpdp @dd@ VdGd Zh h Uh;h Wp5p hdt 0< 0pcP tpM/O P@P).O aNP@<p`Pp`zP/O %Np`*3 Z] Z/O pP3.O N=LI<p`\p` x0 %N 0 Ma&jjZ dghepcta<LH0 MP@<PX46S / FP/ 0P - 7P`K5I /0 M 0 M1#:x":S5h2\ R `@t<\ O0p`qX46S X N0ndYl"0y\0zi/ P . MP@F[O0<0S, 4`!6S \ <@T 0 hMJ/ P@PH  0 DM>x1#::646SX1#::C (< R%X#46Stpt 4P5?55?5???|8XAMPe ,  :NP@ ERUlU@ p`@P 0 MU`ʨ 1 K 0 M`K O P`` K@K0 L0 L.O P@P5 P@P Pg@0QtA 0 @ n@ L0 @AL 0 @qt@  L M}/O LP@[/O LBL  40T0 T 0RT T@ T@ TW T 20R) 10BS0BT PX QP U EW !p₠1W`^W 1p⃠W1Ѓ`PT0 T0 00B STP 0RT 0B Q@L@ T0 0ST S}0T@P T@ q -LM, 0 0 S0 J 1P,  4 ptP8P - ` 8#8!"(!82$8!#80a("(40 (bA(U $Bh0SpG W 0SpG WJ0S , 0,P1`8P 8#8!( 8 H!#80a("(40,(bA(U $Bh 1 pRpG W 0SpG WJ0S ,  -LlM4 \80 p`@W00qdz01#:H":S !. P  002Q0 0000K, K0':ც᪪Zp T K J%00ƂJ0 KZ/ l jK. {KW/ PKP@ QFR/ qK0 DKpI P PP QX 0 PP00CP0 X 0j@SP0S@dB C`@ U< U<@ E` ES`@ d0 ` 4 ^ࠃ^4 N4 40P\ PS%lmlm |4||<|?aCoc?`(?yPD?XS񟗹ꀌ4H44444444444Ȍ4Ќ44444،444444444444 44444$44444,4L000@ 0S`VLB0S<2  02 P@0h2p' 2. 2Ύ 000 0 00S 00 6 0upPPl1 ,0S ,|g 0000T1LQ:0@1 14101,1(10p0p0000000PpPt p~lpK? lP@`&yV0@  Pqpi@n`dhdpl ,? -"L M>@0> 0T0 ` 0Sk*@T0Z`c Sd2 R  {nZ&fQ *6 p,K(2,  R 2P8k@0T1 *0kP,0@ 0, PT1:0S  kP,0 0, P11 0F0 Q 000S P!0S0 0 mP  , R0000@ 0f00  j R,  0#P R,  0#PR 0#P LN0 0 0 ,0 `l$,0@S P-L @ <0!RF 0q PRQ @`@` 0 R0!0  B8# 010 g!0`BQc R0_m8jcjP`VP@@`@PWPl - 1p LR@? 1`V=P0S3 T00Q00SJp t!* TyP0 RU 0 RUU00S   mXJꖾP 00Tyc, h -H3L M R0 ,3@T$f 3 R :##:S )f @ T[2 T,K2,P UP2 2pi\I \E000C@; *"*2`21 2!-0\"00 ! RSR00Z0S $2 R 00 cl0GP@ 0 ZR Z 10 % `g s :#:S `riP PU,P xi @$ET P, UU` !@Xi1SRipWPU,P  Wi @$ETP,p U0 00 SR0 :JR|0 R0P@  f c 8Tl p- 1LM PR  1 R/0 R *0"*RPb%6 ` V+0 V`pK0@ T@0 0@h!R tl@0S p $0 , -X L0PS HH 00CQ03 00k000 ` p-LM`0PS@'00 S0:0 0CR@0l T00\Q00Sp 00kpk` @0 p-PLMpPp`@ 0S0X0T S0 ph60 0CR0ptkqk `P0 -pL0@S`.P0 0S0"T )0 0CR@0x T00Q00SLH똼 00P $0S S0ST -LM0pS@0  P`Q Q 0@ K  0S0000S0P00S -MLM K@(L8L,@ S ;K`(0C K4$*K:K8@ K Z P6 ,0S @,!4 $ K8((I<,ISK"8 K4 prK*Ki 0 Pe 5P_ 0ZZpN ZL *K4$S:K K0B*K4:K4W:<5K  K*KPi 0P P 4P3KKK4 KCS K*K$Q00W0#02S:K4S K^ \4(K:K$m@4(K ,4(4( K:K$p 08#(Kp$p@ H$HT p pZZ Z *K$ R 0BS@ KPK$0%H  KP P*K PjK0X0^00S K0X0P00SKQF *K$R9 ]K(PEPEK^t2@@(K@P  *K$P:K4:KK^ P KP 0S*K$pR:K4:K::K⌔ JIK<K Y<0S80S40sh:K$%X 0za:K4S ZbK$RRVuCNK@DK@D 0 PP*K$0*K4IpXX:K4:K  FK⌔ HX KK⌔ ZhEUDpBp -L`M0(0 `0 \0 X0 T0 P0 L0 H0 |0 x0 t0 p0 l0 h0 d0 D0 @0 <0 80 40 00 ,0 DpKP@`X PPP 0SG <S 0| KT0 ` p h X P@ L t lP `KPH\ T0P W `P 0S`0S(dx p0PS0X0  8T L0 P@  8T L0 X c0 pB -LM(@0$S  h}  -LM@0SiH00 -ML4M00Ÿ 0, K*KSTX{ K(JJ [Ppb 0#S P@ PPP@ PT 0S  R00 RPPU`d@ T 0S X@T:KTP PPKXK(N$NJK(@D`$@D(`F (K@0 @P@T *KX K00X @TT0 ,0S P,,P 2,,P}  p-L$M00 `P80 40 00 ,0 (0 $0 0 8@K2PP T P@ 0S4p -LpHMP`Dp @p  PFxBpB -pP@L`r/0W@e T@@)0@"p0V`@ h0 2 `@\0@#$0$ ("("4 400g@IFxB -(!XL"x H` P iT hdTU H -L'T!!Q#7011A!1 ȠT0!90T0A0 !0xp00 cd1(0000 c( S0! (a c0#7%c!c1c X@0 T08 #HT 0 @00׊ 0  S0 900T| ?A7c%c!c1cW XEنy&$ -@pL᠊ 0R 0SZ`0 P@0E.>? B7c011N0 d 0!T 0 L0L " /uEن! !U00P 0-0PLr/8V4@0, ,VB@0S0FxB|BhtBH -0PL4r/uV0`Sp- S  0@W0 0 R@ 0T0\ 0S 0S0S0S LPp 0@W0 0 R@ 0TP 0PFxB -AMLM,48 <#h0V,0 4  P`F&B~KpGpG 00PSP@ ZH00$H T00S4P 0S`F00 ,0S $,u P, -AMLM,$p(. , "h  V, 4  P 0 ,0S ,qP`F%BKHH 040PSP=@:H $H( 0"(lP0P`F S@ -LMH L p r/0, yUH` 9p 0 1d" L"0 R0t2 0<Sh2 l |2 p2 0^x xD R" P P |x0,X0S @㒟KoK%KAK  0@P񟗢<)TP tQ$ Dȟ 0 Sp" ,0 S XD"0S 0@SD2 yPk00D"DXPOK?K@DH2L42  p70 S TV*00, bZ00`F@T@Q*@$?#<-"-0 0c`0, bP *0S  P*0SPlR Pp4 0 0  RP 00ӑ -RL M00 , *,p `PU 0 S0? 4` PU0S 00X: iPUJ0.S \S@TpPUZPU0S .U 0@- .R .R .^ABa0B" Q00.Q^APBa@BABa0B UT00B SQ 00\S0@B-R T0\S0B ^0*S 0.S S0S !0B]S.R000Q\R R.R0S !0C]S0S0 0   < 00 , 0 ( Ġ P 0000ӑ -OMLM@ 0r/ , ,Q05 - 0$QUT U U U 0R>*l= K AAT !p: To!4oS- I>K0C 0C000S000@S0005\ =000@Q KY/0`00n0`A ` g8"P@ h lxPpd  TY8P< (K OKAPPI $< @REnK`F`F fK4@@ ;P@(K R  )P&+(K0 S S %R0P S S \ \ \00\``V`@,88 P`e $ )P1+(@K0 S S+Pn/Y 0 SS S S ,S PPP 0bSyS fS P 0bSyS fS|zH Y)PW$*(PK0 S SQ\k0P S S \ \ \00\@@TY`, 7 7P@`0DS PH` \ V!* \00 \PYP\ V: P P P 0S S S  (Px((@K0 S SrUUo 0 P S S \ \ PP P 0X r0 0  R  0SMKL LL@K '50  :ON.K B0 B0C P0S  R4E7J4 R2% % P lJT ,8O |(P&(@K0 S S U UP 1115  \ \ \ \ 0 SSz ;S`w 0 SP 6P ;Q Qq 6  0P NKJ J  GPE %4!@% h1 6P`3  Q;Q Qq00  RP 00  !PE4 l1 00 %h1 % 05l!$05  $  \@hl\@K P00 ώlO`  Q;Q Qq00  RP &Y  ! /P P PP0`30E R@ %5E $0$@ % 5 E  BPx 'Pd#(K0 S SLY?P  E "  9`0S= UU`0` HPD SEH`P 0.\@SPpVP *T.@D5PPV:00占P0:0 000,0 S @,4DIPP $ENK@D@D,P.5P ,`5*IP= `p,5`0e SDpPH` \V!* R R00 R0SY P\ V: P P P P 0S S S S000 4ST1o/S0S&1SFxB|BhtBhĜ || xd -0LMP0r/M0pSD Y@ S S@0TP S S  &P`3$K P$Q |H1  00P0S0 ^00 0 0 00T R R R @0TP R R R0S a&P  [&P0:0t Q&P0; X I&P0; < A&P01FxBDF<4<("4 <1QS0 W 0-L@PP@sT0o 0-LM@ P K 0K  P @@Jp0 -LMKPA-M `p |20  00S3 0\ Pt A\ |0  0  R#0CU\|0  0 D R |0  0   Ra NA N.\ 0V54:Ѝ\ \| 10  00S 0hC10S , ^*0S쎑W <4<("4.<0^* R0S8<^P0S R8<4X\x\PP P-L \hBꞝ/00h -LMP@`T,`K,pK 3P 010jP VX`@TX ,K F0V0.T00S` X  -"L$M0K 0CPcT RL K0 A ,P@)t W~ { 0  y4P`K> @)>K 0C1Kc@@2AlA H D< L @L D7PÓ07S K A 0P@07S  0\KclA18 A 4< 0 < 7mQ T00%Q00S  `@Dvr `W!X< APPD@`PeX } 0PC 0 AP PJ `81 K@@ 0| P PJ ` 1 K@@#@ }`8$,8 -LM0@s O0000 -LtMp0|@ $0 " 0jP`KS  $0S $cyAth KPK叀K/) DpPOPfp AK|`p -PLM@R  ?  000 -LM@O 0 0 0P0 -LM5 -LMp@`P0T@$K P,0 P00g Z@{ -L\M `\, l Pt 0%S U 000S,0 S ,@zT4FCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCChl\PPl@ 0h hKlhP\th 0\t0l 0l 0S$@T @dJPϠ0Bl4? 2cc1D1Al|Ml0t*$$IQnm8t` (ts -LMTp,@KP` 0  ]>  0S pQ *0S0 Q*0S0 -aLA@_OReBd @Ap`@@qGTçPDdp@DW00ä?dpG@Q ?T00S L U'@(0 0Q0 S0 R -LMP LL1R00 mm@ `  0@T1@0pT mmP ` 0@11 T!@ 0T p`P%P_00 0@T0@Tlpk0@Pw(0SHp0T%P00  L,lt -#ML M$0PP,0 ` *P 0:S /S .[%P PU  0:S0/S TtW :(@7(@@ T*BNK@D@D+G% +-+).3%PP FP/p@ #\K(PE PE#ᙱKP741 0-$0)(0% 2R,p\ \^3^P2P ZZ0Y0 YQ001001 0 e b 0RQ @Xp@X L0 0 QsX Xp@pL0SP7d0T7 @S^ XX 0X0 1QuM@p0Xp@ X ZX 0SX7. X X  Y\ 0S\70X 00CX 1 RXl0 ,0S t, XPU/D$P8P0drL a0S0 C,S R-S+S0SS0SSP@-@  00L S 100C^00L S^ 0-LMPK@ 0P 02c2c20 :R 0 ;0P 0 2c! 0:S<0 P0 00 0-0P-SL@P +SP  U0 0c00 -LM0@JS: MS 00C S00 0P 0/S00    00  0qP 0.S 0fP 0.S 0 0 00 m E-P@p "22a11\3a11\p0Sl S  W02c2cZ@]E ;RPS J^P WXa  102c2c^S,! 1?0c0AZ1`L ` !Ϡl  B 111F/N!b  !@!A! B 0C`aR0B S B^ W 00T` 010S^ 02c2cS002c2cSQ*gfff$I -RLDMP\ ` /\0<S \0@0cd0 0S TKP@ IP00 `R <R `@ ~`@a0S,S ;S XKP@s 0V0R00S D ;Q,Qh Qd@Q` 0011P'RL7`c \\%0011P'R\\ds01u.00\'RT0 0f  P'L7R`c\T0X d0c bL7`'0 Td7 PhY 00 0 0 SmM @ \B"d Y0@ `7"@<KnP@ 0,SPKeP@ ^d TX0]~h al0 0`p LP7`Tdh 0< KhX0@hP KT0@000@000 L1`"`!!X1X1 !h0 "b"b3h0 0XTڄT0>CX0 &@>`@ 0@>S``@ T00c  L7PTdg\ >0@>S\ @ bd  s$<0\@ R !`0@d T0 Q$ -@LM$0S h -@ 0LS0 00Ph:  -@LM9h9: 0-L4P@8 P0Sl!P. 5$PP!\ 0m ,TǃPǃLǃ ;!0hP 0:S H HP 0 ,$!00h:9  -@LM9h9: -LM`\p  0P"P7 S@ u RA @0S@AL0 Kp ] P` T70m= 01(0 R0P R0  A  p-0``0^80 ``V0u 8 ^N 0 0R 0 0R80L080 A 0V?HE.²Q$ScQ$Ių -Lh -L,M@<K0 Q 0 Q  -@p0T`LP40c0h 4 -@p0T`LP30c0h3 0R 0R 0R 0R 0R 0c -LtM0 00TK0SPPK?L@K< PhHK Pb@P儀KDK P PY}PTH^DńPڜ4^$ڔ4\  “Ϡ2l1Q`3l1R1R`@4!bH XP/H4^DńPDP$O2d1ap3d1U1UpW 00# 0A0d^ \D H0 0D0 )PH d!PT0;Q@0 v>8# 0ST Ŝ ŏP@@TPZ@ကK?0/0S0 P S@ ňK   P0SÈ0S S UP@P0CS0 @0S0 PʷTKP4\>`0 S; (("(Y 0@S1P1P}R pRJ0 S @TpG4UZ 0`S1PQPJP7  S K`VPE4UZLǕ0 00n0  0STK P` 40R00 ? \0#S gK    P00:TKwPT;0 T0 f QuPLDP0\  “2a1H`3a1R1R@0!^H PPKTK< YP 'lnQ$xb  -LMp@P`\ 0 ~ -MLM 04( S0 0ł>K0C0Cp0 D8 ,(RJ 00S1 P1!88 8( 80QBKL !80Q8(0@ SJBKL@8( 1SA0@(K@1 @( QZ@0S<8 <8.K B8(  0 P1H P'R <(@8 R<( @8XH8( 0>K0C!88!aPǖ\04(D8@X PLLGdUPP P`,8SL'L 0 `bS00 0xb  0-4PL@4  Z@40:xb0 0 L d 0 0F d@0  R J1u  0Q R@Z  -LM@K$0c -L M@K$0@K 0 `RA 0 `RS  0 `RS AR b-  \ 1<20 0 \ ?\"00 0QS@-@0c  \1<0   \ ?\0 @0 @\ PT0 0 -RLM@8"x8S,0 `0hȠ,Ƞ*H&$!PQ # 3(!( '#P020cY ! C2R `0 !8,0S&hh0` 0 Q 2RhF0P13P1 <2 -(0(   1$P ;;( ;S0 0P0 -LM`PP0@ KpD0 K04 4K00M00Ѝ -LM@Pp`EUW 00-_u@T0-`P\9p T0 R @  S$0 -LM`PpP%J6 K`P`,K0 0K00CM-00!OO$P`0"&pЍ -LM`Pp, H0P`pY ,0 p-LM`P@@@`@p -1LM0S``V$ P@pSS PpR SN $8?S @ U=|:JUT!0000à@T  RP;?$ $  u00Q0SpJe\0 \03  0<$0 00P@ $0P0?45WCpSpp $ p-LM`P@l@P@` ph -LMPP@`pW P `034 `RE0E0BUPU0H @0`043P 0 00` -LMdß@TXp, 00 ` T W 0^0T3("S*2V ,P0;,P02S|5P3 T T00W00ST00W\ /O0`PP#>`P`P`0O/ <`PP`V%^!000P 0\P2 000 ,P 00 0O/O0`*0`@0@ P` 0``!v00Q0 S  P (1U:  |0#03  ,K0f0K "Y` ^X,P0W T ,P0^,P0T^,P0{0^0TD $ -RL@M@p $0 0 $ ` `AG P@U0e $ e0(0 21%$ `e( $0 K(K$K$P0 P O4  b p-PL Mp_@@` P0Q S0 U UJA>`o0OoPJ0P` P 0 `p0`S  0 S43"?S04# 0 0 p-;PLMDUEoJP V 0T0U00S pp~UPD 000p5 D" 0a4000V`p$ -;L,M\< 8 * \PoO 0^8K< K`P80C8 <=PoOoPJ  0P` P`PD @ `Po4KO0^`P,0P`$+`P -;L`p45gSM 3^@$P 0 )V! W2 0 KN0^0 ^0n03  1>0$0 2 A$0 AB B0Q0UzW V2$0 n$Q0 Q03  01$0 0P0S;V V ?"0!P -;LˠP` 45fMà3^@p $0 $U V1$0 N$^0 ^0n03  1>$0 0$0 cAH0Q0\U UP` S:\: 0S00 lp'V U Kn<Q0 Q 03  010$0 1$0 0P0S "; Ϡ\  Ϡ\  y -;@T;LM/UT`ᠯ", (@ 4P 0 H X9 T^(K, KV0X4P 0K4 KM0,4sL'h$H X!1"4 R0#038"8(!,6.(0\ ! 2\ 0C QCR ,p 5U`; i^0U0X00S; -;PD;LM0/EU"4 0P ,@ (0 h Sb ST P ?45(K, K0PU4P0K4 K0P,0454( S b4 ࠑ}~ ,0 4 p?0S`,Ƞ,Ƞ(XB[ 4!Q0#038!8 5"40P 20bP  CR`P`  0P0!02S `FT ^S ;T -;0LMS@ ;0S P  00 45S P{P c45S;0 S-L# ;0S ?S S 00 P *S S 45S 345S;0 S-L# ;0S ?S S0 0000P *S S 45S 45S -!:**@LAB14LM\?@(0R\0l0&03  T`PT P TQx 000T`0R@L0R000 000 l>"0  $ -p`':@ナ7DL⨊ MXO<0KP  @KX@0H1@0 A@ 0?48@K5 0 ( -LP@K4MH)JJp,jP@ 冪 #T # 3(l0 $(h0.%pH(N.l # R2^P2t 3#S#3t@p#8$0 (, PP@2`3`#\ # 3(t0,( Ƞ##!@ Q020S ! 24`h@^ ! 2ldxY00RKAH D L0 *L`H0DK HKLK0D @T0 0` 0O/ l0T Y 00` 0O` -LP@KlM`K PP<,JXJ@ ,Jᄪ@|40 X%X "| t #[,Hs[2,.\0#03^#38,8 Ƞ&.x 8 "# V2R02 3#h00c bVQ0C2Y0C2S`h0 fh  00|00|0 H0 DK|D 0HKLK>L`dD H0h`Pxt@030# 3# h \|L| h|H ph0l@ 3 #030#0SPLh P DP t ` 0/O PP@Z ` 0O/A?O`PP` -p(  LMP`P' &:::S@ W @0 O00X64460 PP 20460@ -p(  LMP`P3 &:::S@$ ?S@ S@0 O00W VUS S X64460 0460@ -p(  LMP`P3 &:::S@$ ?S@ S @0 O00W VUS S X64460 0460@Q0 0aQ03000100P0R b0@- @P 1<\0 0 ?\4 00-b1R"  @-Sc@#0 401  00S20@-  3#@3@# 0  0bQ@2c0 0@-Pc0 @R#3 e d \@2 n0Q@20p@-X h%X ! $ T#3 Ƞ$ȌH.@!Q2pG-(!X  "(!& ' V#3W#3 Ƞ&Ȍh$a*'x%p,Z@2\P2 3 #P$ PG-ȠM!h,Ƞ !#8() X#3 Ƞ"( X(ȌPA*% ᑌ,Z@#@3H*H F' ᙡ&,QP2 Vp2` P@3@#\#3P, Ƞ%".p RP2 3#^#3@ .,$<0\@2@PTP28 40@0 PЍQPP  :Q00SP  :Q0#02SQP -P`LV@gp0S  SP@D RCA 0\R#R! B -L M@KZPT `0 -L"ɠ2l3c13@"c1MP 1K0  9 C -L^M⸠p`OKPC/MK@( h < 8 i&Vat0V$KOK`?cKpG 0@FfKq q A A D1 (0S (2 -PLKTP(K@0CP@ 0C4 d B P@o 3( K!$(,"( R`*R^ 2Kp2 0 IF>K0C"P pt0,^0S 0t t h wdh$`0 K@P@ @$"(0K!48<#8 S*S 0H T H0L P J I@  Lh@hA Hp\ ᭸0p4Slgp PBNK@D@DhL!L1#p@) V$pPvu0#SEKEKALK 0 LAIP4 \ X T $X4P$0P 2hP22p$RhPV0(@,H(L\4 ,l -LM` @0 0\ `0V -pp`@LTP W P `@T` 0V0000hH -LM$@0 S η0; -LMPp`P@b ,K0,px!0#p  P @\T`E,0S LLL00LLLLLLLLLL( 0"00,(0 $" "p P@T` (pP0P (0L 0 "(0 88H\ih4 -Lh\,P0 -L  hBi, -LM`TPpP 0 S S 0d z" 0 0 @0$ i"@5? -Lh,P0 --LM q -LM@$  0$0KQ \  0  K 1S01 -@LM z; 0-LBP|@ 0S L| 0SPeT 0S \00LS `000 0 -LDM@ d ᒶP d㍶P`} 0Sh 0S0J0@ @@`KULpP dP00 H XP L T@ fXKP0SVX =0P0P0H0STTA 0@81H  FP 1%P0@ 00Ks00p0d  N X%4 40JH  `0X@\ 00*s00 00(@, 00s000?, -LTM` `\ h0 0Qd 0p KLP0|0 pK0 0Rx0  x 00$0L< 4 00h_  ) 0-LP@P0  P 0S S1P 0h+0 0-L@P P 0S S 00h0S 0h  0-LM@P0S0P  \0G 0\ 0-0 0 0LS@P 00S 0S 0S  0S 0hPX4`hpx000 0 0 0 0 0 0P0 P 0 0 00 0-0LS@P S 00  0S S 000  0 S 000 000 P0-  @ t@-0@SC @<4(<"4!<0  -0S C   <4(<"4!<0   0-LM@0 SKCP0 (<4(<"4!<0  -LM0@SK C < 4 D -k 0 0 p-LPd p`0@,$,!$#,B V 0? !<4<("4!<0cS @` V @ P,$,< $,4.l$<("4%<A0 V 0? !@<4<("4!< 0cS @` V<4, <$!4 , (Q0S R$1 !0$1^ 0S J?P0S) 1S$ 0P000Q 00b0 !0000  c 0 S(%*$1 0(! $1   0P $Q( UU0$Q $1Ś 0P 0S( P0U(1( a0 0,1 -LM(0 p7b00VP(pVAv %P! @A@P 1!0 1!( 0P1D!D, W00  ,0i -L`p@<PP  n djP -0LM@ ,0( P00 0-@LPP UQ0P Q0!311Qa0@"a@p@-0P0 @ 0`0  00  00  00 0 0 0 0 00  00  00  00  00  00  00  00  00  #0 0" ! !0"0 # '0$0& % %0&0$ ' +0(0* ) )0*0( + /0,0. - -0.0, / 30002 1 10200 3 70406 5 50604 7 ;080: 9 90:08 ; ?0<0> = =0>0< ? C0@0B A A0B0@ C 1 G0DFEEFDG ` 0V0pG-M0 咀 0P0呀 @P`pL吠叀 @P`p0P0 0 L0 0 0 兀H儀0D僀@@傀P`p0 <偀8 0 @P`pH0$0D @00<8000tw|04vx 0u0 ~}|{@zPy`xp,t( 0 @!P"`#p40$00%,0&0((0'p00 ,04h jl0r s0pon@mPl`kpdq$i hgf) *(0+,-@.P/`0p$0< 10 @2030405080\ \`0be0a`@Xd c_P^`]p[ ZYX9:;@607 8p0T@?0 @0A0B0C0D0^T0 0TD E0FG崌⾉0 0 ZЍ -LM@p4 00 , 08 40L0 Ƞ< S,ȠL 0X0C8#Ƞ3 X0 08\<#X5 0<0e8#h < a X0` 0n0C 00,`0 0X00 00C8#Ƞ APp@00 0E8X#X4  R 0("X0e8#h 8 0`0l0C0 , ` 8040 ePp80 4 4P㌠!\/ X0 08#X\< " 0<0e8#h<  `Ie00e0 `0@040\ 00C8#ȠQ00X @ -LMP @p`0B8S`RE 00Q 00lU@PT3 V  0S 0Q S0ò000 B0 00C0C0 0 00T00 UU800C800 R -LMP`  a("H T p 0 ʲ0S T0 fP  `ZQ0 Ppd`P 0 0b8#H Tʲ0S  0- LP@0S 0\P 0Q 0S 0S 0S00 -LM@ PQpl 0 RX 00 P) @Y 00d0 0S 0S 0P  0(1 P$1 0$1  $1 0(! @0 d Ƞ Q`ἠ,kP   04p  0 S  1 0]0 00 0S0GP 张@`0 0S07P 0S @ -LMP`  Q@ n, $ 0 0S0P  0Pp 0, S 0 A  ,]0 0  pP!P Y 0(10S$1 0 ! 0S 0P  0P$1 0$1 0-LMP @p 1 00 -L M`@ A nQP, p'P"ᬟP 0 P 0, S 0   \0 0 ğ0 0S0|P  0Pp -LMP<0 80K0 Kp `P@Q0, 10 <KRp8#80CY 0@00PP08#X ("X 0 P L 00< 0@00Q<Y0A  P00<R PP< 0P -RL M`Pp 0 @T 0S @RT ͅ0! A0@ &P@ V00 F P V, 0 10 731 B,0  1@01S -L MQ 1pU, 0 1S{@`x 1Uu 0  \0D 0S0SZ 0 0<3Q B K  1F 0 10S% @ ` 0 Y \ಐ\% 0 Q10  @0 @00, S00 0 P 01-0Q0 P0> P 00 `3 P@ *PP  "P@  1S0C1N00! Q0PQX 0 AQ=Q10 -LMPpPmP@ R0 X 0W@ P  0 AT ^ 0 P @-0@0 @0!00  RCA 0\R! BQ'  0R!<###x#l#`#T#H# 2 2 2 2 2 2 2 2Q 0S !0S: 0-LMPK 00%0 @( 0ST 0S @S 0ST 0SO f[I  E \[00 I10*2 > 0-PU@L P :PP  01Z 0 0 p-LM@ P$K, ,0K $0 (` ` P `p -LM`V (  0SP@ p`@ V`pV@  V 1+#,PP 0p0`S0`` 0 @00, eV`pV@ B<B S=  P UP! 0 0e P0 0p0eS0`e0PVPV: ,PP 0 P0f  000vP P*0P` 0PU:⸜P 0 0c  0P0 V,` `pV@ ,0S? 0Y 1! P Q00P00S$ Q ,PPkY 0p0eS0`e^%P], P 0 0e 0  y000P E  bP0g0,0 Y 0 03 0-0L @R5 P-  0P @0P 0P $00 0 00 QB< S  0  0 0c0 000001lB p-L M0K K@C 00p!`嘛PUhC 0 SP P000pkP` 0 0 px p-LtM@PP`KP0@: S  Q  SL  p( 40R p; 0p0+ 0 p40 -LM, PPpF0S@a@T 0 0S00 p@ 0S 0000 0E#10 0@S000,!0 0 Pp0S P `I -L M`CPP쀟0S6p@T 0S @S 0ST  P ` 0So`0 .p@ 0E#1, 0@S`I 0-LTPM@KT 0K  0  @@Wp,< -LM`@ 0pP`O -LM@5zPP/0:0 p-LMP `@0 : 0ph* -LM@pP  0:0q0:0! -LMp` \0 P@ P@  0-L0MpP0 @0 0SDK@ 0S ,|00@@ t,@ P-L 0 h W 00h*1 p-LM`0p@T 0Pd@00U0  ,PP`@Up0@00pp -dpLMW` P@PUJ0SX@PUZpW`R @0S R@- Mp-LM0`0 @`Ip Mp-LM0`0 @`6pP@-@p `0S0S=S 0S=S PdP U 0S  0R^ 0S ^0=S P00cC10@= -LMK -LM0K *P - LMK0P -LM 0@P@ -LM 0@P@ -QRLtMp` 0@S 0S@b@DT*U00 0P0XR00S @ZJJJJJJJJJJJJJJJJJJ }J xJ sJ nJ iJ dJ _J ZJ UJ PJKJFJAJ=Q:Q:Q:Q:Q:Q:Q}:Qx:Qs:Qn:Qi:Qd:Q_:QZ:QU:QP:QK:QF: QA: Q<: Q7: Q2: Q-: Q(: Q#: Q: Q: Q:Q:Q :Q:QA ? QA ? QA > QA > QA = QA = QA < QA < QA ; QA ; QA : QA : QA 9 QA 9 QA 8 QA 8 QA 7 QA 7 QA 6 QA 6 QA 5 QA 5 QA 4 QA 4 QA 3 QA 3 QA 2 QA 2 QA 1 QA 1 QA 0 QA 0 \aBC`B0QA 0  -LM@Fh\T -LM@\Pp` h^\QU0SD R 0S=W00  00CSAdAAAAAAAAAAAAAAAAAA0 0%S00 1 0 0 ;00 0 0 R 0;S< W  4 R 00R 0, $C@-Q:@- R (2 R R -PPPP RrPP B PP R  R00 B R000Ѥ000l\000Ѥ000 R \6 R B0-.40P<$DL%T \,Ġ̌8 R0 .Ġ̌ RA R B0-.80P8$HH%X X,ȠȌ8 R0 .ȠȌ RA R B0-.<0P4$LD%\ T,̠Č8 R0 .̠Č RA R'0 R@- RP1P P1P RrP1P  B P1P B@  R010 1  B R0q0`0q0`0q0`\0q0`0q0`0q0` R 0\6 R B0@-81, Ġ%̌T$\D#L0P  R0@ Ġ01#̌  R R B0@-81, Ƞ%ȌX$XH#H0P  R0@ Ƞ01#Ȍ  R R B0@-81, ̠%Č\$TL#D0P  R0@ ̠01#Č  R -- L`^M@pTA0TPC/M_K 0 KKM?KPE@`1 4a 0a d0K?aK@D 0KQ |A Q A u1` 0S  -R0 0c BSR48 R p-@P`x BRpR0 BRRR2**x *J *** -p@L00l8#hP M08#x `0 0c8#h@08#x 0b0C`p`0 -LM@P 0S p7U0R G0`8U#h 0  b Rʂ0 S00@0@@0@Rڰ 0000G000A8  B8 000o# -L4M@ 0< 开@ PD p <0Px D0@ 00  0 ZH P L *P0<S`R0000 l , M@0g\0KH8 K8' 0080 0 c4 CP08#8P0 0ZpPP0n0 a B 00ഀD   000#8ᲀL  L 08# asL0 00`0ᲀPD  0<@ D   000 -LLMT X PpP 0L8#hL \\P ` h [00C8S 0@TL s \d `E0S@@KHKd0@ @ b 00H0 0L c@d@ P P3 0S 0 00S L Pp   00008#h\0 0S\`0S L'\0S 0 00S\  TLPT \ \  hT 000 0a0C0 h 0b0C 0X L0pPX L` X0@QPh  L X` eX 8K TP X0LPP4PT 8pW\ 0 RL0X P X -LM@p0Qs P`0 R=V0e S0 0RS 00P U*V0 00Q *^ 0P@  0Y008 8(40Poq P0 00S"P@ 0S 0 00S 0pP  Q p-LM40@SP`$ 000`!H 0 Pp0000000 0 B@ 0p00S40040 -L M`pxQ  0 0C0ppSa <0R@W  P@0Pp  P P>Y 0S00C0pp  ,1R Y 0C\0K 1 00  0 !0  00[\002K)0[* [0 0\ʌ0 0"K+ [,[ \@NO0 0@0@0<  JPPBJ@ @00@ -L MPx`p@ `  1R TI 0CP0K100  0!0  00[P0Z" <0W@  P@0PNp  P MO0 0B@0@0< J PpBJ@ 2@00@0Tʀ0 0"K) [*[ Pڸ5P  -LM` ~0H20APP p0 101  d 020 0  崜8Q0 00P -L M  !4 0pD $0@SQ!P40 BU00 ,P 18aV U 0, 1 CU@  T pb @ TPU00ZD0 $0@0@@c TD ZF !4 0@  A@ D@ 010CY ?=2!I !U08#X&ʊU0 aP`40@ D0 T0D0Z 1@@ AU@ D 1  L001  Ld@?=2D  $0!E!P@T$ U D0T P U D0TU1@ \0@bT5У 0$10C@/-"@dP`S -0p8#(=1@0@A0C$0^^ 18a!$ BVLP ?=2!E.!h}` -LAMp0P 0 [MANK0AnK @D `FS@D `F) \0 0 AK A0A $4 0s1 P   0 pS $ 嗔XT -L MⰀ0ሐ` 0cV8#Ƞ, F0@p P0 100 0c8#Ƞ 0 &밀,000 0Pc PEP00@ -LM1@QPap ώ0 Rp8! ,5P8q8pR0-P@ 0bR03 B0 -Lᴃ%s: %s not compiled in instbinUsage: %s ..., where is one of: mount_cd9660dfmountmount_ext2fssyncnewfs_msdossttylndisklabelpaxtarcpiofsck_ext2fscatifconfigrtsolping6lessmoremount_nfsfdiskgrepfgrepegrepumountmount_msdosfsckmknodreboothaltmount_ffsdhclientcpgzipgunzipgzcatchmodchgrpchownfsck_ffsnewfsrmmtejectmkdirksh-shsleepmvexprdmesghostnamebb [ c8@@GX cccЉ @@ccbsconvfilesifobsofskipno value specified for %sunknown operand %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationscbs cannot be zerobuffer sizes cannot be zeroseek offsets cannot be larger than %qdconv option disabled%s: illegal numeric valuefiles is not supported for non-tape devicesstdoutinput bufferoutput buffercase conv and -DNO_CONV%s: end of device%s: short write on character device%s: short write on tape device%zu+%zu records in %zu+%zu records out blockblocks%zu odd length swab %s %zu truncated %s %qd bytes transferred in %ld.%03ld secs (%0.0f bytes/sec) summaryskip reached end of inputffcfffffffffuserquotagroupquotarwautoaccesstimeatimedevexecsuidrdonlyupdateegjo:Rcd9660%s: Filesystem not supported by kernelrealpath %s%s on %susage: mount_cd9660 [-egjR] [-o options] special node %s: illegal value '%s'needsdoes not need-o %s: option %s a value-o %s: option not supportedhiklnPt:retrieving information on mounted file systems%s mounted as a %s file system%s is not a local file system-i is incompatible with -Ponly one -t option may be specified.empty type list %7s%-*.*s %*u %9u %9d %5.0f%% %7u %7u %5.0f%% 1K-blocks%-*.*s %s Used Avail CapacityFilesystem Mounted on iused ifree %%iused Size%-*.*s %s Used Avail Capacity1024-blocks 512-blocks%-*.*s %s Used Available Capacity Mounted on %-*.*s %*d %10ld %11d %5.0f%% %s df: %qd: %s usage: %s [-hiklnP] [-t type] [[file | file_system] ...] ffsext2fskerberos uid mappingNFS exportedanon uid mappingexported read-onlynoatimenoaccesstimenodevnoexecnosuidwith quotasread-onlyroot file systemsynchronoussoftdepasynchronousasyncexported to the worldAadfo:rswt:uvforcerqnoauto/var/run/mountd.pidsignal mountdgetmntinfo:@nfsunknown special file or file system %s.root_devicecan't find fstab entry for %s.%s has unknown file system type./usr/sbinexec: mount_%smountfsstatfs %s%s/mount_%sexec %s for %sno mount helper program found for %sforkalready mounted%s on %s type %.*s: %s %s on %s type %.*s (%sunknown flag%s %#xv2v3udptcpsoftintrnoconn%s%s=%dwsizersizerdirsizetimeoretransmaxgrouplistreadaheadacregminacregmax, %s=%dacdirminacdirmaxprmounthardmfs%s%s=%lu %sadosfs%s%s=%u, %s=%u%s%s=0%omsdosshortnowin95gemdirexecnorripgensextattprocfslinuxversion %d, ctime=%s%s,%s-o[-Aadfruvw] [-t ffs | external_type][-dfrsuvw] special | nodeusage: mount %s %s mount %s mount %s [-dfruvw] [-o options] [-t ffs | external_type]special nodeufs%s: fstab type %s != disklabel type %s%s: fstab uses outdated type 'ufs' -- fix pleaseffcfffffffffmount table fullspecified device does not match mounted device%s on %s: %sfilesystem not supported by kernelusage: mount_ext2fs [-o options] special node $FreeBSD: src/sbin/newfs_msdos/newfs_msdos.c,v 1.9 1999/08/28 00:13:52 peter Exp $%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) %s: can't read sector %u%s: can't write sector %uNO NAMEFAT%uBSD 4.4%u clusters too few clusters for FAT%u, need %uwarning: sectors/FAT limits file system to %u clusterstoo few reserved sectorsno room for backup sectorbackup sector would overwrite info sectorno room for info sector/boot/%s%s: inappropriate file type or format160180320360720120014402880%s: bad FAT typevolume ID%s: bad volume label%s: bad OEM stringbytes/sectorsectors/FATsectors/clusterdirectory entriesdrive headsmedia descriptornumber of FATshidden sectorswarning: %s is not a character devicebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %u-%c is not a legal FAT%s optionblock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)too many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: FAT type limits file system to %u sectors/dev/%s is mounted on %s%s: unknown standard format%s: can't figure out partition info%s: partition is unavailablegetdiskinfo%s: unknown disk typeioctl (GDINFO)%s: can't read disk label; disk type must be specifiedbps=%u spc=%u res=%u nft=%u mid=%#x spt=%u hds=%u hid=%u bspf=%u rdcl=%u infs=%#x bkbs= bsec=%u spf=%u sec=%u rde=%u%s: no default %s%s: illegal %s%s: bad %s"*+,./:;<=>?[\]|usage: newfs_msdos [ -options ] special [disktype] where the options are: -N don't create file system: just print out parameters -B get bootstrap from file -F FAT type (12, 16, or 32) -I volume ID -L volume label -O OEM string -S bytes/sector -a sectors/FAT -b block size -c sectors/cluster -e root directory entries -f standard format -h drive heads -i file system info sector -k backup boot sector -m media descriptor -n number of FATs -o hidden sectors -r reserved sectors -s file system size (sectors) -u sectors/track X` h}l̅mt|    (:ăȃЃ؃  #3# 3(20383@#H@P@8!@X@`hpxĄ̄Ԅ܄  @@ $,4<sDLT\dlt|  pȅԅ܅ $08@HP@X@d@l@x    Ć̆Ԇ@܆@  C$C C$C(4@LT\dlt|  @ć@̇ԇ܇discarddsuspeofeol2lnextminquitreprintstartstatusstopsuspflushrprntoption requires a numeric argument -- %smaximum option value is %d -- %sundefoption requires an argument -- %sillegal gfmt1 option -- %sillegal gfmt1 optiongfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:ispeed=%d:ospeed=%d %s=%x:%lxoflagospeedlflagiflagispeedcflagcbreakcolscolumnscookeddecekeverythingextproclcasenewoldostartostoprawrowssanespeedttyillegal option -- -%s%d %d TIOCSETDTIOCSTARTTIOCSTOPcs5cs6cs7cs8cstopb-cstopbcread-creadparenb-parenbparodd-paroddparity-parityevenp-evenpoddp-oddppass8-pass8hupcl-hupcl-hupclocal-clocalcrtscts-crtsctsmdmbuf-mdmbufignbrk-ignbrkbrkint-brkintignpar-ignparparmrk-parmrkinpck-inpckistrip-istripinlcr-inlcrigncr-igncricrnl-icrnliuclc-iuclcixon-ixon-flowixoff-ixofftandem-tandemixany-ixanydecctlq-decctlqimaxbel-imaxbel-echoechoe-echoecrterase-crterasecrtbs-crtbsechok-echokechoke-echokecrtkill-crtkillaltwerase-altweraseiexten-iextenechonl-echonlechoctl-echoctlctlecho-ctlechoechoprt-echoprtprterase-prteraseisig-isigicanon-icanonnoflsh-noflshtostop-tostopflusho-flushopendin-pendin-crtnewcrt-newcrtnokerninfo-nokerninfokerninfo-kerninfoxcase-xcaseopost-opostlitout-litoutocrnl-ocrnlolcuc-olcuconlcr-onlcronlret-onlretonocr-onocrtabs-tabsoxtabs-oxtabsonoeot-onoeottablet disc; ispeed %d baud; ospeed %d baud;lflags-extprociflagsoflagscflags%-8scchars%s = %s; %d rows; %d columns;speed %d baud;#%d disc; slip disc; ppp disc; strip disc; nmea disc; -aefgaef:gTIOCGETDTIOCSWINSZtcsetattrgfmt1illegal option -- %sTIOCGWINSZnot a terminalusage: %s [-a|-e|-g] [-f file] [operands] @(#) Copyright (c) 1987, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: ln.c,v 1.14 2006/04/25 04:38:26 deraadt Exp $Ffhnslinkit%s/%susage: %s [-fhns] sourcefile [targetfile] %s [-fs] sourcefile ... [targetdir] @(#) Copyright (c) 1987, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: disklabel.c,v 1.98 2006/07/01 16:50:33 krw Exp $b̰,,$Ddh\{sƑOJ˻qKIc%*d'`wX\+5/`IIljwt9{~q߽x'yt^d(1<;A9`J;?~]8 PMhumn;^^mMy۶4>dN>`6bh,{sV'2:^ ̋Uo`U;|ب^La5þz( ,:jT^L f`FCn,/sKi;Lun٘n0[fjO/iܺ-X|2g, kJ O Vz+Wm];G)# ĬWm;ءWL1UָjK8F(6.- v0<$L+Ȝto׽ڒ4fxu !0c2b;kOi'єuVkGQN \JDE3v%nNZK6Ap>o`NGLcS̰xR[e9"-פ,<(G~^7f*tN,m0W hHkTz$s2{|c( ڞf>_v~j8󫳫eJՒvg3vK $vT/\Pa e0v S8%jFS0 ~ YiPhla % / *JtW/庹3}lPTotwf$7ш1&jahVKŗ'9c7CQN6$aێ57 J&Z9X\p$w6oُI I ބ䃫U5:jvPAjBb00&b9zen)` ̫THy(5`, \0Vf`@dQ>6k-Lwƚ^ո^邻ZmӸ"}m -cKVbm85-퓔w#(b?yצ)unnWrekRZ8¸Ť8z:pSԃI<|4 2谁-Xdv;n5TZb&3CC_6WE!QPt!N'G9 (Bc i՝/..CEe@Vld3h-By,g-L y.[כOyY-V(LUTXo>Q/^o);vhR0S#KdezaH rX7?($Q3OQKCC悯 ijnB06lMaLQnUEHGHxR6X.4grozYΡ}i$ppuJA`y@ ĘS gY_.N" $&WmjЧOVg0H:@lP7ÐTG<4E _kOҏh) /"X?14]d`SzlXq[rV|N|%!N9e`"GP| Cjڶ`E35b%Gp.FiS^cI6۵Gc]~.qt8!”KCq4 nWLjNٯ ]Ȉ16{e`f|*(b~M0B^hq"k[0*Xk9ނ6&7\n=LFh&9` Nv J/񚄦7`KflC+XsgT*fn=RjXu'3k_Y Yz<ߎǖ sZ5.fK3 q:n8;'909^`0.0BJ3u"Eoh ۍ >}X,UAox>Ks#qB$ms ?0ױQ^2RO+h:I<=!4m-,=az Ugv(PO)pf- Ԥ:Мu$OaC&PAZPSKh`%g7Qt=NHXh~HC2p(: 2d#.5c$a毜TN gKxz hM°B!,~s8G{ WqC @[YNߎ oQU@_Bֵm\mq[ynhZ*Pu`Ѽ6:eb=@SjȍܬiX7,\=9[3|eN8z.geT 2?p -yzn~pIY8Qp3lfhc0P+̹|qx޷9> EKH{0`9DN;ye M7vfFqAH]F9"^~ }9[OQ6͕$fq;7`gAFZ"vXA3Ҳ䰉@Kz@0zpFji~8 _n40O*SDS,.h4SH"r4KlXxP@>Ռ8JSovtHW!\j)&t]* pQ)ynr6oF V;{( 4IU8Dт:Q=Zz#e@vפ~J.l)%驨WϷ=aLx\ɞB̨QڝlL nK~6bD%D»- +ކQmD״'oX_)b:U#N;Wj1WEF!AK550`8l*+s2 7~&堘p`^c t7RXz'*l'OnUjGM.WF}l>L\5d҂Dav&Bw|5>hIm`ޥGy)UOJcqd@W&,T#E`|Za@T8"W(:ds#ŻB]@܂)-Oti E˼áZ\:[(bC rUynvn#y.j g:э~< 6IV*TzJ󐯳s-v'v6)Jqul|$ Lj ID[.pr :sYo`~NGeݠ*9i쯒8^r8L܀jM-On&kN*K:&/Ĩ, H ",4*8 &~D?(S3Z%> S=w殽Z4&NYcڲ*udާR}.&I3#v̿MAL@/4l9 MbcGl$ZQ^ϜH[:B:_NBhvӎuIcCL# 0}1n1^h/XC?\g+0&I=.,0)]^˥5s{& S"1Z5eK>Sc]KGBr#>s{i[cv nb ~؇3{u9("tvݙ77è//D8^2Cp [T41A#l}vyi>ȵROP’dZ{lǓ|SN4n}t~\ơJU/T.A*ukT@!,A \KWIM(c׸ߞ=W1)Xkʱu[`ށGEy!Jv*inW+ޙA[y v&ѩNi3&#OɤPYp,§cN0uBhdUށj݈uqZ͢l7?k"7cN/Mgh$Vz؂@iAKrcNtraMmK>4 iiVpm *4 TQݵI=.p {gZR6]m )|;Ze{i|o"c(}zzu.KФ\}ьܬsf8(7un.=.C.)q7S9R]z,)-_4a\:u_&܊ CUY XxetHHjMcV# rL4zZCB4߈>)>Z0>P| $'QdlMBpq I#I1R$~shɂOPcdẸÖ /e q{PWܱ=(_JquWߙf3y_π-=1Ny8RL $s0O:ُz`-OƯpeXn|ʡKZ8= :9Sp|J J3X `c֝W0rK1kS;kqA EI4ݤI~}{]|}'DS=O|:VJc'mO&4|3KqnK]}fљB™l髹 o΄"Q#C w]a4YjUВkgi@>Gś[~/LYoMvpӊ=&p VG}N/PsyՐbA> [*XS+ϼޣY>1hݍf挒6<̡(]k MO,jrs/\2=n?X$o)yI>ڒ }Gn3d60YmP- 7k5؋&z:5G:k b֋ QtϠ@澌 ejڱ5.L"ޡy4 ӪŔuNCsPvG7xw< /ch8]!OHx`t@,;>8jPF< >S4FiS{FGr7;,U Qxm(M!E^QjLHA ;Kfz2{o"-x,u}7JRa%qWlm[L/ %>,C?Юεrhf L䩏rz@2γiؑ똂Mo[ JÊ^ ,0Omz >#@nZ2.{&;)䴔Kx`#p2$77@\rT]ZnܺbCyJ]qQZ5 &o?p%ϥ[v=///߇^b0~ĝa]g\̜pNY۠ž.YD7t8K(5}k#,vRbh1?ߟO([ CFTa2J-s uE::gϾ*(?t!5IܪCyʒtG'pbBB3ނa_>&Hݱd2!${HCb32/uQo̊kI"IxP${W&NܨUv[7Ad`UlG*=<29C%%`=WB$er9U;xGty9n&+g(6{t$"<-yv=noѱ=!/VL>Bb!nWe]c-,RjD([p0'l.jӺC京9(}Ѹ߻~Ӷ9NXU3|@,[é6vOъ ͳ5rEm[Dt!=<tgh&K^O'#١e1؜?9iPfadosudfunknownSMDMSCPold DECSCSIESDIST506HP-IBHP-FLtype 9floppyccdvndATAPIRAIDunusedswapVersion6Version7SystemV4.1BSDEighth-Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSHFSADFSNTFSUDFBEf:NRWb:cdenp:rs:tvwbckmgioctl DIOCWLABELunknown disk type: %sDANGER! The disklabel was not found at the correct location!To repair this situation, use `disklabel %s > file' tosave it, then use `disklabel -R %s file' to replace it.A new disklabel is not being installed now.Erase the previous contents of the disk? [n]: writelseekwriting label to block %lld (0x%qx) ioctl DIOCSDINFOioctl DIOCWDINFO%s: No disk label on disk; use "disklabel -r" to install initial label%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of disk%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)can't read master boot recordwarning, DOS partition table with no valid OpenBSD partition# Inside MBR partition %d: type %02X start %u size %u no disklabel found. scanning.no disk labeldisk label corruptedfound at 0x%lxreading label from block %lld, offset %lld ioctl DIOCGPDINFOioctl DIOCGDINFOioctl DIOCRLDINFOBootstrap doesn't leave room for disk label\ :Automatically generated label:\ :dt=se#%u:ns#%u:nt#%u:nc#%u:sc#%u:su#%u:%srm#%hu:%sil#%hu:d%d#%up%c#%u:o%c#%u:t%c=%s:t%c=unknown%d:b%c#%u:f%c#%u:%sts#%u:%shs#%u:%scs#%hu:%ssk#%hu:%.*s| %c: %12.*f%c %12.*f%c %7.7s%7d%19.19s# %s# Cyl %5u-%6u %5u %5u %4hu %5u %5u %4.4s %c: %13u %13u device: %s # %s: type: %s type: %d disk: %.*s label: %.*s bytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total bytes: %.*f%c free bytes: %.*f%c rpm: %hu %hu partitions: offset# %13.13s %13.13s fstype [fsize bsize cpg] interleave: %hu trackskew: %hu cylinderskew: %hu headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %d free sectors: %u total sectors: %u badsect ecc removable # Notes: # Up to 16 partitions are valid, named from 'a' to 'p'. Partition 'a' is # your root filesystem, 'b' is your swap, and 'c' should cover your whole # disk. Any other partition is free for any use. 'size' and 'offset' are # in 512-byte blocks. fstype should be '4.2BSD', 'swap', or 'none' or some # other values. fsize/bsize/cpg should typically be '2048 16384 16' for a # 4.2BSD filesystem (or '512 4096 16' except on alpha, sun4, ...) re-edit the label? [y]: editNo changes.-cEDITOR/usr/bin/vifailed to start editor/bin/sh # line %d: syntax errorIDEline %d: warning, unknown disk type: %sremovableeccbadsectline %d: bad flag: %sdrivedataline %d: bad drivedata %s%d partitionsline %d: bad %s: %ssectors/cylindertracks/cylindercylinderstotal sectorsrpmtrackskewcylinderskewheadswitchtrack-to-track seekline %d: bad partition name: %sline %d: warning, unknown filesystem type: %sline %d: too few fieldsline %d: bad partition offset: %sgetasciilabelline %d: bad partition size: %sline %d: unknown field: %sline %d: bad # of partitionssector size %dtracks/cylinder %dwarning, unused partition %c: size %d offset %dpartition %c: block size < fragment sizepartition %c: partition extends past end of unitpartition %c: offset past end of unitwarning, partition %c: size 0, but offset %dwarning, number of partitions (%d) > MAXPARTITIONS (%d)warning, super block size %% sector-size != 0super block size %dwarning, boot block size %% sector-size != 0boot block size %dwarning, revolutions/minute %dcylinders/unit %dsectors/track %dcmplabel usage: disklabel [-c | -d | -r | -t] [-v] [-p unit] disk (read) disklabel -w [-c | -d | -r] [-nv] disk disktype [packid] (write) disklabel -e [-c | -d | -r] [-nv] disk (edit) disklabel -E [-c | -d | -r] [-nv] [-f tempfile] disk (simple editor) disklabel -R [-nrv] disk protofile (restore) disklabel -N | -W [-nv] disk (protect) disklabel -B [-nv]%s disk [disktype] (boot) disklabel -Bw [-nv]%s disk disktype [packid] (write) disklabel -BR [-nv]%s disk protofile [disktype] (restore) `disk' may be of the form: sd0 or /dev/rsd0%c. `disktype' is an entry from %s, see disktab(5) for more info. /etc/disktab`packid' is an identification string for the device. `protofile' is the output from the read cmd form; -R is powerful. For procedures specific to this architecture see: %s fdisk(8)You need to specify a type for this disk.No 'c' partition found, adding one that spans the disk. Initial label editor (enter '?' for help at any prompt) unable to get default partition tablePAGER/usr/bin/lessgunzip -qc|%sunable to execute %sEnteringExiting%s expert mode This option is not valid when run without the -f flag. Write the modified label to disk?Write new label?unable to write labelNo label changes.In no change mode, not writing label.Recalculated free space.cannot open %sFilenameName of the file to save label into.Nothing to undo!Last change undone.Unknown option: %c ('?' for help) can't run when there is partition overlap.Partition must be between 'a' and '%c' (excluding 'c'). editor_add Please re-enter an offset and size for partition %c. Partition '%c' exists. Delete it first. The letter of the new partition, a - p.partitionPartition '%c' already exists. Partition must be between 'a' and '%c'. No space left, you need to shrink a partition Partition '%c' is not in use. You cannot name a filesystem of type %s. partition to nameThe letter of the partition to name, a - p.Command aborted Please re-enter an offset and sizeWarning, need %u sectors but there are only %u free. Setting size to %u. partition to modifyThe letter of the partition to modify, a - p.You may not delete the 'c' partition. The 'c' partition must exist and should span the entire disk. By default it is of type 'unused' and so does not take up any space. The letter of the partition to delete, a - p, or '*'.partition to deletePartition %c is currently %u sectors in size (%u free). new sizeSize of the partition. You may also say +/- amount for a relative change.Invalid entry Only %u sectors free, you asked for %u 'c' partition may not be larger than the disk partition to change sizeThe letter of the partition to change size, a - p.%s: [%s] %s: [%u] Rounding to nearest cylinder: %u getuinthas_overlap Error, partitions %c and %c overlap: Disable which one? (^D to abort) [%c %c] Changing device parameters for %s: What kind of disk is this? Usually SCSI, ESDI, ST506, or floppy (use ESDI for IDE)."%s" is not a valid disk type. Valid types are: "%s"label name15 char string that describes this label, usually the disk name.The Numer of sectors per track.The number of tracks per cylinder.The number of sectors per cylinder (Usually sectors/track * tracks/cylinder).number of cylindersThe total number of cylinders on the disk.The total number of sectors on the disk.Not enough free space to shrink by %u sectors (only %u sectors left) The rotational speed of the disk in revolutions per minute.The physical sector interleave, set when formatting. Almost always 1.edit_parmsYou may want to increase the size of the 'c' partition.failed to sort partition tablesdrzFLOPPYxdhdCCDVNDsvndPossible values are:"IDE", Disk typeWhat kind of disk is this? Usually SCSI, IDE, ESDI, CCD, ST506, or floppy.Starting sectorThe start of the OpenBSD portion of the disk.Size ('*' for entire disk)The size of the OpenBSD portion of the disk ('*' for the entire disk). Treating sectors %u-%u as the OpenBSD portion of the disk. You can use the 'b' command to change this. The 'p' command prints the current disk label. By default, it prints the size and offset in sectors (a sector is usually 512 bytes). The 'p' command takes an optional units argument. Possible values are 'b' for bytes, 'c' for cylinders, 'k' for kilobytes, 'm' for megabytes, and 'g' for gigabytes. The 'D' command will set the disk label to the default values as reported by the disk itself. This similates the case where there is no disk label. The 'M' command pipes the entire OpenBSD manual page for disk label through the pager specified by the PAGER environment variable or 'less' if PAGER is not set. It is especially useful during install when the normal system manual is not available. The 'X' command toggles disklabel in to/out of 'expert mode'. By default, some settings are reserved for experts only (such as the block and fragment size on ffs partitions). The 'a' command adds new partitions to the disk. It takes as an optional argument the partition letter to add. If you do not specify a partition letter, you will be prompted for it; the next available letter will be the default answer The 'b' command is used to change the boundaries of the OpenBSD portion of the disk. This is only useful on disks with an fdisk partition. By default, on a disk with an fdisk partition, the boundaries are set to be the first and last sectors of the OpenBSD fdisk partition. You should only change these if your fdisk partition table is incorrect or you have a disk larger than 8gig, since 8gig is the maximum size an fdisk partition can be. You may enter '*' at the 'Size' prompt to indicate the entire size of the disk (minus the starting sector). Use this option with care; if you extend the boundaries such that they overlap with another operating system you will corrupt the other operating system's data. The 'c' command is used to change the size of an existing partition. It takes as an optional argument the partition letter to change. If you do not specify a partition letter, you will be prompted for one. You may add a '+' or '-' prefix to the new size to increase or decrease the existing value instead of entering an absolute value. You may also use a suffix to indicate the units the values is in terms of. Possible suffixes are 'b' for bytes, 'c' for cylinders, 'k' for kilobytes, 'm' for megabytes, 'g' for gigabytes or no suffix for sectors (usually 512 bytes). You may also enter '*' to change the size to be the total number of free sectors remaining. The 'd' command is used to delete an existing partition. It takes as an optional argument the partition letter to change. If you do not specify a partition letter, you will be prompted for one. You may not delete the ``c'' partition as 'c' must always exist and by default is marked as 'unused' (so it does not take up any space). The 'e' command is used to edit the disk drive parameters. These include the number of sectors/track, tracks/cylinder, sectors/cylinder, number of cylinders on the disk , total sectors on the disk, rpm, interleave, disk type, and a descriptive label string. You should not change these unless you know what you are doing The 'g' command is used select which disk geometry to use, the disk, BIOS, or user geometry. It takes as an optional argument ``d'', ``b'', or ``u''. If you do not specify the type as an argument, you will be prompted for it. The 'm' command is used to modify an existing partition. It takes as an optional argument the partition letter to change. If you do not specify a partition letter, you will be prompted for one. This option allows the user to change the filesystem type, starting offset, partition size, block fragment size, block size, and cylinders per group for the specified partition (not all parameters are configurable for non-BSD partitions). The 'n' command is used to set the mount point for a partition (ie: name it). It takes as an optional argument the partition letter to name. If you do not specify a partition letter, you will be prompted for one. This option is only valid if disklabel was invoked with the -F flag. The 'q' command quits the label editor. If any changes have been made you will be asked whether or not to save the changes to the on-disk label. The 'r' command is used to recalculate the free space available. This option should really not be necessary under normal circumstances but can be useful if disklabel gets confused. The 's' command is used to save a copy of the label to a file in ascii format (suitable for loading via disklabel's [-R] option). It takes as an optional argument the filename to save the label to. If you do not specify a filename, you will be prompted for one. The 'u' command will undo (or redo) the last change. Entering 'u' once will undo your last change. Entering it again will restore the change. The 'w' command will write the current label to disk. This option will commit any changes to the on-disk label. The 'x' command exits the label editor without saving any changes to the on-disk label. Available commands: ? [cmnd] - this message or command specific help. a [part] - add new partition. b - set OpenBSD disk boundaries. c [part] - change partition size. D - set label to default. d [part] - delete partition. e - edit drive parameters. g [b|d|u] - use [b]ios, [d]isk or [u]ser geometry. M - show entire OpenBSD man page for disklabel. m [part] - modify existing partition. n [part] - set the mount point for a partition. p [unit] - print label. q - quit and save changes. r - recalculate free space. s [path] - save label to file. u - undo last change. w - write label to disk. X - toggle expert mode. x - exit without saving changes. z - zero out partition table.Numeric parameters may use suffixes to indicate units: 'b' for bytes, 'c' for cylinders, 'k' for kilobytes, 'm' for megabytes, 'g' for gigabytes or no suffix for sectors (usually 512 bytes). '%' for percent of total disk size, '&' for percent of free space. Non-sector units will be rounded to the nearest cylinder. Entering '?' at most prompts will give you (simple) context sensitive help.The 'z' command zeroes out the existing partition table, leaving only the 'c' partition. The drive parameters are not changed. mpsave%s%c %s %s rw 1 %d Starting sector for this partition.The OpenBSD portion of the disk starts at sector %u, you tried to add a partition at %u. You can use the 'b' command to change the size of the OpenBSD portion. The OpenBSD portion of the disk ends at sector %u, you tried to add a partition at %u. You can use the 'b' command to change the size of the OpenBSD portion. Size of the partition.Sorry, there are only %u sectors left The OpenBSD portion of the disk ends at sector %u, you tried to add a partition ending at sector %u. You can use the 'b' command to change the size of the OpenBSD portion. Size may not be larger than %u sectors Size of fs block fragments. Usually 2048 or 512.Zero fragment size implies zero block sizeSize of filesystem blocks. Usually 16384 or 4096.Error: block size must be a multiple of the fragment size. Error: block size must be at least as big as fragment size. Error: block size must be at least as big as page size (%d). cpgNumber of filesystem cylinders per group. Usually 16 or 8.FS type (decimal)Filesystem type as a decimal number; usually 7 (4.2BSD) or 1 (swap).FS typeFilesystem type (usually 4.2BSD or swap)Unrecognized filesystem type '%s', treating as 'unknown' noneWhere to mount this filesystem (ie: / /var /usr)Mount points must start with '/' Can't stat deviceBIOS geometry not defined. You must enter either 'd', 'b', or 'u'. Note: user geometry is the same as disk geometry. Enter 'd' to use the geometry based on what the disk itself thinks it is, 'b' to use what the BIOS says,or 'u' to use the geometry that was found on in the label.[d]isk, [b]ios, or [u]ser geometry$OpenBSD: ar_io.c,v 1.37 2005/08/04 10:02:44 mpf Exp $$OpenBSD: ar_subs.c,v 1.30 2006/07/21 22:56:58 ray Exp $$OpenBSD: buf_subs.c,v 1.21 2005/11/09 19:59:06 otto Exp $$OpenBSD: cache.c,v 1.17 2004/03/16 03:28:34 tedu Exp $$OpenBSD: cpio.c,v 1.17 2004/04/16 22:50:23 deraadt Exp $$OpenBSD: file_subs.c,v 1.30 2005/11/09 19:59:06 otto Exp $$OpenBSD: ftree.c,v 1.26 2005/04/21 21:47:18 beck Exp $$OpenBSD: gen_subs.c,v 1.18 2005/04/28 06:58:07 otto Exp $$OpenBSD: getoldopt.c,v 1.8 2003/07/02 21:19:33 deraadt Exp $$OpenBSD: options.c,v 1.64 2006/04/09 03:35:34 jaredy Exp $$OpenBSD: pat_rep.c,v 1.30 2005/08/05 08:30:10 djm Exp $@(#) Copyright (c) 1992, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: pax.c,v 1.28 2005/08/04 10:02:44 mpf Exp $$OpenBSD: sel_subs.c,v 1.18 2004/04/16 22:50:23 deraadt Exp $$OpenBSD: tables.c,v 1.23 2005/04/21 21:47:18 beck Exp $$OpenBSD: tar.c,v 1.41 2006/03/04 20:24:55 otto Exp $$OpenBSD: tty_subs.c,v 1.12 2003/06/02 23:32:09 millert Exp $Cannot write an archive on top of a directory %sFailed stat on %sFailed chdir to %sFailed open to read on %sFailed open to write on %sFailed open to read/write on %s%s: unknown format, %qu bytes skipped. %qu blocks %s: %s vol %d, %lu files, %qu bytes read, %qu bytes written. done. %s: Waiting for tape drive close to complete...ar_drainUnable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specEnd of archive volume %d reachedFailed read on archive volume %dWARNING: partial archive write. Archive IS FLAWEDWARNING: partial archive write. Archive MAY BE FLAWEDFailed write to archive volume: %dUnable to append, trailer re-write failed. Quitting.Write failed, archive is write protected.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Cannot allow updates to an archive with flaws.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to seek archive backwardsReverse position on previous volume.Unable to obtain current archive byte offsetUnable to backspace tape %d blocks.Tape drive unable to backspace requested amountget_physUnable to backspace tape over %d pad blocksUnable to backspace over tape filemark.Unable to locate tape filemark.Cannot determine archive tape blocksize.Unable to backspace over last tape block.ar_next ATTENTION! %s archive volume change required. %s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot open %s, try again Cannot save archive name.Quitting %s! %s ready for archive tape volume: %d Load the NEXT TAPE on the tape driveReady for archive volume: %d Unable to restore signal maskUnable to set signal maskcould not pipecould not forkcould not exec-dcCan't fchdir to starting directoryCannot chdir to %sextractUnable to open %s to readCannot mix current archive format %s with %sappend%s: Reading archive to position at the end...directory name is too long %scopyDestination is not a directory %sDestination pathname too long %sCannot access destination directory %sArchive I/O error. Trying to recover.Archive I/O error, cannot continuePremature end of file on archive readInvalid header, starting valid header search.Unable to append, archive header flawCannot identify format. Searching...Sorry, unable to determine archive format.Write block size of %d too large, maximium is: %dWrite block size of %d larger than POSIX max %d, archive may not be portableWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximium is: %dWrite block size %d is not a %d byte multipleUnable to rewrite archive trailer, cannot append.Cannot append to an archive that may have flaws.Archive read error limit (%d) reachedUnable to append when there are archive read errors.File changed size during read %sFile %s was modified during copy to archiveRead fault on %sActual crc does not match expected crc %sUnable to obtain block size for file %sFile %s changed size during copy to %sFile %s was modified during copy to %sFailed stat of %sFailed write during copy of %s to %sUser specified archive volume byte limit reached.Unable to allocate memory for user id cache tableUnable to allocate memory for group id cache tableUnable to allocate memory for user name cache tableUnable to allocate memory for group name cache tableTRAILER!!!cpio_endwrCpio file name in header is corruptedCpio file name length %d is out of rangeCpio link name is corruptCpio link name read errorCpio link name length is invalid: %qu070707File is too large for cpio format %sCpio header field is too small to store file %scpio_wrUnable to write cpio link name for %sUnable to write cpio header for %s070701070702File is too large for sv4cpio format %sSv4cpio header field is too small for file %svcpio_wrCould not write sv4cpio link name for %sCould not write sv4cpio header for %sFile is too large for bcpio format %sbcpio_wrBcpio header field is too small for file %sCould not write bcpio link name for %sCould not write bcpio header for %sUnable to create %sUnable to close file descriptor on %sA hard link to the directory %s is not allowedUnable to link to %s from %sUnable to copy %s, file would overwrite itselfCould not link to %s from %sUnable to remove %sUnable to link file %s to itselfCould not create: %snode_creatCould not access %s (stat)cannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCould not unlink %sUnable to remove directory %sAccess/modification time set failed on: %sUnable to obtain file stats %sUnable to set file uid/gid of %sCould not set permissions on %sFailed write to file %sOut of memoryFile seek on %sWARNING! Major Internal Error! GNU hack Failing!Failed seek on file %sFile changed size %sset_crcFile %s was modified during readFile rewind failed on: %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:Can't chdir to %sFile system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %sIgnoring too-long pathname: %sIgnoring unterminated pathname at EOFls_list%b %e %H:%M%b %e %Y%s%2u %-*.*s %-*.*s %4lu,%4lu == => %9qu %s%s %s ls_tty%s: unknown option %c %s: %c argument missing bcpiosv4cpiosv4crcustarab:cdf:iklno:p:rs:tuvwx:zB:DE:G:HLOPT:U:XYZ0Write limit is not a %d byte multipleInvalid write limit %sError count value must be positiveInvalid block size %sInvalid -p string: %cUnknown -x format: %spax: Known -x formats are:Destination directory was not suppliedb:cef:hmopqruts:vwxzBC:HI:LOPXZ014578/dev/rst0/dev/rst1/dev/rst4/dev/rst5/dev/rst7/dev/rst8Unable to allocate space for option listTAPEProblem with file '%s'Unable to open file '%s' for read-C-Iwrite_opt=nodirabcdfiklmoprstuvzABC:E:F:H:I:LO:SZ6Unknown -H format: %scpio: Known -H formats are:Problem while reading stdin%s: Invalid combination of options: -%cThese format options are not supported %s = %s Invalid option nameInvalid options formatusage: pax [-0cdOnvz] [-E limit] [-f archive] [-G group] [-s replstr] [-T [from_date][,to_date][/[c][m]]] [-U user] [pattern ...] pax -r [-0cDdikOnuvzYZz] [-E limit] [-f archive] [-G group] [-o options] [-p string] [-s replstr] [-T [from_date][,to_date]] [-U user] [pattern ...] pax -w [-0adHiLOPtuvXz] [-B bytes] [-b blocksize] [-f archive] [-G group] [-o options] [-s replstr] [-T [from_date][,to_date][/[c][m]]] [-U user] [-x format] [file ...] pax -r -w [-0DdHikLlnOPtuvXYZ] [-G group] [-p string] [-s replstr] [-T [from_date][,to_date][/[c][m]]] [-U user] [file ...] directory usage: tar {crtux}[014578befHhLmOoPpqsvwXZz] [blocking-factor | archive | replstr] [-C directory] [-I file] [file ...] tar {-crtux} [-014578eHhLmOoPpqvwXZz] [-b blocking-factor] [-C directory] [-f archive] [-I file] [-s replstr] [file ...] usage: cpio -o [-aABcLvVzZ] [-C bytes] [-H format] [-O archive] [-F archive] < name-list [> archive] cpio -i [-bBcdfmnrsStuvVzZ6] [-C bytes] [-E file] [-H format] [-I archive] [-F archive] [pattern...] [< archive] cpio -p [-adlLmuvV] destination-directory < name-list Empty replacement stringrep_addInvalid replacement string %sInvalid replacement string option %s%s while compiling regular expression %sUnable to allocate memory for replacement stringEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern list inconsistentPattern select out of memoryRemoving leading / from absolute path names in the archive ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Processing continues, name changed to: %s tty_renameProcessing continues, name unchanged. Skipping file. File name %s/%s, too longrep_name%s >> %s >> %s Replacement name too long %s >> %sReplacement name error %sTMPDIR/tmp/Cannot allocate memory for temp file name.Can't open current working directory.can not gzip while appendingCpu time limit reached, cleaning up.Signal caught, cleaning up.LC_TIMEUnable to set up signal handlerUser selection table out of memoryUnable to find uid for user: %sUnable to allocate memory for user selection tableGroup selection table out of memoryCannot determine gid for group name: %sUnable to allocate memory fo group selection tableEmpty time range stringUpper %s and lower %s time overlapIllegal upper time range %sTime range format is: [[[[[cc]yy]mm]dd]HH]MM[.SS][/[c][m]]Illegal lower time range %sBad option %c with time range %sUnable to allocate memory for time rangeImproperly specified time range: %sCannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %schk_ftimeFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryFailed ftime table readFailed ftime table seekCannot allocate memory for interactive rename tableNo interactive rename table, links may failInteractive rename table out of memoryCannot update rename tableCannot allocate memory for device mapping tableDevice map table out of memoryUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryUnable to allocate memory for directory timesUnable to store mode and times for created directory: %swrite_optnodir%s=%s is only supported when writing.Unknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format optiontar_wrFile name too long for tar %sTar header field is too small for %sFile is too large for tar %sTar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for ustar %sUstar header field is too small for uid %lu, using nobodyUstar header field is too small for gid %lu, using nobodyUstar header field is too small for %sustar_wrnobodyFile is too long for ustar %sLink name too long for ustar %sUstar cannot archive a socket %s/dev/ttyFatal error, cannot open %s%s: @(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: ping.c,v 1.77 2006/04/13 00:49:15 deraadt Exp $setresuidDI:LRS:c:dfi:jl:np:qrs:T:t:vw:number of packets to transmit is %s: %sbad interface address: %stos value is %s: %s%s: only root may use interval < 1sbad timing interval: %spreload value is %s: %spacket size is %s: %sttl value is %s: %smaxwait value is %s: %s-f and -i options are incompatiblebind-R option and -D or -T, or -t to unicast destinations are incompatiblesetsockopt IP_MULTICAST_IFgetsockoptCannot set the receive buffer sizePING %s: %d data bytes ping: recvfromPING %s (%s): %d data bytes Could only allocate a receive buffer of %i bytes (default %i)setsockoptsetsockopt IP_MULTICAST_TTLsetsockopt IP_MULTICAST_LOOPping: record routerecord route not valid to multicast destinationsunknown host: %sping: wrote %s %d chars, ret=%d pingerping: sendtopacket too short (%d bytes) from %s unknown option %x LSRR: 0.0.0.0 (truncated route) %s RR: (same route) NOP%d bytes from %s: icmp_seq=%u ttl=%d wrong data byte #%d should be 0x%x but was 0x%x%x (DUP!) time=%d.%03d ms%d bytes from %s: %ld packets transmitted, %ld packets received, %.1f%% packet lossround-trip min/avg/max/std-dev = %d.%03d/%d.%03d/%d.%03d/%d.%03d ms -- somebody's duplicating packets!%ld duplicates, --- %s ping statistics --- Echo ReplyDestination Net UnreachableDest Unreachable, Unknown Code: %d Destination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF setfrag needed and DF set (MTU %d) Source Route FailedNetwork UnknownHost UnknownSource IsolatedDest. Net Administratively ProhibitedDest. Host Administratively ProhibitedDestination Net Unreachable for TOSDesination Host Unreachable for TOSRoute administratively prohibitedHost Precedence ViolationPrecedence CutoffSource QuenchRedirect Network(New addr: %s) Redirect, Unknown Code: %dRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostUnknown ICMP type: %d Echo RequestRouter Discovery Advertisement(%d entries, lifetime %d seconds) Router Discovery SolicitationTime exceeded, Unknown Code: %d Frag reassembly time exceededTime to live exceededParameter problem, required option absent: pointer = 0x%02x Parameter problem: pointer = 0x%02x TimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask Reply (Mask 0x%08x) Vr HL TOS Len ID Flg off TTL Pro cks Src Dst Data %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %s %02x%s (%s)TCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xpatterns must be specified as hex digitsusage: ping [-DdfjLnqRrv] [-c count] [-I ifaddr] [-i wait] [-l preload] [-p pattern] [-s packetsize] [-T tos] [-t ttl] [-w maxwait] host $OpenBSD: fsutil.c,v 1.15 2006/05/28 15:43:41 thib Exp $lost+foundwrong type to dirscan %d DIRECTORY CORRUPTEDNAME=%s fileerror%s=%s DIRLINK COUNT %s COUNT %d SHOULD BE %d (ADJUSTED)ADJUSTLINK COUNT INCREASINGUNREFmkentryUNREF %s RECONNECTSORRY. CANNOT CREATE lost+found DIRECTORYlost+found IS NOT A DIRECTORYREALLOCATElinkupSORRY. CANNOT CREATE lost+found DIRECTORY SORRY. NO lost+found DIRECTORY DIR I=%u CONNECTED. PARENT WAS I=%u SORRY. NO SPACE IN lost+found DIRECTORYNO lost+found DIRECTORYCREATE (CREATED) (RECONNECTED)makeentryNO SPACE LEFT IN %s (EXPANDED)EXPANDLARGE FILES UNSUPPORTED ON REVISION 0 FILESYSTEMSSETTING LARGE FILE INDICATOR SET LARGE FILE INDICATORTRYING TO SET FILESIZE TO %llu ON MODE %x FILE ckinodeDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDSiblockPARTIALLY TRUNCATED INODE I=%ublk %d < cgdmin %d; blk + cnt %d > cgsbase %d blk %d >= cgdmin %d; blk + cnt %d > cgdmax %d bad inode number %d to ginode bad inode number %d to nextinode Cannot allocate space for inode buffer cannot increase directory list cannot find inode %d CLEAR (CLEARED) I=%u OWNER=%u MODE=%o SIZE=%llu MTIME=%12.12s %4.4s %d %s I=%uBAD STATE %d TO BLKERR b:dfm:npyAlternate super block location: %d ** lost+found creation mode %o bad mode to -m: %o -%c flag requires a %s checkfilesysCAN'T CHECK FILE SYSTEM.** Phase 1 - Check Blocks and Sizes** Phase 1b - Rescan For More DUPS%d files, %d used, %d free ***** REBOOT NOW ***** ***** PLEASE RERUN FSCK ***** ***** FILE SYSTEM WAS MODIFIED *****The following zero link count inodes remain: %u,The following duplicate blocks remain: %d,%d blocks missing %d files missing ** Phase 5 - Check Cyl groups** Phase 4 - Check Reference Counts** Phase 3 - Check Connectivity** Phase 2 - Check PathnamesINTERNAL ERROR: dups with -p** Root file system** Last Mounted on %s starting usage: %s [-dfnpy] [-b block#] [-m mode] filesystem ... UNKNOWN FILE TYPE I=%ubad size %llu:INCORRECT BLOCK COUNT I=%u (%d should be %d) (CORRECTED)LINK COUNT TABLE OVERFLOWCONTINUEbad indirect addr: %d bad direct addr: %d bad size %llu ndb %d:HOLD BAD BLOCKINODE I=%u HAS DTIME=%12.12s %4.4sPARTIALLY ALLOCATED INODE I=%uDUP TABLE OVERFLOW.EXCESSIVE DUP BLKS I=%u (SKIPPING)EXCESSIVE BAD BLKS I=%uBAD STATE %d FOR ROOT INODE DUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYCANNOT ALLOCATE ROOT INODE ROOT INODE UNALLOCATEDALLOCATEpass2MISSING '..'FIXBAD INODE NUMBER FOR '..'DIRECTORY TOO SHORTDIRECTORY %s: LENGTH %lu NOT MULTIPLE OF %dMISSING '.'I OUT OF RANGEREMOVEpass2checkUNALLOCATEDBAD TYPE VALUEIS AN EXTRANEOUS HARD LINK TO DIRECTORY%s %s %s (IGNORED)DUP/BADZERO LENGTH DIRECTORYEXTRA '.' ENTRYEXTRA '..' ENTRYCANNOT FIX, INSUFFICIENT SPACE TO ADD '..' CANNOT FIX, SECOND ENTRY IN DIRECTORY CONTAINS %s BAD TYPE VALUE FOR '..'CANNOT FIX, INSUFFICIENT SPACE TO ADD '.' CANNOT FIX, FIRST ENTRY IN DIRECTORY CONTAINS %s BAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'BAD STATE %d FOR INODE I=%d ZERO LENGTHBAD/DUPsummary info for cg %d is %d, %d, %d,should be %d, %d, %d SUMMARY INFORMATIONS WRONG FOR CG #%dBLK(S) MISSING IN BIT MAPS #%dINODE(S) MISSING IN BIT MAPS #%dsummary info bad in superblock: %d, %d should be %d, %d SUPERBLK SUMMARY INFORMATION BADpass5ino_bitmap:ibmap:blk_bitmap:bbmap:BAD STATE %d FOR INODE I=%ld %u: %2x %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. /r%s is not a character device Can't stat %s Can't stat rootmalloc failedrealloc failedstrdup failed%s is not a character device (NO WRITE)cannot allocate space for superblock setupLOOK FOR ALTERNATE SUPERBLOCKSLOCATION OF AN ALTERNATESUPER-BLOCK TO SUPPLY NEEDEDINFORMATION; SEE fsck_ext2fs(8).SEARCH FOR ALTERNATE SUPER-BLOCKFAILED. YOU MUST USE THE-b OPTION TO FSCK_FFS TO SPECIFY THE%s %s %s %s %s %s USING ALTERNATE SUPERBLOCK AT %d WRONG FPG=%d (BPG=%d) IN SUPERBLOCKBAD SUMMARY INFORMATIONcannot alloc %u bytes for blockmap cannot alloc %u bytes for statemap cannot alloc %u bytes for lncntp cannot alloc %u bytes for inphead cannot alloc %u bytes for typemap IMPOSSIBLE RESERVED BLOCK COUNT=%d IN SUPERBLOCKSET TO DEFAULT** File system is already clean %sile system is clean; not checking ** Fstate = %d NO WRITE ACCESS** %sCan't open %s: %s Can't stat %s: %s MAGIC NUMBER WRONGBAD LOG_BSIZEINCOMPATIBLE FEATURE BITS IN SUPER BLOCKcompat 0x%08x, incompat 0x%08x, compat_ro 0x%08x VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEsuperblock mismatchesoffset %ld, original %ld, alternate %ld BAD SUPER BLOCK: %s %s: NOT LABELED AS A EXT2 FILE SYSTEM (%s) %s: CANNOT FIGURE OUT FILE SYSTEM PARTITION ioctl (GCINFO): %s %s: can't read disk label PARTIALLY WRITING %sZERO'ED BLOCK %d TO DISK bad file type 0%o %s? yes %s? [Fyn?] %s? no INTERNAL ERROR: GOT TO reply()cannot allocate buffer pool deadlocked buffer pool CANNOT %s: BLK %dProgram terminated MARKING FILE SYSTEM CLEAN cache missed %ld of %ld (%d%%) MARK FILE SYSTEM CLEANUPDATE STANDARD SUPERBLOCKSPanic: lost %d buffers READTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %ld (%ld), %ld,SEEKWRITETHE FOLLOWING SECTORS COULD NOT BE WRITTEN:returning to single-user after filesystem check catchquitSALVAGE (SALVAGED)UNKNOWN INODESC FIX MODE %d benstuvusage: %s [-benstuv] [-] [file ...] %6d GccDtcDtcDcDcDcDc XbDbDbDhEi E|aE$gEg Eln(E(o0E(o8Eo@EoHE rPE rXErdErpEsEaEbБEdEdEdEdEdEdEfE(_EcEcE cEcF@cFcFF$FT0F%d: powersave on (%dms sleep) (auto) %ddBm%sHIDENWIDNOBRIDGEieee80211_status no permission to scanSIOCG80211ALLNODES none restoreieee80211_listnodesnwid chan %u bssid %s lladdr %s %udB %u%% powersave %uMESSIBSSPOLLABLEPOLLREQPRIVACYSHORT_PREAMBLEPBCCCHNL_AGILITY SHORT_SLOTTIME RSNDSSSOFDMCACHEBSSAUTHASSOCCOLLECTSGIOCGIFMEDIA%s: no link type?init_current_mediaSIOCSIFMEDIAonly one `media' command may be issuedmay not issue `media' after `mode' commandsmay not issue `media' after `mediaopt' commandsonly one `mode' command may be issuedinvalid media mode: %sonly one `mediaopt' command may be issuedmay not issue `mediaopt' after `instance'only one `-mediaopt' command may be issuedmay not issue both `media' and `-mediaopt'only one `instance' command may be issuedmust specify `media' before `instance'media instance %s: %sEthernetetherTokenRingtokenFDDIIEEE802.11TDMCARPautoselectmanual10baseT10baseT/UTP10UTP10base210base2/BNC10BNC10base510base5/AUI10AUI100baseTX100TX100baseFX100FX100baseT4100T4100baseVG100VG100baseT2100T21000baseSX1000SX10baseSTPSTP10STP10baseFLFL10FL1000baseLX1000LX1000baseCX1000CX1000baseT1000T1000baseTX1000TXHomePNA1HPNA110GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10GbaseCX410GCX410GBASE-CX4DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDIFH1FH2DS2DS5DS11DS1DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72t1t1-amie1-g.704e1-amie1-ami-g.704t3t3-m13e3e3-g.751e3-g.832e1-g.704-crc411a11b11gfhmasterfull-duplexfdxhalf-duplexhdxflag0flag1flag2loopbackhw-loopbackloopEarlyTokenReleaseETRSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapibssibss-mastermonitorturbohdlc-crc16pppframerelay-ansiframerelay-ciscoframerelay-ituunknown %s media subtype: %sunknown %s media mode: %sunknown %s media option: %smedia mode %smediaopt instance %d physical address inet%s %s --> %s phys_statusno carrieractiveno ringinsertedno networkbackupUPBROADCASTDEBUGLOOPBACKPOINTOPOINTNOTRAILERSRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST metric %lu mtu %lu lladdr %s description: %s %s: no media types?SIOCGIFMEDIA media: status: supported media: inet %sSIOCGIFNETMASKSIOCGIFDSTADDR --> %s netmask 0x%xSIOCGIFBRDADDR broadcast %sin_status inet6 %sSIOCGIFDSTADDR_IN6 -> %sSIOCGIFNETMASK_IN6 prefixlen %dSIOCGIFAFLAG_IN6 anycast tentative duplicated detached deprecated scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime infty vltime in6_aliasprefix %s: %s%s=%o%s=%xusage: ifconfig [-AaCm] [interface] [address_family] [address [dest_address]] [parameters] getifgroupsSIOCGIFGROUP groups:malformed link-level addressSIOCSIFLLADDR1ACFLRSTacdfghiklmnopqrstuxCOLUMNS%s: %s: %s: directory causes a cyclefts_readdisplay%lld%*s%*qd printlong%3d, %3d %-*s %*qd %*u total %lu %s %*u %-*s %-*s -> printlink ls: %s: %s %*s usage: %s [-1AaCcdFfghikLlmnopqRrSsTtuWx] [file ...] mainifconfigmake_packetrtsol_check_timerrtsol_timer_updatesockopensendpacketrtsol_inputinterface_upinterface_statuslladdropt_fill)get_llflagprobe_initdefrouter_probesendprobeadDFfailed to open a socketfailed to initialize interfacesselect: %sfailed to setup for probing routersfailed to initialize %skernel is configured as a router, not a hostkernel is configured not to accept RAsadDfFm1memory allocation failedinterface %s was already configuredfailed to get link layer information for %slink-layer address option has null length on %s. Treat as not included.memory allocation failed for %sNew timer is %ld:%08ldthere is no timer%s status is changed from %d to %dNo answer after sending %d RSstimer expiration on %s, state = %dset timer for %s to %d:%dstop timer for %sillegal interface state(%d) on %susage: rtsol [-DdF] interface ... usage: rtsol [-DdF] -a usage: rtsold [-1DdFfm] interface ... usage: rtsold [-1DdFfm] -a <%s> %swarnmsgprobing %sreallocmultiple interfaces foundff02::2inet_pton failed for %ssetsockopt(ICMP6_FILTER): %sIPV6_HOPLIMIT: %sIPV6_PKTINFO: %ssocket: %smalloc for send msghdr failedmalloc for receive msghdr failedsend RS on %s, whose state is %dsendmsg on %s: %ssendpacketfailed to get receiving interfacertsol_inputinvalid icmp type(%d) from %s on %sinvalid RA with hop limit(%d) from %s on %sinvalid RA with non link-local source from %s on %sreceived RA from %s on %s, state is %dreceived RA from %s on an unexpeced IF(%s)invalid icmp code(%d) from %s on %spacket size(%d) is too shortfailed to get receiving hop limitrecvmsg: %schecking if %s is ready...interface_up%s is duplicated%s is tentative%s is readyget_llflag() failed, anyway I'll tryioctl(SIOCSIFFLAGS): %sioctl(SIOCGIFFLAGS): %sinterface_statusioctl(SIOCGIFMEDIA) on %s: %sioctl(SIOCGIFFLAGS) on %s: %sunsupported link type(%d)get_llflagioctl(SIOCGIFAFLAG_IN6): %sgetifaddrs: %ssocket(SOCK_DGRAM): %sshutdown: %slo0defrouter_probedefault router list contains a non-link-local address(%s)ioctl(SIOCGDRLST_IN6): %sprobe a router %s on %ssendprobeTTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftinvalid namelen:%d/%luno nameunknown qtyperefused???unknown, type 0x%xrefused, type 0x%x%d bytes from %s, icmp_seq=%u hlim=%d(DUP!) time=%g ms dst=%sfailed to get receiving packet informationa:b:c:dfHg:h:I:i:l:mnNp:qRS:s:tvwW-R is not supported in this configurationinvalid source address: %sinvalid socket buffer sizeillegal number of packets -- %sMust be superuser to flood pingillegal hoplimit -- %sillegal hoplimit %stoo small interval, raised to 0.01illegal timing interval %sillegal preload value -- %sMust be superuser to preloaddatalen value too large, maximum is %dillegal datalen value -- %sgetaddrinfo failedsetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_HOPOPTS)setsockopt(IPV6_DSTOPTS)-f and -i incompatible optionsUnable to allocate packetsetsockopt(IPV6_USE_MIN_MTU)setsockopt(ICMP6_FILTER)%s: invalid interface namesetsockopt(SO_SNDBUF)PING6(%lu=40+8+%lu bytes) %s --> new path MTU (%d) is notified recvmsgpollsetsockopt(IPV6_HOPLIMIT)setsockopt(IPV6_PKTINFO)setsockopt(SO_RCVBUF)you need -b to increase socket buffer sizeUDP socketUDP setsockopt(IPV6_PKTOPTIONS)UDP connectgetsocknamecan't initialize rthdrbad addr family of an intermediate addrcan't add an intermediate nodecan't set the last flagcan't allocate enough memorysetsockopt(IPV6_RTHDR)IPV6_MULTICAST_HOPSgateway resolves to multiple addressestoo many intermediate hopsgetaddrinfo for the gateway %s: %sping6: wrote %s %d chars, ret=%d sendmsg\%03odnsdecodeinvalid peernamepr_packunknown code 0x%x, type 0x%xNodeInfo NOOP HbH Options: Routing: Dst Options: -%uNodeInfo Supported Qtypes, compressed bitmap, raw bitmap %s(TTL=%u)pr_nodeaddr(TTL=infty) no address truncated --- %s ping6 statistics --- round-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms %.1lf%% packet loss+%ld duplicates, IPv6 addressDNS labelIPv4 addressSuccessRefusedNo Route to Destinationpr_icmphDestination Unreachable, Bad Code: %d Destination Administratively UnreachableDestination Unreachable Beyond ScopePacket too big mtu = %d Time exceeded, Bad Code: %d Parameter problem: Bad code(%d) pointer = 0x%02x Erroneous Header Unrecognized Option Unknown Nextheader Listener QueryListener ReportListener DoneRouter SolicitationRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementRedirectDestination: %s New Target: %sBad ICMP type: %dNode Information QueryNOOP, invalid, oldfqdn, subject=%s(%s), no subject, subject=%s(invalid)Supported qtypesDNS namenodeaddrIPv4 nodeaddrNode Information Reply, %sVr TC Flow Plen Nxt Hlim %1x %02x %05x %04x %02x %02x %s->pr_iphHBH RTHDR FRAG ESPICMP6: type = %d, code = %d Unknown Header(%d) DSTOPT IP6ff02::2:0000:0000nigroupusage: ping6 [-dfHmNnqtvWw] [-a addrtype] [-b bufsiz] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [hops...] host ?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for dataLESSSECURELESS-E-G-L-mMOREWARNING: terminal is not fully functionalCannot allocate memoryticdcmsomdmbvbbc|^srget_termraw_modeLESS_TERMCAP_ltget_envLINESlicokrklkukdkPkNkh@7kDTERMhcxndadbsgpcNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketseek errorread errorch_ungetchar overrunseek error to 0ESC^%c*s<%X>Non-match First-file EOF-ignore Keep-pos Regex-off (P)+ [Press space to continue, 'q' to quit.]less %sungetcc overflowPattern not found help(N-th) No %snext fileNo %sprevious fileNo such filemark: goto mark: Command not availableBrackets: [Press 'h' for instructions.]Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableeditchar"%s" may be a binary file. See it anyway? Missing filename ("less --help" for help)LESSMETAESCAPE\LESSMETACHARS; *? '"()<>|&^`#\%c%s%c%s%s%sHOMEbin_file%s %s %sLESSOPENLESSCLOSE...skipping... Cannot find help fileCannot seek to end of fileCannot seek to beginning of fileCannot seek to line number %nDetermining length of fileDon't know length of fileCannot seek to that file positionLESSANSIENDCHARSplinenum~ Calculating line numbers (press RETURN)Invalid mark letterMark not setMark not in current fileLine number is required after -lless Copyright (C) 2002 Mark Nudelman less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Homepage: http://www.greenwoodsoftware.com/less Tab stops and then every %d spacesopt_x-" must be followed by 1 or 2 charsquotes %sUse "h" for helpThere is no %s option ("less --help" for help)There is no %s optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric option-%sValue is required after %sNumber is required after %sfakeSearch includes displayed screenSearch skips displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by clearing each lineRepaint by painting from top of screenAssume intelligent terminalAssume dumb terminalDon't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesAllow help commandDon't allow help commandCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: Position target at screen line %dDon't display a status columnDisplay a status columnDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numbersprompt: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directlyDisplay control characters directly, processing ANSI sequencesDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linesDisplay underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: Horizontal shift %d positionsUse keypad modeDon't use keypad modeBe less helpful in promptsBe helpful in promptspostoalinenumtoainttoaiprint_intiprint_linenumap_posap_linenumap_intNo previous regular expressionInvalid patternPlease re-enter search patternNothing to searchLine numbers turned offffcffffffffXkf`0m( 0@<Dml P@Xhmtmmmbgdumbtimernfsv3rdirplusmntudpresvportnfsv2ac23a:bcdD:g:I:iL:lo:PR:r:sTt:w:x:U-2 and -3 are mutually exclusiveillegal -I value -- %sillegal -R value -- %sillegal -a value -- %sconflicting version optionsillegal -r value -- %sillegal -t value -- %sillegal -w value -- %sillegal -x value -- %sNFS Portmapcan't access %s: %sbad MNT RPCCannot MNT PRCcan't resolve address for host %sno : or @ spechostname too longusage: %s [-23bcdilsTU] [-a maxreadahead] [-g maxgroups] [-I readdirsize] [-o options] [-R retrycnt] [-r readsize] [-t timeout] [-w writesize] [-x retrans] rhost:path node unused DOS FAT-12 XENIX / XENIX /usr DOS FAT-16 Extended DOSDOS > 32MB HPFS/QNX/AUXAIX fs AIX/Coherent OS/2 Bootmgr Win95 FAT-32 Win95 FAT32LDOS FAT-16 Extended LBAOPUS OS/2 hidden Compaq Diag.OS/2 hidden OS/2 hidden OS/2 hidden AST swap Willowtech Thinkpad Rec Willowsoft $NEC DOS 8Theos 9Plan 9 @VENIX 286 ALin/Minux DRBLinuxSwap DRCLinux DR MQNX 4.2 Pri NQNX 4.2 Sec OQNX 4.2 Ter PDM QDM RCP/M or SysVSDM TOntrack UEZ-Drive VGolden Bow \Priam aSpeedStor cISC, HURD, *dNetWare 2.xxeNetWare 3.xxfNetWare 386 gNovell hNovell iNovell pDiskSecure uPCIX Minix (old) Minix (new) Linux swap Linux files*OS/2 hidden Linux ext. NT FAT VS NTFS VS Amoeba FS Amoeba BBT Mylex BSDI NotebookSaveFreeBSD OpenBSD NEXTSTEP MacOS X NetBSD MacOS X bootBSDI filesy*BSDI swap Solaris CTOS DRDOSs FAT12DRDOSs < 32MDRDOSs >=32MHPFS DisbledCPM/C.DOS/C*Dell Maint SpeedStor SpeedStor SpeedStor BeOS/i386 EFI GPT EFI Sys SpeedStor DOS 3.3+ SecSpeedStor Xenix BBT Z[s۸~eWjlO6U$sΞJd$(RKv__7$s˪|I Xt>*/Pq'SToL:[*Ow{w"؋Z/b+".,Je*ͳe.7?goonw?ɯ' JƗμ̼x3/yj3O Yy+ Y=6hۘ_̼16ofޜ.6VP߄[a:8n p~]@ = DFϩ(VJăX4r!p*,\BH1ϲB%V2D!)u!,-WV5 Hx ;:Nb(tgh+R Eb9;_^FǧB<(twC̬%${QbXDyDDSH[pUk-i U֧;4^~I&#R="xdKO<<>+C"XsS-w̉,dq CnR(H K]o,J||avi/㯇n/lrRnc#D0*XL^ykȳ AR@zJD J>pn g C8}sF3xqk֑!˼a!ΖOfcļg"+VvK+N 7F|}7<Af?hOC̄.bUAD.a)#EЎSBT*/bv ./چꥂB?u2 ~0=+V?/ZM-N*/{UV.m.ܤ_.Dїk~ddW;N =1xo8|6/ ,jQR4&nr_>cG.9ߑu GK7.@La#_XVHD結F.#d4' e5Ae=-`4:nysnn!ƃWYb܆PvbA?26$Hbl(u+I*Siݤr[d[q_jDN센 'DKțQ8pSRDa@FS R eE9R_Xϼ_$dh6- -dڛK0$1K&vA!@ BKdT.1t&X(i%`RTUNX5&EnPS3AkAJ}G 㱰\n`\HaS!)R;KSlC)h(@Uw6>{K+Kf&2/'fzeAa΢v9Qj<XX2-8ϰdCq!t75ML+j̋*ۧvsk*D'!hV)ݵZwW E`qQ&TݤJAY{DPWծ ()Ůh6 ~27[WdOFVbx'8e MS,y+۰?@[6 G}A߳܊ݏ:#z^ fs-.0r25]|2T?o;N6+z;)?mzÐ|2;MAgAKD|:*z+y?}v>o>>4XыۅB]@P'~Gz?0Ī |,ߖV]~DgD7١7 @ǵl|ҟ}`: 3Zf|Q/C9qbE<7HR D?t("Eg+jG W(75gfWf.Y3_)g_?D7j fb6㯈:l%΀ޜy`Znհ&mk#ʙ-+=Oml}oG d¨ K g!{L,,P`%- Nnp"e :/0^զRekЧuY \Amk @bB EFB{EM$zGNPpo5Չ XDj]abUjQ&sȗTg-Tq.CUZ89]k74Os+S{Kbu?=fCz"^Yq]yw.n<w@6f4/U((fjqRYjհmuLGPƤ 9>WQq¼P}b{aRxdKn_ZSG)uWG~Qˍ^`]i5pЧMu~֮yP\S m1Eg6`YD|LgEc$JgJL: H\Ie vl%0l>l Xa7jKl}5J QVɽخN ۚ]vc_q˲؛[*eVtݾOLPMC4jmڡo^EUKI"fv$lII0zf1!U!;&7p~і5!FdGJ~txԲ޸zUrI{o$yh>$W:ek$$/zRi(wO9ȮySzjQvj7@mҊ"7I0zKK7.sϻ)a آD`9OuԼfTIM:ɑ\&Q5c#W(5:gVQwL|w#;&1DD֞?yŸ̴ m`;d U ()wVE'ׇ9BqyXVxXdSG>udk'C@p+Dϱ-RwׅvqcNBmo>`BV'{.| n6*8S-dol!ZGg E/NR(dB$)h껳WzaMvsO)FsRt8OXK.ڜL&}ソn?zK77 6\V0ՀM`q4v%\n e+zߑ,[smX1/ue xwp/C% a.AWrVyNND;A)0S]} jQO鏫 xA)bQAy/kΜLt Lrg"X O}_y!ɠ'? Rߕs-Lusage: %s [-ieu] [-c cylinders -h heads -s sectors] [-f mbrfile] device -i: initialize disk with virgin MBR -u: update MBR code, preserve partition table -e: edit MBRs on disk interactively -f: specify non-standard MBR template -chs: specify disk geometry `disk' may be of the forms: sd0 or /dev/rsd0c. ieuf:c:h:s:Cylinder argument %s [1..262144].Head argument %s [1..256].Sector argument %s [1..63].using builtin MBRCan't get disk geometry, please use [-chs] to specify.Please specify a full geometry with [-chs].error initializing MBRCommand help listShow entire OpenBSD man page for fdiskreinitRe-initialize loaded MBR (to defaults)setpidSet the identifier of a given table entryEdit current drive statsEdit given table entryflagFlag given table entry as bootableUpdate machine code in loaded MBRSelect extended partition table entry MBRSwap two partition entriesPrint loaded MBR partition tableWrite loaded MBR to diskexitExit edit of current MBR, without saving changesQuit edit of current MBR, saving current changesabortAbort program without saving current changes ----------------------------------------------------- ------ ATTENTION - UPDATING MASTER BOOT RECORD ------ ----------------------------------------------------- Do you wish to write new MBR? Do you wish to write new MBR and partition table?USER_initMBR is unchangedEnter 'help' for informationfdisk:%c%d> Writing current MBR to disk.error writing MBRUSER_modifyAborting changes to current MBR.Invalid command '%s'. Try 'help'. Offset: %d USER_print_diskBytesSectorsKilobytesMegabytesGigabytesask_cmd%s [%X - %X]: [%X] %s [%d - %d]: [%d] (? for help) ask_num'%d' is out of range. '%s' is not a valid number. %s [n] %s is not a character device or a regular fileDIOCGDINFODISK_getlabelmetricsBIOS fixup botch (secs (%d) > size (%d))Disk: %s geometry: %d/%d/%d [%.0f %s] geometry: Signature: 0x%X MBR_pcopyChoose from the following Partition id values:%02X %s %02X %s %02X %s %02X %s Warning CHS values out of bounds only saving LBA values Starting Ending LBA Info:%c%1d: %.2X %4u %3u %2u - %4u %3u %2u [%12u:%12.0f%s] %s #: id C H S - C H S [ start: size ]------------------------------------------------------------------------Start of partition #%d after end!In memory copy is initialized to:Use 'write' to update disk.XreinitChange disk geometry?BIOS CylindersBIOS HeadsBIOS SectorsInvalid argument: %s Invalid partition number %d. Swap with what partition?%d same partition as %d, doing nothing. Invalid argument: %s Invalid partition number.Partition id ('0' to disable) Partition %d is disabled. Do you wish to edit in CHS mode?BIOS Starting cylinderBIOS Starting headBIOS Starting sectorBIOS Ending cylinderBIOS Ending headBIOS Ending sectorLoop to offset 0! Not selected.Selected extended partition %d New MBR at offset %d. Partition %d is not an extended partition. Writing MBR at offset %d. Xwrite %s %s Machine code updated.Partition %d flag value set to 0x%x. Partition %d marked active. Invalid argument: %s [value] (standard input)(fd %d)invalid file type^\((%s[[:<:]]%s%.*s%s[[:>:]]%susage: %s [-abcEFGHhIiLlnoPqRSsUVvwx] [-A num] [-B num] [-C[num]] [-e pattern] [-f file] [--binary-files=value] [--context[=num]] [--line-buffered] [pattern] [file ...] 0123456789A:B:CEFGHILPSRUVabce:f:hilnoqrsuvwxybinary-filesmmapline-bufferedafter-contextbefore-contextextended-regexpfixed-stringsbasic-regexpbinaryversionbyte-offsetregexpno-filenameignore-casefiles-without-matchfiles-with-matchesline-numberquietsilentrecursiveno-messagesrevert-matchword-regexpline-regexpunix-byte-offsetscontext out of rangegrep version %u.%u without-matchUnknown binary-files optionBinary file %s matches [[:<:]][[:>:]]aFfh:t:v%s: not a directory or special deviceumountfsBad MNT RPC%s: unmount from %s %s: not currently mountedusage: %s %s umount [-fv] special | nodeumount -a [-fv] [-h host] [-t type]ffcfffffffffGsl9xu:g:m:o:not an MSDOS filesystemstat %sunknown group id: %sunknown user id: %sinvalid file mode: %susage: mount_msdos [-o options] [-u user] [-g group] [-m mask] bdev dir $OpenBSD: fsck.c,v 1.24 2006/03/20 19:50:09 dhill Exp $$OpenBSD: fsutil.c,v 1.15 2006/05/28 15:43:41 thib Exp $$OpenBSD: preen.c,v 1.16 2005/10/28 07:30:35 otto Exp $start %s %swait %scheckfs%s/fsck_%sexec %sCan't get resource limit for data sizeCan't get resource limit to max data sizedvpfnyb:l:T:t:-b %s%s: unknown special file or file system.fsck_%snoInvalid option stringusage: %s [-dfnpvy] [-l maxparallel] [-T fstype:fsoptions] [-t fstype] [special | node ...] UNEXPECTED INCONSISTENCY:THE FOLLOWING FILE SYSTEM%s HAD AN %s %s: %s (%s)%sCan't open checklist file: %s/etc/fstabBAD DISK NAME %s pass %d, name %s Unknown pid %ld%s: %s (%s): EXITED WITH SIGNAL %d done %s: %s (%s) = %x disk %s: %s in fstab more than once!mkfifom:invalid file mode.non-numeric major number.non-numeric minor number.major or minor number too largenode must be type 'b' or 'c'.usage: %s [-m mode] fifoname ... usage: %s [-m mode] name [b | c] major minor usage: %s [-m mode] name p UGHRBD M@dmCXLS1@2 3cJ0123456789abcdefold usage of trailing 0assuming route to if entry in usenot in tablerouting table overflow: gateway %s (%s)netmask missingold usage of trailing digit, assuming route via gatewayblackholechangecloningdstencapgatewaygenmaskhopcountifaifpipxjumbolinkllinfolockrestmpathnetnojumbonostaticproto1proto2recvpiperejectrttrttvarsasendpipeshowssthreshstaticxresolvebotched keyword: %susage: %s [-dnqtv] command [[modifiers] args] commands: add, change, delete, flush, get, monitor, show dnqtT:v/dev/nullroute-sysctl-estimate%-20.20s donewrite to routing socketgot only %d for rlen Examining routing table from sysctl(address family %s) actual retrieval of routing tablemust be root to alter routing tableking bula sez: set_metric with invalid keyinet6_makenetandmask128%s: resolved to multiple values%s: bad address%s: not a network%d: bad address familyinternal errorprefixlen is not supported with af %dactual retrieval of interface tablegot message of size %d on %sread from routing socketwriting to routing socketso_labelso_ifaso_ifpso_genmaskso_maskso_gateso_dstRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics or flagsRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_RESOLVE: Route created by cloningRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_IFINFO: iface status changeRTM_IFANNOUNCE: iface arrival/departurerouting message version %d not understoodprint_rtmsg%s: len %d, table %u, if# %d, link: %s, flags:name: %s, pid: %ld, seq %d, errno %d, flags:metric %d, flags:if# %d, name %s, what: departurearrival route to: %s destination: %s mask: %s interface: %.*s if address: %s flags: label: %s use hopcount mtu expire%8lu %8lu%c %8ld%c sockaddrs: gateway: %s RTM_GET: %s (errno %d)message length mismatch, in packet %d, returned %d locks: inits: sockaddrs: %s: link %s; sodump%s: inet %s; %s: ipx %s; %s: inet6 %s; label too longinvalid table id: %ssysctl of routing tableRouting tables Encap:sysctl of spdspd-sysctl-estimateGatewayFlagsRefsUseMtuInterface%-*.*s %-*.*s %-6.6s %6.6s %8.8s %6.6s %s PortProtoSA(Address/Proto/Type/Direction)Source%-18s %-5s %-18s %-5s %-5s %-22s %-6.6s %6d %8ld %6ld %6s %.16sp_rtentryInternet Protocol Family %d: AppleTalkIPXInternet6Encap%-*s %-5u %-*.*s %-5u %-6u/esp/use/in/out///acquire/require/bypass/deny/dontacq/ah/ipip/ipcomp%-*.*s p_flagsroutename(%d) %s%u.%u.%u/%d%u.%u.%u.%u/%d%u.%u/%d%u/%d%s/%dnetname6illegal prefixlenaf %d: %s*.**.0x%XHany%XH.%s%s.%XH%02X%02X%02X%02X%02X%02XHlink#%d@(#) Copyright (c) 1985, 1989, 1993, 1994 The Regents of the University of California. All rights reserved. KMGTPasciiimageebcdictenexusage: %s [ | Using %s mode to transfer files. %s: unknown mode. TYPE %s %sTYPE %sinternal error: unknown type %d.We only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. local-fileremote-fileusage: %s local-file [ remote-file ] APPESTORSTOUlocal-filesusage: %s local-files Continue withmput%s: not foundr+wusage: %s remote-file [ local-file ] local: %sRETRgetitremote-filesusage: %s remote-files can't get cwdSkipping non-relative filename `%s' mgetand logged inConnected %sto %s. Not connected. Connected for proxy commands to %s. No proxy connection. (none)Gate ftp: %s, server %s, port %s. Passive mode: %s. Mode: %s; Type: %s; Form: %s; Structure: %s. Verbose: %s; Bell: %s; Prompting: %s; Globbing: %s. Store unique: %s; Receive unique: %s. Preserve modification times: %s. Case: %s; CR stripping: %s. Ntrans: (in) %s (out) %s Ntrans: off. Nmap: (in) %s (out) %s Nmap: off. Hash mark printing: %s; Mark count: %d; Progress bar: %s. Use of PORT/LPRT cmds: %s. (disabled for this connection)Use of EPSV/EPRT cmds for IPv4: %s%s. Macros: usage: %s [ on | off ] %s %s. Bell modeEPSV/EPRT on IPv4Packet tracingusage: %s [ on | off | bytecount ] bytecount value is %s: %s Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive modeusage: %s [ on | off | gateserver [ port ] ] Disabling gate-ftp mode - no gate-ftp server defined. GlobbingPreserve modification timesusage: %s [ on | off | debuglevel ] debugging value is %s: %s Debugging %s (debug=%d). remote-directoryusage: %s remote-directory CWD %sCWD command not recognized, trying XCWD. XCWD %susage: %s local-directory Local directory now %s getcwd: %slcdDELE %susage: %s remote-file mdeletefrom-nameto-nameRNFR %susage: %s from-name to-name RNTO %susage: %s remote-directory local-file nlistLISTNLSToutput to local-file:usage: %s remote-files local-file Try again latershellusernameusage: %s username [password] [account] USER %sPassword: PASS %sAccount: ACCT %sLogin failed. PWDPWD command not recognized, trying XPWD. XPWDLocal directory %s getcwdlpwddirectory-nameMKD %susage: %s directory-name MKD command not recognized, trying XMKD. XMKD %sRMD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendusage: %s line-to-send arguments to SITE commandSITEquote1SITE CHMOD %s %susage: %s mode file-name SITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITusage: %s [password] Account:usage: %s command ?Ambiguous command. ?Invalid command. ?Invalid proxy command. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutusage: %s [mapin mapout] nmap: unbalanced brackets. Passive modeStore uniqueReceive uniqueCDUPCDUP command not recognized, trying XCUP. XCUPrestart: offset not specified. restart: invalid offset. Restarting at %lld. Execute get, put or append to initiate transfer SYSTLimit of 16 macros have already been defined. macro nameusage: %s macro_name Enter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4K buffer exceeded. usage: %s filename %s %lld %s %sSTAT %sSTATLocal file "%s" is newer than remote file "%s". |%sCan't allocate memory for $PAGERaccountbellbyecasecdupclosedisconnectepsv4formgateglobhashidlemacdefmdirmlsmodtimemsendnewernmapntranspassivepreserveprogresspromptpwdquoterecvregetresetrestartrhelprmdirrstatusruniquesendportsitestructsuniquetraceumaskverbose'%s' macro not found. domacroRetrieving %s/%s auto_fetchExtra `@' characters in usernames and passwords should be encoded as %%40Can't allocate memory to parse URLhttp://ftp://url_get: Invalid URL '%s'Invalid URL (no `/' after host): %sInvalid URL (no file after host): %sInvalid URL (no file after directory): %sCan't allocate memory for proxy URL.Malformed proxy URL: %sCan't open file %sReading from filehost %s, port %s, path %s, save as %s. (unknown)Trying %s... r+Requesting %s (via %s) User-Agent: OpenBSD ftpGET %s HTTP/1.0 %s GET /%s HTTP/1.0 Host: Can't allocate memory.[%s]:%s %s Writing HTTP requestreceived '%s' 301302Too many redirections requested200Error retrieving file: %sContent-Length: Location: Redirected to %s Can't open %sCan't allocate memory for transfer bufferReading from socketRead short file. Successfully retrieved file. Auto-login using ftp URLs isn't supported when using $ftp_proxyReceiving HTTP replyWriting %sImproper response from %surl_get http fetch aborted. file fetch aborted. ftp_proxyhttp_proxyCan't allocate memory for auto-fetch.Invalid URL: %suser %s:%s host %s port %s dir %s file %s Can't connect or login to host `%s'*?[]{}Can't allocate memory for URL decoding:/ftpgatehttp%s: bad port number `%s'connect to address %ssetsockopt TOS (ignored)fdopen failed.Connected to %s. hookup---> PASS PASS XXXXACCT ACCT XXXXNo control connection for command. %c%c%c421 Service not available, remote server has closed connection. getreply send aborted waiting for remote to finish abort. sentlocal: %s remote: %s %s: not a plain file. REST %lldnetoutsendrequest receive aborted waiting for remote to finish abort. receivednetin%s: short writeWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %suse of scoped address can be troublesomesetsockopt (ignored)EPSVwrong server: return code must be 229 disabling epsv4 for this connection PASVLPSVPassive mode refused. wrong server: return code must be 227 %u,%u,%u,%u,%u,%uwrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode AF mismatch. Shouldn't happen! %c%c%c%d%cparse error! setsockopt (reuse address)setsockopt IP_PORTRANGE (ignored)setsockopt IPV6_PORTRANGE (ignored)listenEPRT |%d|%s|%s|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dinitconnacceptdataconnproxy server does not support third party transfers. No primary connection. PORT %slocal: %s remote: %s runique: can't find unique file name. Lost control connection for abort.%cABOR abort_remoteNeither $FTPSERVER nor $GATE_SERVER is defined; disabling gate-ftpdumbemacssu-r requires numeric argument46AadEegimno:pP:r:tvVRetrying... FTPSERVERPORTFTPMODEunknown FTPMODE: %s. Using defaultsgate-ftpFTPSERVERftp> sorry, input line too long. Proxy c%sommands may be abbreviated. Commands are: ?Ambiguous help command %s ?Invalid help command %s %-*s %s usage: %s [-46AadEegimnptVv] [-P port] [-r seconds] [host [port]] %s [-o output] ftp://[user:password@]host[:port]/file[/] %s [-o output] http://host[:port]/file %s [-o output] host:[/path/]file[/] anonymous4K macro buffer exceeded. Unknown .netrc keyword %sError: .netrc file is readable by others.Remove account or make file unreadable by others.Missing macdef name argument. Macro definition missing null line terminator. Remove password or make file unreadable by others.ruserpasspasswordpasswdmachine%s/.netrc: %s%s/.netrcstringlist|%.*s%*s| %5lld %c%c %2d:%02d:%02d --:-- ETA - stalled -%02d:%02d ETAprogressmeterAlready connected to %s, use close first. usage: %s host-name [port] gateserver not defined (shouldn't happen)PASSERVE %sConnected via pass-through server %s non-printstreamRemote system type is %s. 215 UNIX Type: L8215 TOPS20Remember to set tenex mode when transferring binary files from this machine. %s@Name (%s): Name (%s:%s): Password:Login failed.$initftp_loginsorry, arguments too long. (%s) unable to create temporary file: %sftpXXXXXXXXXXunable to create temporary file %scan't find list of remote files, oops.can't find list of remote files, oops. remglob%s %s? n, y, p, a, are the only acceptable commands! Interactive mode: off. Prompting off for duration of %s. confirmSIZE %sMDTM %s191Y2K warning! Fixed incorrect time-val received from server. %*s %04d%02d%02d%02d%02d%02dCan't convert %s to a time. Unable to determine real path of `%s'fileindir %3d%% *************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************%lld byte%s %s in %.2f seconds (%.2f %sB/s) ETA: %02d:%02d:%02d ptransfer/etc/rcWARNING: some process(es) wouldn't die(can't restart init): SIGTERM processes/dev/consolesetsidrevokeSIGTSTP inithalted (with powerdown) by %shalted by %srebooted by %sdlnpq~usage: %s [-dn%sq] ffcffffffff(k@`fXkkreloadfilesystem must be mounted read-only; you may need to run fsckusage: mount_ffs [-o options] special node X"<%@ _S &FL # a $ L $ , 4  D  P !\ d  . p [           (  4  D  ` pl  rx p p p p p Ĝ Ĝ    r  P8 P T  rd Ĝx p Ĝ Ĝ Ĝ p   Ĝ P Ĝ8 H P` Ĝx p     P      p  ,pDPTlpp rPPp P8PDPPp` ppp          4p@PLPXPdPpP|PP PPPPPPPPPPP(P4P@PLPXPdPpP|PPPPPPPPPPPP PP$P0P<PHPTP`PlPxPPPPPPPPPPPPPP P,P8PDPPP\PhPtPPPPPPPPPPPPPPP(P4P@PLPXPdPpP|PPPPPPPPPPPP PP$P0P<PHPTP`PlPxPPPPPPPPPPPPPP P,P8PDPPP\PhPtPPPPPPPPPPPPPPP(P4P@PLPXPdPpP|PPPPPPPPPPPP PP$P0P<PHPTP`PlPxPPcmediumreason/etc/dhclient.confFAILalias_routehandlerc:dl:quifi callocifi->client callocifi->client->config callocInterface name too long%s.%s/var/db/dhclient.leasesasprintf%s: no link ... giving up got link cannot open %s: %m_dhcpno such user: _dhcp, falling back to "nobody"no such user: nobodycan't open and lock %s: %mPREINITAF_ROUTE/var/empty/chrootchdir("/")setresgidsetgroupsusage: %s [-dqu] [-c conffile] [-l leasefile] interface ARPCHECKcheck_DHCPACK from %spacket_to_lease failed.BOUNDRENEWREBINDREBOOTold_new_bound to %s -- renewal in %d seconds.BOOTREPLY from %s rejected.DHCPOFFERDHCPNACKDHCPACK%s from %s rejected.BOOTREPLY%s from %s%s isn't satisfactory.%s already seen.ARPSENDdhcpoffer: no memory to record lease.dhcpoffer: no memory for server name.Bogus server name %sdhcpoffer: no memory for filename.dhcpoffer: no memory for option %dInvalid lease option - ignoring offerDHCPNAK from %sDHCPNAK with no active lease. Trying medium "%s" %dMEDIUMDHCPDISCOVER on %s to %s port %d interval %dNo DHCPOFFERS received.Trying recorded lease %sTIMEOUTbound: renewal in %d seconds.bound: immediate renewal.No working leases in persistent database - sleeping. EXPIREDHCPREQUEST on %s to %s port %dsend_requestDHCPDECLINE on %s to %s port %doptions do not fit in DHCPDISCOVER packet.options do not fit in DHCPREQUEST packet.options do not fit in DHCPDECLINE packet.can't create %s: %mlease { bootp; interface "%s"; fixed-address %s; filename "%s"; server-name "%s"; medium "%s"; option %s %s; renew %d %d/%d/%d %02d:%02d:%02d; rebind %d %d/%d/%d %02d:%02d:%02d; expire %d %d/%d/%d %02d:%02d:%02d; } script_init: no memory for environmentPATH=/usr/bin:/usr/sbin:/bin:/sbinip_addressnetwork_numberbroadcast_addressserver_nameprepend optionappend optionno space to %s %sexpirypriv_script_write_paramsunexpected msg type %ureceived corrupted messagefork: %mwait: %mexecve (%s, ...): %mscript_set_env: no memory for variablescript_set_env: no memory for variable assignmentillegal character (%c) in value '%s'%s%s=%sdaemonInvalid IP address in option: %sBogus Host Name option %d: %s (%s)unknown dhcp option value 0x%xwarning: hostname %s contains an underscore which violates RFC 952option_as_string: bad code %ddhcp option too largecannot fork%s [priv]poll errorCorrupt lease file - possible data loss!expecting a statement.semicolon expected.expecting string or hexadecimal datastring constant too long.expecting hexadecimal constant.hexadecimal constant too long.expected option name.expecting semicolon.%s: unexpected option name.%s: too many options.expecting interface name (in quotes).expecting left brace.unterminated interface declaration.no memory for lease.unterminated lease declaration.wrong interface name. Expecting '%s'.expecting lease declaration.expecting identifier after option keyword.no option named %sexpecting number.expecting identifier.truefalseexpecting boolean.Bad format %c in parse_option_param.expecting string.option data buffer %soption data buffer overflowout of memory allocating option data.parse_option_declExpecting media options.no memory for string list entry.no memory for reject list!parse_reject_statementexpecting IP address.getifaddrs failedno space to remember ifpCan't allocate poll structures.No live interfaces to poll on - exiting.poll: %mreceive_packet failed on %s: %sInterface %s no longer appears valid.got_oneCan't create socketinterface_link_forceupinterface_link_forcedownioctl(SIOCGIFFLAGS) on %s: %mioctl(SIOCGIFMEDIA) on %s: %mCan't allocate timeout structure!can't allocate protocol struct for %sinterface_link_status/dev/bpf%dCan't find free bpf: %mCan't attach interface %s to bpf device %s: %mif_register_bpfCan't get BPF version: %mKernel BPF version out of range - recompile dhcpd!Can't set immediate mode on bpf device: %mCan't set filter-drop mode on bpf device: %mCan't get bpf buffer length: %mCan't allocate %lu bytes for bpf input buffer.Can't install packet filter program: %mCan't install write filter program: %mCannot lock bpfsend_packet: %msend_packetcSclarger than bufferoption %s (%d) %s.Many bogus options seen in offers. Taking this offer in spite of bogus options - hope for the best!rejecting bogus offer.Can't allocate storage for option %s.Can't expand storage for option %s.pretty_print_option: bad code %d%s: Excess information in format string: %s%s: garbage in format string: %s%s: expecting at least %d bytes; got %d%s: %d extra bytes%s: %d extra bytes at end of arrayUnexpected format code %cpretty_print_optionDiscarding packet with invalid hlen.do_packeteof in string constantstring constant larger than internal buffernumeric token larger than internal bufferbackoff-cutoffbootpdenyethernetfddifixed-addresshardwareinitial-intervallink-timeoutprependrebindrenewrequireretryscriptselect-timeoutserver-namesupersedetimeouttoken-ringexiting. %s line %d: %s%s^subnet_numberbroadcast_addraddr_eqpiaddr%d bad IP checksums seen in %d packetsip length %d disagrees with bytes received %d.%d udp packets in %d too long - droppedaccepting packet with data after udp payload.%d bad udp checksums in %d packetssubnet-masktime-offsetIAtime-serversien116-name-serversdomain-name-serverslog-serverscookie-serverslpr-serversimpress-serversresource-location-servershost-nameboot-sizemerit-dumpdomain-nameswap-serverroot-pathextensions-pathip-forwardingnon-local-source-routingpolicy-filterIIAmax-dgram-reassemblydefault-ip-ttlpath-mtu-aging-timeoutpath-mtu-plateau-tableSAinterface-mtuall-subnets-localbroadcast-addressperform-mask-discoverymask-supplierrouter-discoveryrouter-solicitation-addressstatic-routestrailer-encapsulationarp-cache-timeoutieee802-3-encapsulationdefault-tcp-ttltcp-keepalive-intervaltcp-keepalive-garbagenis-domainnis-serversntp-serversvendor-encapsulated-optionsnetbios-name-serversnetbios-dd-servernetbios-node-typenetbios-scopefont-serversx-display-managerdhcp-requested-addressdhcp-lease-timedhcp-option-overloaddhcp-message-typedhcp-server-identifierdhcp-parameter-request-listBAdhcp-messagedhcp-max-message-sizedhcp-renewal-timedhcp-rebinding-timedhcp-class-identifierdhcp-client-identifieroption-62option-63nisplus-domainnisplus-serverstftp-server-namebootfile-namemobile-ip-home-agentsmtp-serverpop-servernntp-serverwww-serverfinger-serverirc-serverstreettalk-serverstreettalk-directory-assistance-serveruser-classoption-78option-79option-80option-81option-82option-83option-84nds-serversnds-tree-namends-contextoption-88option-89option-90option-91option-92option-93option-94option-95option-96option-97option-98option-99option-100option-101option-102option-103option-104option-105option-106option-107option-108option-109option-110option-111option-112option-113option-114option-115option-116option-117option-118option-119option-120option-121option-122option-123option-124option-125option-126option-127option-128option-129option-130option-131option-132option-133option-134option-135option-136option-137option-138option-139option-140option-141option-142option-143option-144option-145option-146option-147option-148option-149option-150option-151option-152option-153option-154option-155option-156option-157option-158option-159option-160option-161option-162option-163option-164option-165option-166option-167option-168option-169option-170option-171option-172option-173option-174option-175option-176option-177option-178option-179option-180option-181option-182option-183option-184option-185option-186option-187option-188option-189option-190option-191option-192option-193option-194option-195option-196option-197option-198option-199option-200option-201option-202option-203option-204option-205option-206option-207option-208option-209option-210option-211option-212option-213option-214option-215option-216option-217option-218option-219option-220option-221option-222option-223option-224option-225option-226option-227option-228option-229option-230option-231option-232option-233option-234option-235option-236option-237option-238option-239option-240option-241option-242option-243option-244option-245option-246option-247option-248option-249option-250option-251option-252option-253option-254option-endpadvalue %s%o exceeds max (%d) for precision.value %s%x exceeds max (%d) for precision.value %s%u exceeds max (%d) for precision.Unexpected integer size: %dfilename must be a stringno memory for string %s.expecting a network hardware typeExpecting numeric lease timeno space for numeric aggregatenumeric aggregate too short.Bogus number: %s: digit %d not in base %dBogus number: %s.numeric day of week expected.numeric year expected.expected slash separating year from month.numeric month expected.expected slash separating month from day.numeric day of month expected.numeric hour expected.expected colon separating hour from minute.numeric minute expected.buf_open: %mbuf_add: %mbuf_close (connection closed)buf_close (short write): %mbuf_close: %mbuf_read (connection closed)buf_read (short read): %mbuf_read: %mcorrupted message receivedreceived unknown message, code %ddispatch_imsgcannot read temp filecannot seek temp fileline too longcannot write temp fileinvalid address/tmp/ed.XXXXXXXXXXw+cannot open temp filecannot close temp fileEnter key: get_keywordbad hex digit in keybad binary digit in keydes_setkeydes_ciphercbc_decodedecryption failed (block corrupted)decryption failed (incomplete block)cannot read fileinvalid pattern delimiter& no previous commandunexpected end-of-filecannot close input filecannot open input file%lu newline inserted newline appended cannot read input filecannot close output filecannot open output filecannot write filecannot read stdin \abfnrtv\\ warning: file modifiedinvalid filename@(#) Copyright (c) 1993 Andrew Moore, Talke Studio. All rights reserved. usage: %s [-] [-sx] [-p string] [name] p:sx ? interrupt? script, line %d: %s number out of rangeinvalid redirectioninvalid destinationno previous substitutiondestination expectedcannot nest global commandsno current filenameunexpected command suffixinvalid command suffixunexpected addressno matchfilename too longshell access restrictedinvalid mark charactered.hup/ed.hupno previous patterntrailing backslash (\)unbalanced brackets ([])infinite substitution loopnothing to undoHLPRfiprthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s%s: name too long (not copied)cannot overwrite directory %s with non-directory %s%s is a directory (not copied).%s and %s are identical (not copied).overwrite %s? readlink: %sunlink: %scopy_linksymlink: %smkfifo: %smknod: %schown: %schflags: %sutimes: %slchown: %susage: %s [-fip] [-R [-H | -L | -P]] source_file target_file %s [-fip] [-R [-H | -L | -P]] source_file ... target_directory ...QX$ZS `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @      inflate 1.2.3 Copyright 1995-2005 Mark Adler  #+3;CScs !1Aa  0@`@@22.l2x22222.%s not a regular file%s%s already has %s suffix -- unchanged%s: unknown suffix: ignored%s%s: name too long%s: input: %sdeflate.gzzcatzipunknown program nameGZIPGZIP is too longoption -a is ignored on this systemillegal bit count -- %s-o argument is too long123456789ab:cdfghlLnNOo:qrS:tvV-o option may only be used with a single input filemay not mix -o, -c, or -t options%s is a directory: ignored: unchangedcompression not supported%s: won't read compressed data from terminal%s: unrecognized file formatcrc errordodecompressfchown: %sfchmod: %sfchflags: %sfutimes: %sZgzztgztaz.-_method crc date time compressed uncompressed ratio uncompressed_name%-7.7s %08x %s %10lld %10lld %4.1f%% %s %10lld %10lld %4.1f%% (totals) OK %4.1f%% -- replaced with %s %lld bytes in, %lld bytes out usage: %s [-123456789cdfghLlNnOqrtVv] [-b bits] [-o filename] [-S suffix] [file ...] 1.2.3put_headerfile errorstream errordata errorinsufficient memorybuffer errorincompatible versionneed dictionarystream end@(#) Copyright (c) 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: chmod.c,v 1.23 2006/04/25 15:41:07 deraadt Exp $HLPRXfghorstuwxinvalid flags: %sinvalid flag: %sthe -R and -h options may not be specified together.user is %s: %sgroup is %s: %susage: %s [-R [-H | -L | -P]] %s file ... [owner][:group]usage: %s [-fh] [-R [-H | -L | -P]] %s file ... $OpenBSD: dir.c,v 1.17 2004/07/05 02:31:54 pvalchev Exp $$OpenBSD: inode.c,v 1.26 2003/10/11 01:43:45 tedu Exp $@(#) Copyright (c) 1980, 1986, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: main.c,v 1.27 2006/04/17 09:34:16 moritz Exp $$OpenBSD: pass1.c,v 1.20 2006/03/22 20:24:32 deraadt Exp $$OpenBSD: pass1b.c,v 1.13 2006/03/22 20:24:32 deraadt Exp $$OpenBSD: pass2.c,v 1.25 2006/03/22 20:24:32 deraadt Exp $$OpenBSD: pass3.c,v 1.12 2006/03/22 20:24:32 deraadt Exp $$OpenBSD: pass4.c,v 1.15 2006/03/22 20:24:32 deraadt Exp $$OpenBSD: pass5.c,v 1.24 2006/04/27 02:40:03 pedro Exp $$OpenBSD: fsutil.c,v 1.15 2006/05/28 15:43:41 thib Exp $$OpenBSD: setup.c,v 1.24 2006/04/17 19:18:08 deraadt Exp $$OpenBSD: utilities.c,v 1.30 2006/04/17 19:33:54 deraadt Exp $?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@dirscanexpanddir blk + cnt %d > sblock.fs_fpg %d cannot allocate memory for inode cache cannot increase directory listCG %d: BAD MAGIC NUMBER dfpnNyYb:c:m:conversion levelusage: %s [-fnpy] [-b block#] [-c level] [-m mode] filesystem ... %d files, %d used, %d free (%d frags, %d blocks, %d.%d%% fragmentation) phase 1, inode %d/%dcheckinodeconvert symlink %d(%s) of size %llu cannot read symlink phase 1b, inode %d/%dphase 2, directory %d/%dphase 2, parent directory %d/%d%s %s: LENGTH %ld NOT MULTIPLE of %d%s %s: LENGTH %ld NOT MULTIPLE OF %d (REMOVED)phase 3, directory %d/%ldphase 4, inode %d/%dphase 5, cg %d/%dCREATCANNOT %s CLUSTER MAPS SUMMARY INFORMATION BADBLK(S) MISSING IN BIT MAPSALLOCATED FRAG %ld MARKED FREE ALLOCATED INODE %ld MARKED FREE FREE BLK COUNT(S) WRONG IN SUPERBLKCREATE CLUSTER MAPS%sING CLUSTER MAPS DELETING CLUSTERING MAPS DELETE CLUSTERING MAPSUNKNOWN ROTATIONAL TABLE FORMAT %d INFORMATION; SEE fsck_ffs(8).IMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCK (FIXED)IMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=%x IN SUPERBLOCKINCORRECT FMASK=%x IN SUPERBLOCKINCORRECT MAXFILESIZE=%llu IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%lx IN SUPERBLOCKINCORRECT QFMASK=%lx IN SUPERBLOCKcannot alloc %u bytes for cylinder group summary area cannot alloc %lu bytes for lncntp cannot alloc %lu bytes for inphead CONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATIMPOSSIBLE MINFREE=%d IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCKclean = %d CPG OUT OF RANGENCYL LESS THAN NCG*CPGSIZE PREPOSTEROUSLY LARGEoffset %d, original %ld, alternate %ld NCG OUT OF RANGE%s: NOT LABELED AS A BSD FILE SYSTEM (%s) UPDATE STANDARD SUPERBLOCKcatchinfo   init: %s init: already running initial setsid() failed: %mrootsetlogin() failed: %munrecognized flag '-%c'sfignoring excess argumentsfatal signal: %scannot get kernel security level: %scannot change kernel security level from %d to %d: %scan't open %s: %mcan't get %s for controlling terminal: %m/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/bincan't exec %s for single user: %mcan't fork single-user shell, trying againwait for single-user shell failed: %m; restartinginit: shell stopped, restarting single user shell terminated, restartingsingle user shell terminated.single_userautobootcan't exec %s for %s: %mcan't fork for %s on %s: %mwait for %s on %s failed: %m; going to single user modeinit: %s on %s stopped, restarting %s on %s terminated abnormally, going to single user modesession database close: %ssession database open: %sinsert %d: %sdelete %d: %scan't parse getty for port %scan't allocate windowcan't parse window for port %scan't fork for window system on port %s: %msetsid failed (window) %mcan't exec window system '%s' for port %s: %mcan't fork for getty on port %s: %mgetty repeating too quickly on port %s, sleepingcan't exec getty '%s' for port %s: %mport %s changed utmp index from %d to %dcan't exec %s for %s %s: %msome processes would not die; ps axl advisedNOS:T:a:b:c:d:e:f:g:h:i:k:l:m:o:p:qr:s:t:u:x:z:P:T:a:b:c:d:e:f:i:m:o:s:%s: can't figure out file system partitiondisagrees with disk label%s (%d) %s (%lu) Warning: calculated sectors per cylindermfs:%dNumber of cylinders restricts cylinders per group to %d. Warning: changing optimization to space because minfree is less than %d%% %s: no default sector size%s: no default #sectors/track%s: no default #tracks%s: maximum file system size on the `%c' partition is %d%s: `%c' partition overlaps boot program%s: `%c' partition is unavailable%s: %s: not a character-special device %s: getmntinfo: %s%sr%snewfs_%s%s/newfs_%s%s not found%s: bad sector size%s: bad maximum contiguous blocks %s: bad block size%s: bad cylinders/group%s: bad rotational delay %s: bad blocks per file in a cylinder group %s: bad fragment size%s: bad average file size%s: bad average files per dir%s: bad bytes per inode %s: bad track skew%s: bad interleave%s: bad free space %% %s: unknown optimization preference: use `space' or `time'.%s: bad spare sectors per track%s: bad revolutions/minute %s: bad file system size%s: bad sectors/track%s: bad spare sectors per cylinder%s: bad total tracksinsane maxpartitions value %d%s: mount: %sabnormal terminationioctl (WDINFO)%s: can't rewrite disk label-N do not create file system, just print out parameters-O create a 4.3BSD format filesystem-P src populate mfs filesystem-S sector size-T disktype-a maximum contiguous blocks-b block size-c cylinders/group-d rotational delay between contiguous blocks-e maximum blocks per file in a cylinder group-f frag size-g average file size-h average files per directory-i number of bytes per inode-k sector 0 skew, per track-l hardware sector interleave-m minimum free space %%-n number of distinguished rotational positions-o optimization preference (`space' or `time')-p spare sectors per track-r revolutions/minute-s file system size (sectors)-t file system type-u sectors/track-x spare sectors per cylinder-z tracks/cylinderusage: %s [ -fsoptions ] special-device mount-point usage: %s [ -fsoptions ] special-device where fsoptions are: %s: exitedchdircannot stat %s%s: not a dir or a block device-rw-pe/bin/pax%s: mount (update, rdonly)unmount %scopy %s to %s failedrmdir %smount %s %s/mnttmp mountpoint %s busygettmpmnttmp mountpoint %s too longmntXXXXXXXXXXmkdtemp %stmp mount point too long%s: initializing cg %ld/%d siginfopreposterous size %u, max is %upreposterous ntrak %dpreposterous nsect %dillegal expected average file size %dillegal expected number of files per directory %dblock size must be a power of 2, not %dfragment size must be a power of 2, not %dfragment size %d is too small, minimum is %dblock size %d is too small, minimum is %dblock size %d is too large, maximum is %dno block size to support this diskminimum bytes per inode isWith a block size of %d %s %ld With %d sectors per cylinder, minimum cylinders per group is %ld CylinderWarning: cylinder%s groups must have a multiple of %ld cylinders panic (fs_cpg * fs_spc) %% NSPF != 0cylinder groups must have at least %ld cylinders!mapcramped && !inodecrampedBlock size and bytes per inode restrictBlock size restrictsBytes per inode restrict cylinders per group to %d. file systems must have at least one cylinder (not %d)and ntrak File system performance may be impaired. rotational layout tables with nsectWarning: insufficient space in super block for %s %s %d %s %d.%sWarning: inode blocks/cyl group (%ld) >= data blocks (%ld) in last cylinder group. This implies %ld sector(s) cannot be allocated. mkfsfsinit failedsuper-block backups (for fsck -b #) at:%s: %d sectors in %d %s of %d tracks, %d sectors %.1fMB in %d cyl groups (%d c/g, %.2fMB/g, %d i/g) cg summaryWarning: %d sector(s) in last cylinder unallocated filesystem must have at least %d sectorsinode blocks/cyl group (%ld) >= data blocks (%d) number of cylinders per cylinder group (%d) %s. must be increased%s to be changed from %d to %d This requires the block size %s to be changed from %d to %d and the fragment sizeWith %d bytes per inode, Minimum bytes per inode is %ld block size (%d) cannot be smaller than fragment size (%d)fragment size %d is too small, minimum with block size %d is %dpanic: cylinder group too bigcg 0: bad magic numberinternal error: can't find block in cyl 0first cylinder group ran out of spacecg 0: bad magic number (0x%06x != 0x%06x)fsinit: inode value %d out of rangerdfs: read error on block %dwtfs: write error on block %disblock bad fs_frag %d clrblock bad fs_frag %d setblock bad fs_frag %d dfiPRr%s: is a directoryrm_overwrite%s (inode %u): not overwritten due to multiple links%s: malloccheckoverride %s%s%s/%s for %s? remove %s? "." and ".." may not be removedusage: %s [-dfiPRr] file ... bsfbsrdensityeomfsffsrofflinerewindrewofflretensionweof%s: illegal count%s: unknown commandf:ioctl MTIOCGETWriteProtectMounted76543210%s tape drive, residual=%d erblocksize: %d (%d) density: %d (%d) %d: unknown tape drive type usage: %s [-t] device usage: %s [-f device] command [count] Lost connection to remote host.shell/tcp: unknown service/etc/rmtwho are you?invalid user name: %sO%s %d rmtopenC S I%d %d ioctlrmtioctlProtocol to remote tape server botched (code "%s").rmtreplyProtocol to remote tape server botched.(rmtgets got "%s").m:pusage: %s [-p] [-m mode] dirname ... $OpenBSD: compile.c,v 1.21 2005/04/11 07:11:44 deraadt Exp $0123456789/\$invalid command code %cextra characters at the end of %c commandcommand %c expects \ followed by textextra characters after \ at the end of %c commandunexpected }branchempty labelread commandw commandfilename expectedunterminated substitute patternsubstitute pattern can not be delimited by newline or backslashextra text at the end of a transform commandcommand %c expects up to %d address(es), found %dcommand expectedunexpected EOF (pending }'s)\ can not be used as a string delimiternewline can not be used as a string delimitercompile_reRE error: %sunterminated substitute in regular expression123456789\%c not defined in the REunescaped newline inside substitute patternnumber in substitute flags out of rangemore than one number or 'g' in substitute flagsbad flag in substitute command: '%c'compile_flagsno wfile specifiedunterminated transform source stringcompile_trtransform strings are not the same lengthunterminated transform target stringtransform pattern can not be delimited by newline or backslashcompile_textexpected context addressunterminated regular expressionwhitespace after %sundefined label '%s'duplicate label '%s'unused label '%s'$OpenBSD: main.c,v 1.9 2003/06/10 22:20:50 deraadt Exp $ae:f:nusage: sed script [-an] [file ...] sed [-an] [-e script] ... [-f script_file] ... [file ...] stdout: %s ..."$OpenBSD: misc.c,v 1.6 2004/07/20 03:50:26 deraadt Exp $sed: %lu: %s: $OpenBSD: process.c,v 1.12 2003/11/07 02:58:23 tedu Exp $\%d not defined in the REflush_appends\ \abfnrtv%03ofirst RE may not be emptyuuwH w w p w w w" w w, wX   w w w w x x H% |c(yd+ y0& yA y5 y|A y5 y2 yT? zl4 z0& zl4 z6 (zH& 0z9 8z<3 @z, Hz\- PzA Xz0& `z Q hz' pz8 a@ -a-b-c-d -e-f-G-g-h -H -k-L -n-O-o-p -r-s-S -t-u-w-x-z===!=<>-eq-ne-gt-ge-lt -le!-ef"-nt#-ot$Pn4{l|̬8{tL{f\{cp{d{s{l{m{nTpl X} |T |Ԕ | |r |\u |ds }u } (} 4}|} <} }   L}Ȋ 0~ \}q l}p |}܇ } }t } }  }ć } }z } }|u ~l ~{ ~u 0~| @~} H~h X~L l~} t~` ~`{ ~,| ~ ~t ~\ ~ ~ P H   (4 8x Dp Th d p xhb fd'(! ! %"#)< >g  0y7#-1 1= ?2*?* /&.&_606162636465666768695U5u4L4l3C3c[O%A"BCD4++--==!== *= /= %= += -= <<= >>= &= ^= |= <<>><=>=<>&& || */%+-&^|? , ~!():HIFS= ${PS2=> } ${PS3=#? } ${PS4=+ }Ԋl@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: mknod.c,v 1.1 2005/10/06 06:39:36 otto Exp $aȍԍc܍\ei(kl X8Tm,Cjn8f@HbPuXdlpārbsxhLvdxlet cpx  $ 4P  {}l|đ@~ ||&&!()xq}qqqq]]<>HY p|XH  а  ȔДؔ@(#)PD KSH v5.2.14 99/07/13.2 AAA  Q AA A QBunable to allocate memoryLPrestricted shell - can't cdOLDPWDdon't know current directoryCDPATH%s: bad directorytoo many argumentsno OLDPWDno home directory (HOME not set)can't get current directory - %sRnprsu,-p: %s-u: %s: %spvVpv is a reserved word special is a%s shell builtin is a function undefined (autoload from %s) tracedn exported%s is *GOK*exported is an %salias for alias %s= is a tracked %salias for not foundL#R#UZ#fi#lprtuxfunction %s %T %s() %T %s: not identifierexportreadonly%s[%d]typeset -U -u -l -Z -R%d -L%d -t -r -x -i only -t, -u and -x options may be used with -funalias-tadprtUxalias: -r flag can only be used with -t and without arguments alias %s alias not found adtno argumentslpnzjob control not enabled%%%*d %*s %s%*d %*d %sls:bad signal `%s'Usage: kill [ -s signame | -signum | -signame ] {pid|job}... kill -l [exit_status] %s: arguments must be jobs or process IDsmissing name argument%s: is not an identifierarguments changed since last callOPTARGc_getopts: no argvmissing options argumentlm+alias+cd+command*=export+fc+getopts+jobs+killlet*=readonly=typeset+unaliaswhence+bg+fg%s%*ldm%ld.%02lds%snothing to shift%s: bad numberc_umask=+-rwxugoXsbad maskaugo%#3.3o ugorwxprsu,%s is read onlytrap -- bad signal %s%s: can only %s %d level(s)%s: cannot %sfv%s%*ld.%02ld%sreal user sys system user real :ptime: -%s requires an argumenttime: -%s unknown optioninvalid file modeusage: mknod [-m mode] name [b | c] major minorusage: mknod [-m mode] name p*=.*=:[*=break=builtin*=continue*=eval*=exec*=exit+false*=return*=set*=shift=times*=trap+=wait+readtest+trueulimit+umask*=unset-tmissing ]internal error: unknown opunexpected operator/operandmissing closing parenmissing argumentmissing expression operatormissing second argumentexpression expected-atime(cpu-seconds)file(blocks)coredump(blocks)data(kbytes)stack(kbytes)lockedmem(kbytes)memory(kbytes)nofiles(descriptors)ulimit: %cunlimited%-20s unlimited bad limit: %sexceeds allowable limitinvalid limit: %sx_modefileglob: substitute errorFPATH;|&()`*+?@!IFS\$(){}*&;#|<>"'`beginning-of-historycomplete-commandcomplete-filecompletedelete-char-backwarddelete-word-backwarddelete-char-forwarddelete-word-forwardkill-lineredrawend-of-historyeot-or-deletegoto-historymacro-stringauto-insertkill-to-eolkill-regionlist-commandlist-fileprefix-1prefix-2yank-popbackward-charbeginning-of-linebackward-wordend-of-lineforward-charforward-wordnewlinedown-historynewline-and-nextno-opup-historyprev-hist-wordsearch-character-forwardsearch-character-backwardsearch-historyset-mark-commandstuffstuff-resettranspose-charsexchange-point-and-markcomplete-listexpand-filecapitalize-worddowncase-wordupcase-wordset-argcommentx_search_hist I-search: nothing to yank yank something first%s = '%s' %s: no such functioncannot bind, not a ttyPOSIXparameter null or not setexpand(NULL)%S%s: bad substitutionsubstitute%s: parameter not set%s: cannot open $() input%Rfunny $() command: %s*+?@! coprocess already existsPS4%s: can't find function definition file%s: can't find function definition file - %s%s: function not defined by %sCFUNC %d%s: can't open function definition file %s - %s%s: cannot execute - %s%s: restrictedcommand -p: restrictedbuiltin: %s: not a builtinEXECSHELL%s: %s: %sshcomexec: %scould not finish (dup) redirection %s: %sdupcannot %s %s: %s%s%s herein: yylexerror writing %s: %scan't %s temporary file %s: %shere document missing-rPS3%*d) %sdbteste_isadbteste_error: %s (offset %d)%s: unexpected `%s'end of expression%s: bad number `%s'%s: expression recurses on parameter `%s'%s: %s requires lvalue%s: %s applied to read only variablemissing )missing :zero divisorhistory functions not availablee:glnrs0,1,2,3,4,5,6,7,8,9,-%c%scan't use -e, -l, -n, -r with -s (-e -)can't use -l, -n with -e%.*s ${FCEDIT:-/bin/ed} $_error reading temp file %s - %scannot open temp file %serror writing temporary file - %scannot create temp file %s - %s-16substitution failed%s: not in history%s: invalid rangeno history (yet)HISTFILE%s.%dhist_shrinkinternal error: %s[%d]: shl_stdout not validtoo many files open in shellcan't create pipe - try againillegal file descriptor namefd not open for readingfd not open for writingbad file descriptorno coprocess/tmp%s/shXXXXXXXXstoppedrunning and You have %s%s%s jobs no such jobambiguousargument must be %job or process idwarning: won't have full job controlj_init: tcsetpgrp() failed: %sj_init: setpgid() failed: %sj_init: tcgetpgrp() failed: %sj_init: getpgrp() failed: %s[%d]jw:last procchildexchild: execute() returnedexchild: XPIPEI and no last_job - pid %dcannot fork - try againwaitlast: no last jobjw:waitlastwaitlast: not startedjw:waitfor| jw:resumecannot continue job %s: %sfg: 2nd tcsetpgrp(%d, %d) failed: %s1st tcsetpgrp(%d, %d) failed: %s[%d] job not job-controlledjobsnotifyzombiej_async: bad nzombie (%d)j_async: job not startedj_waitj: tcsetpgrp(%d, %d) failed: %scheckjobcheck_job: job started (flags 0x%x) Running (core dumped)%-20s %s%s%sj_print%s%5d %-20s %s%s %s%s%s%s %5d [%d] %c DoneDone (%d)remove_job: job not found (%s)no closing quote here document `%s' unclosed \$PS1PS2dopprompt\%c%r%l:%M:%S%a %b %d~/%smissing ] MAILyou have mail in $_typesetKSH_VERSION-xPPIDOPTIND=1evaltypeset -i RANDOM MAILCHECK="${MAILCHECK-600}" SECONDS="${SECONDS-0}" TMOUT="${TMOUT-0}"hash=alias -ttype=whence -vstop=kill -STOPsuspend=kill -STOP $$autoload=typeset -fufunctions=typeset -fhistory=fc -linteger=typeset -inohup=nohup local=typesetr=fc -e -login=exec login-tUccdatemailmakeprviwhoENVSH_VERSION$ /etc/suid_profile/etc/profile$HOME/.profileCannot determine current working directory-c requires an argumentUSERinclude: %dUse `exit' to leave ksh shell: %d%s%s-`%c' requires argument%s%s-%c: unknown option |&;<>()*@#!$-? =-+?#% "#$&'()*;<>?[\`|0123456789ABCDEFallexportbraceexpandbgnicecsh-historyemacs-usemetaerrexitgmacsignoreeofinteractivemarkdirsnoclobbernoglobnohupnolognounsetphysicalposixprivilegedtrackallvirawvi-show8vi-tabcompletevi-esccompletextrace%-*s %sCurrent option settings -o %sgetoptionsparse_args: `%c'%s: bad optionA:o;sgmatch'\'%-*s%*sdo_phys_pathshf_fdopen: missing read/writeshf_reopen: bad shf/buf/bsizeshf_reopen: missing read/writeshf_sopen: flags 0x%xshf_flush: no fdshf_emptybuf: no fdshf_fillbuf: no fdshf_read: bsize %dshf_read: flags %xshf_getse: flags %xshf_getchar: flags %xshf_ungetc: flags %xshf_putchar: no fdshf_putchar: flags %xshf_write: nbytes %dshf_write: flags %xshf_snprintf: buf %lx, bsize %dshf_vfprintf0123456789abcdef(null %s)too many <<'s for%s: bad identifier too many redirections %s: invalid function name thenelseeliffiesacwhileuntildo{}[[&&||;;((|&unexpectedunmatchedsyntax error: `%s' %s ?%dsyntax error: unexpected EOF ERRError handlerEXITSIGtimed out waiting for inputsetexecsig: unset signal %d(%s)%S #no-args# #no-vars# ( %T) %T| %T%;%T%s %T ]] %Sdo%N%T%;done in %;for %s select %s case %S in%N(%S%c%;%T%N;;%Nesac %s %T%;doif %Telif %Telse%;%T%;fi then%N%T{%;%T%;} %T& function %s %T%s() %Ttime %T%T|& < >| <> <<- << >> <&>&wdscan: unknown char 0x%x (carrying on)j_ttyinit: can't set close-on-exec flag: %sj_ttyinit: dup of tty fd failed: %sNo controlling tty (open /dev/tty: %s)Can't find tty file descriptorOPTINDPOSIXLY_CORRECTHISTSIZEVISUALMAILCHECKMAILPATHRANDOMSECONDSTMOUTLINENO%s: subscript %ld out of range0123456789abcdefghijklmnopqrstuvwxyz0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZstr_valsetstr: %s=%s: assigning to self%s: is read only%0*s%.*s%*s%.*sy$%s %dfc -e ${VISUAL:-${EDITOR:-vi}} --grabhist: bad history arrayM-usage: %s seconds %s: destination pathname too longdo_moverename %s to %scan't remove %scannot resolve %scannot rename a mount point%s: remove%s: set times%s: set flags%s: set mode%s: set owner/group%s: set owner/group; not setting setuid/setgid%s: waitpid/bin/cp%s: terminated with %d (non-zero) status%s: did not terminate normally/bin/rm-rf-PRpusage: %s [-fi] source target %s [-fi] source ... directory |&=<>+-*/%:()syntax erroreval5division by zeronon-numeric argument_msgbufpM:N:sysctl: KERN_MSGBUFSIZEcouldn't allocate space for buffer datasysctl: KERN_MSGBUFusage: %s [-M core] [-N system] sethostnamegethostnameusage: %s [-s] [name-of-host] /var/run/utmplogout%s: not a device nodereadlabelfs%s: bad filesystem type in label%s: couldn't read disklabel%s%s%s%c/etc/fbtab(null)%s: bad entry: %s%o%s: %s: %mlogin_protect/*%s: chown(%s): %m%s: chmod(%s): %m%s: opendir(%s): %m%lld.%1lld%c%lld%c0B/var/log/wtmplogwtmp\\#TERMPATHtgetent.termcap /usr/share/misc/termcap/usr/share/misc/termcapTERMCAPOOPS?Ynacosacosfacos: DOMAIN error asinasinfasin: DOMAIN error atan2atan2fatan2: DOMAIN error hypothypotfcoshcoshfexpfy0y0fy0: DOMAIN error y1y1fy1: DOMAIN error yn: DOMAIN error ynynflgammalgammaflgamma: SING error loglogflog: SING error log: DOMAIN error log10: SING error log10log10flog10: DOMAIN error pow(0,0): DOMAIN error powfpowpow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sinhsinhfsqrtsqrtfsqrt: DOMAIN error fmodfmodffmod: DOMAIN error remainderremainderfremainder: DOMAIN error acoshacoshfacosh: DOMAIN error atanh: DOMAIN error atanhatanhfatanh: SING error scalbscalbfj0j0f: TLOSS error j1j1fjnjnfgammagammafgamma: SING error 0C0longjmp botch. no errorunknown/invalid errorresolved protocol is unknowninvalid value for hintsmemory allocation failureaddress family for name not supportedservice not supported for ai_socktypeai_socktype not supportedai_family not supportedno address associated with namenon-recoverable failure in name resolutiontemporary failure in name resolutionname or service is not knowninvalid value for ai_flagsxxswfstabscanfstab: rcmd: socket: %s rcmd: socket: All ports in use RSH%s: %s rcmd_afconnect to address %s: rcmd: %s: %s socket: protocol failure in circuit setup. rcmd: accept: %s rcmd: select (setting up stderr): %s select: protocol failure in circuit setup rcmd: write (setting up stderr): %s iruserok%s/.rhosts.rhosts lstat failed.rhosts not regular fileiruserok_sa.rhosts fstat failedbad .rhosts owner.rhosts writable by other than owner/etc/hosts.equiv__ivaliduser__ivaliduser_sa__icheckhostrcmd: address %s not listed for host %s__gethostloopgetnameinfoip6_parsenumeric/usr/bin/rshlocalhostrcmdsh: socketpairrcmdsh: dup2 failedrcmdsh: fork to lose parent failedrcmdsh: execvp %s failed: %s -lrcmdshrcmdsh: setuid(%u): %s rcmdsh: fork failedrcmdsh: unknown user: %s TpResolver Error 0 (no error)Unknown hostHost name lookup failureUnknown server errorNo address associated with nameResolver internal errorUnknown resolver errorrresvport_af%u.%u.%u.%u%u.%u.%u.%uinet_ntop4inet_ntop6%8xH.%02x:%02x:%02x:%02x:%02x:%02x.%u $(04<PrDHPX`hpt| Signal 0HUPINTILLTRAPABRTEMTFPEKILLBUSSEGVSYSPIPEALRMURGTSTPCONTCHLDTTINTTOUIOXCPUXFSZVTALRMPROFWINCHUSR1USR2b̰dp|̧ԧnosappndnosappendnoarchnoarchivednoschgnoschangenosimmutablenouappndnouappendnouchgnouchangenouimmutablenodumpnoopaque ,%ld%s-blocks%s: unknown blocksize%s: minimum blocksize is 512maximum blocksize is %dGBLOCKSIZE%02x:%02x:%02x:%02x:%02x:%02x%x:%x:%x:%x:%x:%x/etc/ethers+ ethers.byaddrether_ntohostethers.bynameether_hostton*** unknown regexp error code ***REG_NOMATCHregexec() failed to matchREG_BADPATinvalid regular expressionREG_ECOLLATEinvalid collating elementREG_ECTYPEinvalid character classREG_EESCAPEREG_ESUBREGinvalid backreference numberREG_EBRACKbrackets ([ ]) not balancedREG_EPARENparentheses not balancedREG_EBRACEbraces not balancedREG_BADBRinvalid repetition count(s)REG_ERANGEinvalid character rangeREG_ESPACEREG_BADRPTrepetition-operator operand invalidREG_EMPTYempty (sub)expressionREG_ASSERT"can't happen" -- you found a bugREG_INVARGinvalid argument to regex routineregerrorREG_0x%xsecurertsctssoftcarwindow/etc/ttys/var/run/dev.db__ttyname_r_basic/etc/protocolsgetnetanswerIN-ADDR.ARPAgetnetbyaddr0.0.0.%u.in-addr.arpa%u.%u.%u.%u.in-addr.arpa0.%u.%u.%u.in-addr.arpa0.0.%u.%u.in-addr.arpagetnetbyname/etc/networks/etc/groupgrscangroup.bynamegroup.bygidreadpassphraseglob3g_opendirg_lstatg_statmaster.passwd.bynamepasswd.byname__YP!__has_yppwgetpwnamgetpwuidmaster.passwd.byuidpasswd.byuid/etc/spwd.db/etc/pwd.db*netgroup: %m(%s,%s,%s)netgroup.byusernetgroupnetgroup.byhostnetgroup: db getnetgroup: Syntax error `%s'netgroup: Cycle in group `%s' ,/etc/netgroup.dbyp_first: clnt_callalphaABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzblankcntrl digitgraphABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~lowerabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ punct!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ upperABCDEFGHIJKLMNOPQRSTUVWXYZxdigit0123456789ABCDEFabcdefalnumABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789NULSOHSTXETXEOTENQBELalertBSbackspaceHTtabLFVTvertical-tabFFform-feedCRcarriage-returnSOSIDLEDC1DC2DC3DC4NAKSYNETBCANEMSUBIS4IS3GSIS2RSIS1USexclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfivesixseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettildeDEL[:<:]][:>:]]authunix_createauthunix_create: out of memory authunix_create_defaultauth_none.c - Fatal marshalling problemltĵ$0<Tht̶,@Tlltĵ$0<Tht̶,@TlHangupInterruptQuitIllegal instructionTrace/BPT trapAbort trapEMT trapFloating point exceptionKilledBus errorSegmentation faultBad system callBroken pipeAlarm clockTerminatedUrgent I/O conditionSuspended (signal)SuspendedContinuedChild exitedStopped (tty input)Stopped (tty output)I/O possibleCputime limit exceededFilesize limit exceededVirtual timer expiredProfiling timer expiredWindow size changesInformation requestUser defined signal 1User defined signal 2option requires an argument -- %coption requires an argument -- %sambiguous option -- %.*soption doesn't take an argument -- %.*sunknown option -- %cunknown option -- %sinet_net_pton_ipv40123456789abcdef0123456789/usr/src/lib/libc/net/inet_net_pton.cn >= 0 && n <= 9n >= 0 && n <= 15assertion "%s" failed: file "%s", line %d assertion "%s" failed: file "%s", line %d, function "%s" ipx_addr%d-%d-%d-%d-%d%x.%x.%x.%x.%x.%x%x,%x,%x%3x%3o%3dsscanfb0b1ncdtscilcshssbpxbxfxoxtxdxsimulatedgetenttc%s.db:\|:cgetnextexeclexecleexeclpexecvpexecvp: : path too long xdr_array: out of memory   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~realpathvfscanfgethostby*.getanswer: asked for "%s", got "%s"-_/getanswergethostby*.getanswer: asked for "%s %s %s", got type "%s"gethostbyaddr%x.%x.ip6.arpa/etc/hostshosts.byaddr_yp_gethtbyaddrhosts.byname:2*" <4,$ >6.&@80( 91)! ;3+# =5-% ?7/'91)! :2*" ;3+# <4,$?7/'>6.&=5-%      )4%/7(3-!0,1'8"5.*2$                                                                                                                                  @ @ @ @ @ ./ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz01234567896789:;<=>?  !"#$%&'()*+,-./012345%2.2u$bcrypt_gensaltOrpheanBeholderScryDoubtbcrypt 1Ѭߘr/Ḗ~&jE|,G$l iciNWqX~=t XrX͋qJT{YZ90`*#`(yA8۸y:`l>w'K1/x`\`U%U攫UbHW@cj9U*4\̴ATr|*oc]ũ+1t>\3֯\$lS2zw(H;Kkē!(f a!`|H2]]]u#&܈e>#Ŭom9BD . Ji^Bh!la gӫҠQjh/T(3Ql n;zP;*~ev9>YfCoEå}^;uos D@jVbNw?6r=B$7H ۛIrS{y%P;LylO`@ž\^c$johSl>9oR;Qm,0DE ^J3(fK.WtE9_ ӹyU 2`yr,@%g̣饎"2u<kaP/R=2`#H{1S>W\o.ViB~(2gsUO'[iXʻ]=!lJ[-ySeEIҐK3~ˤAb Lw6~д+MەqՓkю%ǯ/[{AI~-%^q h"W6d$ cUYCxSZ٢[} Źv&ϕbhAJsN-GJ{RQ)S?Wƛv`+t恵oWk *!ec.4dV]-SGjnpzKD). u#&İn}ߧI`fqilRdVឱ¥6)L u@Y>:䚘T?eB[k?ҡ08-M]% L&pc^?kh >\D}W7: P tAu8/;21>8TNmO Bo ,y|$ryVw.?rU$qk.P̈́GXzt}K:zfC cdG27;C$CMQe*P:qUN1w_V5kǣ;< $Y,n<pEㆱo ^*>Zw=Ne)։>%fRxL.jxS<- N=+6&9`y#RnfE{7(2åZl!Xeh;/ۭ}*/n[(!pa)uGa0a4c\s9pL ު˼,b`\ndi#PZe2Zh@*<1! T_~}=b7w-_h)5ǡޖXxWcr"ÃF T0.SHُ(1mX4a(s<|J]d]B> EꫪOlOBBǵj;Oe!AyMjGKPb=bF&[$ti GV[ Htb#*BXU >ap?#r3A~_;"lY7|`t˧@n2w΄PU5ai Z .zD4Egɞs͈Uy_g@Cge48>q(= m!>J=+hZ=@&L4)i Av.khq$j 3ԷCaP.9FE$tO!@MpE/f m1'A9UG%ښ ʫ%xP()Sچ, mbhiHפh'?Oz|Ϊ_7әxB*k@5 ٫9N;VmK1f&tn:2C[Ah xN جV@E'H::SU kKмgUXc)3VJ*%1?~^|1)p/'\,(H"m?H܆AyG@n]Q_2Տd5A4x{%`*`lc´2Of#k>3b $;" r(-Exb}doITH}'>AcG t.no:7`L knU{7,gm;e' )̒9 i{f} ϑ^و/$[Qy{;v.97yY̗&-1.Bh;+jLu.x7BjQ满PcKkؽ%=YBD n *Ngd_ڈ鿾dW{x`M``FѰ8Ew63kBqA_^;Z4ٷ,Q+:Ֆ}}>(-}|%rZLZq)GW;()f(.y_xU`uD^mm%adâW<'*:m?!cf&(3uU4V<wQ( gQ̫_QM08bX7 z{>d!Q2Ow~㶨F=)iSHd$m-if! FEdlX [@X̻k~jEY:D 5>ʹrdfGof,ҏ"W##v215VbuZ6ns҈bIPLVq z2E{Sb%ҽ5iq"|˶+v>S@`8G% 8vFšw``u N˅؍芰z~L\HjiԐ\-% ?2aN[wߏWr:j?$.Dsp"8 1).lN!(Ew8fTl 4)P|ɵՄ? Gy$1$%s%.*s$md5cryptMD5Pad__sbprintfbug in vfprintf: bad baseInfNaN__find_argumentsexponent?$@Y@@@@j@.AcAחAeA _BvH7BmB@0BļB4&k C7yAC؅W4vCNgmC=`XC@xDPKDMD7yACnF?O8M20HwZ?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~/&/etc/resolv.conf;#lookupsearchnameserversortlist_res_initRES_OPTIONSenvLOCALDOMAINndots:insecure1insecure2edns001234567890123456789abcdef0123456789ABCDEFinet_pton6  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~M8,08< PT `h pt  b04@H\X`hx8LK\j 8@!`d"xde<@fX\#t|INCHAOSHSHESIODANYname serverMDmail destination (deprecated)MFmail forwarder (deprecated)CNAMEcanonical nameSOAstart of authorityMBmailboxMGmail group memberMRmail renameNULLnullWKSwell-known service (deprecated)PTRdomain name pointerHINFOhost informationMINFOmailbox informationMXmail exchangerTXTRPresponsible personAFSDBDCE or AFS serverX25X25 addressISDNISDN addressrouterNSAPnsap addressNSAP_PTRsignaturePXmapping informationGPOSgeographical position (withdrawn)AAAALOClocationNXTnext valid name (unimplemented)EIDendpoint identifier (unimplemented)NIMLOCNIMROD locator (unimplemented)SRVserver selectionATMAATM address (unimplemented)IXFRincremental zone transferAXFRMAILBmailbox-related data (deprecated)MAILAmail agent (deprecated)UINFOuser information (nonstandard)UIDuser ID (nonstandard)GIDgroup ID (nonstandard)NAPTRURN Naming Authority"any"/etc/services,/("4"too smallsyslog_r: unknown facility/priority: %xvsyslog_r<%d>Error %d[%ld]%h %e %T syslog: unknown facility/priority: %xconnectlog_r/dev/log,048<@DHLPTX\dpx<$0<LPTJanFebMarAprMayJunJulAugSepOctNovDecJanuaryFebruaryMarchAprilJuneJulyAugustSeptemberOctoberNovemberDecemberSunMonTueWedThuFriSatSundayMondayTuesdayWednesdayThursdayFridaySaturday%H:%M:%S%m/%d/%y%a %b %e %T %YAMPM%a %b %e %H:%M:%S %Z %Y_fmt%Y-%m-%d%H:%M%2d%03d%I:%M:%S %p%e-%b-%Y%04d_conv-0GMTmnabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789 :+-._Local time zone must be set--see zic manual page/usr/share/zoneinfotzload/etc/localtimeposixrules,M4.1.0,M10.5.0TZvsnprintfyp_match: clnt_callyp_next: clnt_call/var/run/ypbind.lock_yp_dobindclntudp_createfcntl: F_SETFDYP server for domain %s not responding, still trying clnttcp_create%s/%s.%d/var/yp/binding,<`|(D`(D`x; errno = %s ; s1 = %u, s2 = %u ; why = (unknown authentication error - %d) ; low version = %u, high version = %u RPC: SuccessRPC: Can't encode argumentsRPC: Can't decode resultRPC: Unable to sendRPC: Unable to receiveRPC: Timed outRPC: Incompatible versions of RPCRPC: Authentication errorRPC: Program unavailableRPC: Program/version mismatchRPC: Procedure unavailableRPC: Server can't decode argumentsRPC: Remote system errorRPC: Unknown hostRPC: Port mapper failureRPC: Program not registeredRPC: Failed (unspecified error)RPC: Unknown protocolRPC: (unknown error code)%s: %s - %s Authentication OKInvalid client credentialServer rejected credentialInvalid client verifierServer rejected verifierClient credential too weakInvalid server verifierFailed (unspecified error)clnttcp_create: out of memory bindresvport_saxdrrec_create: out of memory perrorlibcUnknown error: Unknown signal: _catopen/usr/share/nls/%L/%N.cat:/usr/share/nls/%N/%LLANGNLSPATH0D\tq0Tdt$<Lp$8Xp $DTl Dh|$8Pt8PdUndefined error: 0Operation not permittedNo such file or directoryNo such processInterrupted system callInput/output errorDevice not configuredArgument list too longExec format errorBad file descriptorNo child processesResource deadlock avoidedPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkOperation not supported by deviceNot a directoryIs a directoryInvalid argumentToo many open files in systemToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksNumerical argument out of domainResult too largeResource temporarily unavailableOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketProtocol not availableProtocol not supportedSocket type not supportedOperation not supportedProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceOperation timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downNo route to hostDirectory not emptyToo many processesToo many usersDisk quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticatorIPsec processing failureAttribute not foundIllegal byte sequenceNo medium foundWrong medium typeltĵ$0<Tht̶,@Tlxdr_bytes: out of memory xdr_string: out of memory %$sniglet^&isatty ((((( AAAAAABBBBBB arc4_stirsnprintfHASH: Out of overflow pages. Increase page size %s/_hash.XXXXXXopen_temp.`p``P``0`L```H`X`X`XFadaGadP($ a(a0a08a0@a%LaP6Tac\acdaclataaa@ Hapapaa<a&a48a48a48aaaaȈ. aI bd b b b k̿ bh bh bh b (b ,bl 4b > P30123456789=:f/?/*?*n+n,N-N.m'E :e  :n:pt5T6:x&:d4-/:ttso_|%v !+ Hh VqQ:q:QZZ    l h b  w  i x X      0  $  k  j  is a directory is not a regular file (use -f to see it)zaz4zb@`TztzBpzzchz{4{dA\{x{eH{{{f{{FP|@|gd|||hL|}HAx$}8}iDT}t}}j<}}J!X}~lHLt ~@~m|X~h~x~n"d~~~pHP~q@~0r"Dhs!TS!u"$PlVw"܀x( XA,Tyltzȁ"~!\?#8L.Al| (press RETURN)... (interrupt to abort)pp8q381@(#) Copyright (c) 1992, 1993, 1994 The Regents of the University of California. All rights reserved. $NetBSD: mount_nfs.c,v 1.12.4.1 1996/05/25 22:48:05 fvdl Exp $ $OpenBSD: getmntopts.c,v 1.9 2004/07/05 18:33:38 otto Exp $Ȏмظ11"t €u6Uu|agPtPS[X!Using drive X, partition YMBR on floppy or old BIOS Read error No O/S No active partition OxUxalȭxحABCdDE F0G@UHVbaPb[c\efdhpi|Llnqqr̮sخvwxu@(#) Copyright (c) 1980, 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: umount.c,v 1.17 2006/06/29 12:51:26 jmc Exp $$OpenBSD: mount_msdos.c,v 1.19 2005/04/08 20:09:37 jaredy Exp $$OpenBSD: getmntopts.c,v 1.9 2004/07/05 18:33:38 otto Exp $ ll@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: mknod.c,v 1.14 2006/04/08 23:51:33 dhill Exp $ \hpDx|    [ ,_xFFj8ķ8TзEط E ܷ!"#$%& '() *$+0,8-D.L/.dxл(Ppؼ4T pksentrttvarrttssthreshsendpiperecvpipeexpirehopcountmtuUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CLONING XRESOLVE LLINFO STATIC BLACKHOLEPROTO3PROTO2PROTO1CLONEDSOURCEMPATHJUMBOUPBROADCASTDEBUGLOOPBACKPTPNOTRAILERSRUNNINGNOARP PPROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTDSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD LABELdM@pp AP|r.l|ج,dجJج7جججt@جج6ج:qج"جlCaجH5$ج87ج:DجX!Dج$% ج$(,ج878جج6@جxج ج0HجDPج Xجxج`جP6ج4ج#0aج`Iج|0(ج$(hجDXج%pج)جbج1xج)Tج8|جH8aج`I@ججج Iج$(ج<ج:ج ج`IجBج(!ججج8Tجج0ج6ج2ج0ج  جL'ججCج6ج2جHج?@[\ \0]H^T^h_t_`{{|}̳}~L P  , 4 ?.$,4<DLT\dhlt|Ħ̦ԦܦdDPjdt.......Ljm..g...Pj..̯ N  ./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz:./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789abcdef 0000000000000000}||0/40/0?0/40/D@ ,0/40/XAp|<T`   \P4\P\<,d4W"ܮ$NetBSD: ffs.S,v 1.5 2003/04/05 23:08:52 bjh21 Exp $$NetBSD: memcmp.S,v 1.2 2003/04/05 23:08:52 bjh21 Exp $.shstrtab.init.text.fini.rodata.data.eh_frame.gotpad0.got.ctors.dtors.gotpad1.bss.stack.arm.atpcs.note.openbsd.ident PP$tt _ $D`D%}}_+5]$>]C] J]Q$]$Z$$l _$f$q44~$ma  on}of!NI u p + & d _afs*QQafs Daemon/var/empty/sbin/nologin2_syslogd*IISyslog Daemon/var/empty/sbin/nologin2_kdc*;;Kerberos Server/var/empty/sbin/nologin2popa3d*POP3 Server/var/empty/sbin/nologin2_ospfd*UUOSPF Daemon/var/empty/sbin/nologin3U_dhcp*MMDHCP programs/var/empty/sbin/nologin3M_identd*identd/var/empty/sbin/nologin3_ppp*RRPPP utilities/var/empty/sbin/nologin1_ppp_mopd*NNMOP Daemon/var/empty/sbin/nologin1_mopd_rusersd* rpc.rusersd/var/empty/sbin/nologin1_rusersd_identd*identd/var/empty/sbin/nologin1_identdpopa3d*POP3 Server/var/empty/sbin/nologin1popa3dLGhc" ? : X " X _ppp*RRPPP utilities/var/empty/sbin/nologin2_pflogd*JJpflogd privsep/var/empty/sbin/nologin2_kadmin*<<Kerberos Admin Server/var/empty/sbin/nologin2sshd*sshd privsep/var/empty/sbin/nologin2nobody*Unprivileged user/nonexistent/sbin/nologin3_hostapd*VVHostAP Daemon/var/empty/sbin/nologin3V_mopd*NNMOP Daemon/var/empty/sbin/nologin3Nnamed*FFBIND Name Service Daemon/var/named/sbin/nologin3F_spamd*>>Spam Daemon/var/empty/sbin/nologin3>_rstatd*rpc.rstatd/var/empty/sbin/nologin3_isakmpd*DDisakmpd privsep/var/empty/sbin/nologin1_isakmpdsmmsp*Sendmail Message Submission Program/nonexistent/sbin/nologin1smmsp fa#A< r m & ! N I   { 5 { _ntp*SSNTP Daemon/var/empty/sbin/nologin2 _bgpd*KKBGP Daemon/var/empty/sbin/nologin2_spamd*>>Spam Daemon/var/empty/sbin/nologin2_portmap*portmap/var/empty/sbin/nologin2_dvmrpd*WWDVMRP Daemon/var/empty/sbin/nologin3W_tftpd*OOTFTP Daemon/var/empty/sbin/nologin3Oproxy*GGProxy Services/nonexistent/sbin/nologin3G_ftp*TTFTP Daemon/var/empty/sbin/nologin1_ftp_ntp*SSNTP Daemon/var/empty/sbin/nologin1_ntp_afs*QQafs Daemon/var/empty/sbin/nologin1_afs_rbootd*PPrbootd Daemon/var/empty/sbin/nologin1_rbootd_tftpd*OOTFTP Daemon/var/empty/sbin/nologin1_tftpd_kdc*;;Kerberos Server/var/empty/sbin/nologin1_kdc_x11*##X Server/var/empty/sbin/nologin1_x11_rstatd*rpc.rstatd/var/empty/sbin/nologin1_rstatdbin*Binaries Commands and Source,,,//sbin/nologin1binoi"ID { v   P _ftp*TTFTP Daemon/var/empty/sbin/nologin2!_tcpdump*LLtcpdump privsep/var/empty/sbin/nologin2uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico2_identd*identd/var/empty/sbin/nologin2 rootdaemonCharlie &/root/bin/ksh2_rbootd*PPrbootd Daemon/var/empty/sbin/nologin3P_rusersd* rpc.rusersd/var/empty/sbin/nologin3 rootdaemonCharlie &/root/bin/ksh3_hostapd*VVHostAP Daemon/var/empty/sbin/nologin1_hostapdproxy*GGProxy Services/nonexistent/sbin/nologin1proxy_portmap*portmap/var/empty/sbin/nologin1_portmapsshd*sshd privsep/var/empty/sbin/nologin1sshd[T vq ~ > 9 j e !  _ospfd*UUOSPF Daemon/var/empty/sbin/nologin2"_dhcp*MMDHCP programs/var/empty/sbin/nologin2www*CCHTTP Server/var/www/sbin/nologin2_rstatd*rpc.rstatd/var/empty/sbin/nologin2 daemon*The devil himself/root/sbin/nologin2_afs*QQafs Daemon/var/empty/sbin/nologin3Q_syslogd*IISyslog Daemon/var/empty/sbin/nologin3I_fingerd*!!fingerd/var/empty/sbin/nologin3!smmsp*Sendmail Message Submission Program/nonexistent/sbin/nologin3daemon*The devil himself/root/sbin/nologin3nobody*Unprivileged user/nonexistent/sbin/nologin1nobody_ospfd*UUOSPF Daemon/var/empty/sbin/nologin1_ospfd_pflogd*JJpflogd privsep/var/empty/sbin/nologin1_pflogd_kadmin*<<Kerberos Admin Server/var/empty/sbin/nologin1_kadmin$vm,%KB f a   p k ( # J E  j _hostapd*VVHostAP Daemon/var/empty/sbin/nologin2#_mopd*NNMOP Daemon/var/empty/sbin/nologin2_isakmpd*DDisakmpd privsep/var/empty/sbin/nologin2_rusersd* rpc.rusersd/var/empty/sbin/nologin2 operator*System &/operator/sbin/nologin2_ppp*RRPPP utilities/var/empty/sbin/nologin3R_pflogd*JJpflogd privsep/var/empty/sbin/nologin3Juucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico3Bpopa3d*POP3 Server/var/empty/sbin/nologin3operator*System &/operator/sbin/nologin3_dvmrpd*WWDVMRP Daemon/var/empty/sbin/nologin1_dvmrpd_tcpdump*LLtcpdump privsep/var/empty/sbin/nologin1_tcpdump_bgpd*KKBGP Daemon/var/empty/sbin/nologin1_bgpd_syslogd*IISyslog Daemon/var/empty/sbin/nologin1_syslogd_spamd*>>Spam Daemon/var/empty/sbin/nologin1_spamdoperator*System &/operator/sbin/nologin1operatordaemon*The devil himself/root/sbin/nologin1daemonrootdaemonCharlie &/root/bin/ksh1root\Vpk-( Z U    z + & W _dvmrpd*WWDVMRP Daemon/var/empty/sbin/nologin2$_tftpd*OOTFTP Daemon/var/empty/sbin/nologin2named*FFBIND Name Service Daemon/var/named/sbin/nologin2_fingerd*!!fingerd/var/empty/sbin/nologin2 bin*Binaries Commands and Source,,,//sbin/nologin2_ntp*SSNTP Daemon/var/empty/sbin/nologin3S_bgpd*KKBGP Daemon/var/empty/sbin/nologin3Kwww*CCHTTP Server/var/www/sbin/nologin3C_kdc*;;Kerberos Server/var/empty/sbin/nologin3;_x11*##X Server/var/empty/sbin/nologin3#sshd*sshd privsep/var/empty/sbin/nologin3bin*Binaries Commands and Source,,,//sbin/nologin3named*FFBIND Name Service Daemon/var/named/sbin/nologin1namedwww*CCHTTP Server/var/www/sbin/nologin1wwwuucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico1uucplg&!72 N I  g 1 g nobody*Unprivileged user/nonexistent/sbin/nologin2%_rbootd*PPrbootd Daemon/var/empty/sbin/nologin2proxy*GGProxy Services/nonexistent/sbin/nologin2_x11*##X Server/var/empty/sbin/nologin2 smmsp*Sendmail Message Submission Program/nonexistent/sbin/nologin2_ftp*TTFTP Daemon/var/empty/sbin/nologin3T_tcpdump*LLtcpdump privsep/var/empty/sbin/nologin3L_isakmpd*DDisakmpd privsep/var/empty/sbin/nologin3D_kadmin*<<Kerberos Admin Server/var/empty/sbin/nologin3<_portmap*portmap/var/empty/sbin/nologin3_dhcp*MMDHCP programs/var/empty/sbin/nologin1_dhcp_fingerd*!!fingerd/var/empty/sbin/nologin1_fingerd . install.md set_term() { local _tables TERM=${TERM:-${MDTERM:-vt220}} ask "Terminal type?" $TERM export TERM=$resp [[ -x /sbin/kbd ]] || return _tables=$(bsort $(kbd -l | egrep -v "^(user|tables|encoding)")) while :; do ask "kbd(8) mapping? ('L' for list)" "none" case $resp in [Ll?]) echo "Major tables: $_tables" ;; none) return ;; *) kbd $resp && { echo $resp >/tmp/kbdtype ; return ; } ;; esac done } welcome() { local _q cat <<__EOT Welcome to the $OBSD $MODE program. This program will help you $MODE OpenBSD in a simple and rational way. At any prompt except password prompts you can run a shell command by typing '!foo', or escape to a shell by typing '!'. Default answers are shown in []'s and are selected by pressing RETURN. At any time you can exit this program by pressing Control-C and then RETURN, but quitting during an $MODE can leave your system in an inconsistent state. __EOT set_term cat <<__EOT IS YOUR DATA BACKED UP? As with anything that modifies disk contents, this program can cause SIGNIFICANT data loss. __EOT case $MODE in upgrade) cat <<__EOT NOTE: once your system has been upgraded, you must manually merge any changes to files in the 'etc' set into the files already on your system. __EOT _q="Proceed with upgrade?" ;; install) cat <<__EOT It is often helpful to have the installation notes handy. For complex disk configurations, relevant disk hardware manuals and a calculator are useful. __EOT if [ -f /etc/fstab ]; then cat <<__EOT You seem to be trying to restart an interrupted installation! You can skip the disk preparation steps and continue, or you can reboot and start over. __EOT _q="Skip disk initialization?" else _q="Proceed with install?" fi ;; esac ask_yn "$_q" if [[ $resp == n ]]; then cat <<__EOT Enter 'halt' at the prompt to gracefully exit OpenBSD. You can then power cycle the machine and boot your original OS. __EOT exit fi echo "Cool! Let's get to it." } stripcom () { local _l [[ -f $1 ]] || return while read _l; do [[ -n ${_l%%#*} ]] && echo $_l done <$1 } scan_dmesg() { bsort $(sed -ne "$1" /var/run/dmesg.boot) } get_ifdevs() { ifconfig -a \ | egrep -v '^[[:space:]]|(bridge|enc|gif|gre|lo|pflog|pfsync|ppp|sl|tun|vlan)[[:digit:]]+:' \ | sed -ne 's/^\(.*\):.*/\1/p' } get_serialdev() { local _d _bd _td [[ -n $MDSERIAL ]] || exit set -- $MDSERIAL _d=$1 _bd=$2 _td=$3 set -- $(scan_dmesg "/^${_d}\([0-9]\) .*/s//\1/p") echo "$_bd$1 $_td$1" } get_drive() { ask_which "$1" "contains the $MODE media" "$2" [[ $resp == done ]] && return 1 makedev $resp || return 1 return 0 } get_partition() { local _drive=$1 _fstypes=$2 _part _fst disklabel $_drive 2>/dev/null \ | grep '^ [a-p]: ' \ | egrep -v "swap|unused" \ | sed -e 's/^ \(.\): *[^ ]* *[^ ]* *\([^ ]*\) .*/\1 \2/' \ >/tmp/parts.$_drive disklabel $_drive 2>/dev/null | grep '^ .:' ask_which "$_drive partition" "has the $MODE sets" \ "$(sed -e 's/^\(.\).*/\1/' /tmp/parts.$_drive)" [[ $resp == done ]] && return 1 _part=$resp _fst=$(sed -ne "/^$_part /s///p" /tmp/parts.$_drive) ask_which "filesystem type" "should be used to mount $_drive$_part" "$_fst $_fstypes ffs" case $resp in done) return 1 ;; $_fst) resp="$_part" ;; *) resp="$_part $resp" ;; esac return 0 } askpass() { set -o noglob stty -echo read resp?"$1 " stty echo set +o noglob echo } ask() { local _question=$1 _default=$2 set -o noglob while :; do echo -n "$_question " [[ -z $_default ]] || echo -n "[$_default] " read resp case $resp in !) echo "Type 'exit' to return to install." sh ;; !*) eval ${resp#?} ;; *) : ${resp:=$_default} break ;; esac done set +o noglob } ask_until() { resp= while [[ -z $resp ]] ; do ask "$1" "$2" done } ask_yn() { local _q=$1 _a=${2:-no} _resp typeset -l _resp while :; do ask "$_q" "$_a" _resp=$resp case $_resp in y|yes) resp=y ; return ;; n|no) resp=n ; return ;; esac done } ask_which() { local _name=$1 _query=$2 _list=$3 _def=$4 _err=$5 set -- $_list if (( $# < 1 )); then echo "${_err:=No ${_name}s found}." resp=done return fi : ${_def:=$1} _list="$*" while :; do ask "Available ${_name}s are: $_list.\nWhich one $_query? (or 'done')" "$_def" isin "$resp" $_list done && break echo "'$resp' is not a valid choice." done } isin() { local _a=$1 _b shift for _b; do [[ $_a == $_b ]] && return 0 done return 1 } addel() { local _a=$1 shift echo -n "$*" isin "$_a" $* || echo -n " $_a" } rmel() { local _a=$1 _b shift for _b; do [[ $_a != $_b ]] && echo -n "$_b " done } bsort() { local _l _a=$1 _b [[ $# -gt 0 ]] || return shift for _b; do if [[ $_a != $_b ]] ; then if [[ $_a > $_b ]] ; then _l="$_a $_l"; _a=$_b else _l="$_b $_l" fi fi done echo -n "$_a " bsort $_l } save_comments() { local _file=$1 if [[ -f /mnt/etc/$_file ]]; then grep "^#" /mnt/etc/$_file >/tmp/$_file.new [[ -f /tmp/$_file ]] && cat /tmp/$_file >>/tmp/$_file.new mv /tmp/$_file.new /tmp/$_file fi } edit_tmp_file() { local _file=$1 ask_yn "Edit $_file with $EDITOR?" [[ $resp == y ]] && $EDITOR /tmp/$_file } manual_net_cfg() { ask_yn "Do you want to do any manual network configuration?" [[ $resp == y ]] && { echo "Type 'exit' to return to $MODE." ; sh ; } } ftp_list_files() { ftp ${_ftp_active} -V -n "$1" <<__EOT user "$2" "$3" cd "$4" ls quit __EOT } makedev() { local _dev=$1 if [[ ! -r /dev/MAKEDEV ]] ; then echo "MAKEDEV not found. Can't create device nodes." return 1 fi cd /dev ; sh MAKEDEV $_dev || return 1 ; cd - >/dev/null } addhostent() { local _addr=$1 _name=$2 _delim="." [[ $_addr == *:* ]] && _delim=":" sed "/^[0-9a-fA-F]*[$_delim].* $_name\$/d" /tmp/hosts >/tmp/hosts.new mv /tmp/hosts.new /tmp/hosts echo "$_addr $_name" >>/tmp/hosts } select_sets() { local _avail=$1 _selected=$2 _next _f _action cat <<__EOT Select sets by entering a set name, a file name pattern or 'all'. De-select sets by prepending a '-' to the set name, file name pattern or 'all'. Selected sets are labelled '[X]'. __EOT while :; do _action= _next= echo for _f in $_avail; do if isin $_f $_selected; then echo " [X] $_f" else echo " [ ] $_f" : ${_next:=$_f} fi done : ${_next:=done} ask "Set name? (or 'done')" "$_next" case $resp in done) break ;; -*) _action=rmel ;; esac : ${_action:=addel} resp=${resp#+|-} case $resp in "") continue ;; all) resp=* ;; esac for _f in $_avail; do eval "case $_f in @($resp)) _selected=\`$_action $_f \$_selected\` ;; esac" done done resp=$_selected } configure_ifs() { local _IFDEVS=$IFDEVS _ifs _name _media _hn while :; do ask_which "interface" "do you wish to initialize" "$_IFDEVS" \ "" "No more interfaces to initialize" [[ $resp == done ]] && break _ifs=$resp _hn=/tmp/hostname.$_ifs ask "Symbolic (host) name for $_ifs?" "$(hostname -s)" _name=$resp _media=$(ifconfig -m $_ifs | grep "media ") if [[ -n $_media ]]; then cat <<__EOT The media options for $_ifs are currently $(ifconfig -m $_ifs | sed -n '/supported/D;/media:/p') __EOT ask_yn "Do you want to change the media options?" case $resp in y) cat <<__EOT Supported media options for $_ifs are: $_media __EOT ask "Media options for $_ifs?" _media=$resp ifconfig $_ifs $_media || return 1 ;; n) _media= ;; esac fi rm -f $_hn v4_config "$_ifs" "$_media" "$_name" "$_hn" v6_config "$_ifs" "$_media" "$_name" "$_hn" [[ -f $_hn ]] && _IFDEVS=$(rmel "$_ifs" $_IFDEVS) done } v4_info() { ifconfig $1 inet | sed -n ' 1s/.*/etc/resolv.conf.tail if [[ -n $_hn ]]; then _hn="send host-name \"$_hn\";" echo "Issuing hostname-associated DHCP request for $_ifs." else echo "Issuing free-roaming DHCP request for $_ifs." fi cat >/etc/dhclient.conf <<__EOT initial-interval 1; $_hn request subnet-mask, broadcast-address, routers, domain-name, domain-name-servers, host-name; __EOT ifconfig $_ifs group dhcp >/dev/null 2>&1 dhclient $_ifs set -- $(v4_info $_ifs) if [[ $1 == UP && -n $2 ]]; then mv /etc/dhclient.conf /tmp/dhclient.conf mv /etc/resolv.conf.tail /tmp/resolv.conf.tail return 0 fi ifconfig $_ifs delete down rm /etc/dhclient.conf /etc/resolv.conf.tail return 1 } v4_config() { local _ifs=$1 _media=$2 _name=$3 _hn=$4 _prompt _addr _mask if ifconfig $_ifs | grep 'groups:.* dhcp' >/dev/null 2>&1; then _addr=dhcp else set -- $(v4_info $_ifs) if [[ -n $2 ]]; then _addr=$2; _mask=$3 ifconfig $_ifs inet $_addr delete fi fi [[ -x /sbin/dhclient ]] && _prompt=" or 'dhcp'" _prompt="IPv4 address for $_ifs? (or 'none'$_prompt)" ask_until "$_prompt" "$_addr" case $resp in none) ;; dhcp) if [[ ! -x /sbin/dhclient ]]; then echo "DHCP not possible - no /sbin/dhclient." elif dhcp_request $_ifs "$_name" || dhcp_request $_ifs ; then addhostent "127.0.0.1" "$_name" echo "dhcp NONE NONE NONE $_media" >>$_hn fi ;; *) _addr=$resp ask_until "Netmask?" "${_mask:=255.255.255.0}" ifconfig $_ifs -group dhcp >/dev/null 2>&1 if ifconfig $_ifs inet $_addr netmask $resp up ; then addhostent "$_addr" "$_name" echo "inet $_addr $resp NONE $_media" >$_hn fi ;; esac } v6_config() { local _ifs=$1 _media=$2 _name=$3 _hn=$4 _addr _prefixlen _prompt ifconfig lo0 inet6 >/dev/null 2>&1 || return set -- $(v6_info $_ifs) [[ -n $2 ]] && { _addr=$2; _prefixlen=$3; } [[ -x /sbin/rtsol ]] && _prompt="or 'rtsol' " _prompt="IPv6 address for $_ifs? (${_prompt}or 'none')" ask_until "$_prompt" "${_addr:-none}" case $resp in none) return ;; rtsol) [[ ! -x /sbin/rtsol ]] && { echo "No /sbin/rtsol." ; return ; } ifconfig $_ifs up rtsol -F $_ifs addhostent "::1" "$_name" echo "up\nrtsol $media" >>$_hn return ;; esac _addr=$resp ask_until "IPv6 prefix length for $_ifs?" "${_prefixlen:=64}" ifconfig $_ifs inet6 $_addr prefixlen $resp up || return echo "inet6 $_addr $resp $media" >>$_hn addhostent "$_addr" "$_name" v6_defroute $_ifs [[ $resp == none ]] && return route -n add -inet6 -host default "$resp" || return echo "$resp" >>/tmp/mygate } v4_defroute() { local _dr _prompt=" or 'none'" [[ -x /sbin/dhclient ]] && _prompt=", 'dhcp'$_prompt" _prompt="Default IPv4 route? (IPv4 address$_prompt)" _dr=$(route -n show -inet | sed -ne '/^default */{s///; s/ .*//; p;}') [[ -f /tmp/dhclient.conf ]] && _dr=dhcp while :; do ask_until "$_prompt" "$_dr" [[ $resp == @(none|dhcp) ]] && break route delete -inet default >/dev/null 2>&1 route -n add -inet -host default "$resp" && { echo "$resp" >/tmp/mygate ; break ; } route -n add -inet -host default $_dr >/dev/null 2>&1 done } v6_defroute() { local _if=$1 _routers _oifs if [[ -z $(route -n show -inet6 | sed -ne '/^default */{s///; s/ .*//; p;}') ]]; then resp=none return fi if [[ -x /sbin/ping6 ]]; then _routers=$(ping6 -n -c 2 ff02::2%$_if 2>&1 | sed -n \ -e '/bytes from/{s/^.*from //;s/,.*$//;p;}') fi _oifs=$IFS IFS= PS3="IPv6 default router? (list #, IPv6 address or 'none'): " select i in $_routers; do case $i in "") resp=$REPLY [[ -n $resp ]] && break ;; *) resp=$i break ;; esac done IFS=$_oifs } enable_network() { local _netfile _gw for _netfile in hosts dhclient.conf resolv.conf resolv.conf.tail protocols services; do if [ -f /mnt/etc/${_netfile} ]; then cp /mnt/etc/${_netfile} /etc/${_netfile} fi done ifconfig lo0 inet 127.0.0.1 for hn in /mnt/etc/hostname.*; do if=${hn#/mnt/etc/hostname.} ifconfig $if >/dev/null 2>&1 || continue while :; do if [ "$cmd2" ]; then set -- $cmd2 af=$1 name=$2 mask=$3 bcaddr=$4 ext1=$5 cmd2= i=1; while [ i -lt 6 -a -n "$1" ]; do shift; let i=i+1; done ext2="$@" else read af name mask bcaddr ext1 ext2 || break fi case $af in "#"*|"!"*|"bridge"|"") continue ;; "dhcp") [ "$name" = "NONE" ] && name= [ "$mask" = "NONE" ] && mask= [ "$bcaddr" = "NONE" ] && bcaddr= dhcpif="$dhcpif $if" cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 down" cmd="$cmd; dhclient $if" ;; "rtsol") rtsolif="$rtsolif $if" cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 up" ;; "up") cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 up" ;; *) read dt dtaddr if [ "$name" = "alias" ]; then alias=$name name=$mask mask=$bcaddr bcaddr=$ext1 ext1=$ext2 ext2= else alias= fi cmd="ifconfig $if $af $alias $name " case $dt in dest) cmd="$cmd $dtaddr" ;; [a-z!]*) cmd2="$dt $dtaddr" ;; esac if [ ! -n "$name" ]; then echo "/mnt/etc/hostname.$if: invalid network configuration file" return fi case $af in inet) [ "$mask" ] && cmd="$cmd netmask $mask" if [ "$bcaddr" -a "$bcaddr" != "NONE" ]; then cmd="$cmd broadcast $bcaddr" fi [ "$alias" ] && rtcmd="; route -qn add -host $name 127.0.0.1" ;; inet6) [ "$mask" ] && cmd="$cmd prefixlen $mask" cmd="$cmd $bcaddr" ;; *) cmd="$cmd $mask $bcaddr" esac cmd="$cmd $ext1 $ext2$rtcmd" rtcmd= ;; esac eval "$cmd" done /dev/null 2>&1 route -qn add -host default $_gw && break done [[ -z $rtsolif ]] && stripcom /mnt/etc/mygate | while read _gw; do [[ $_gw == !(*:*) ]] && continue route -qn delete -inet6 default >/dev/null 2>&1 route -qn add -host -inet6 default $_gw && break done route -qn add -host `hostname` 127.0.0.1 >/dev/null route -qn add -net 127 127.0.0.1 -reject >/dev/null echo "Network interface configuration:" ifconfig -am route -n show if [ -f /etc/resolv.conf ]; then echo "\nResolver enabled." else echo "\nResolver not enabled." fi } install_files() { local _src=$1 _files=$2 _f _sets _get_sets for _f in $THESETS; do isin $_f $_files || continue; _sets=$(addel $_f $_sets) isin $_f $DEFAULTSETS "site$VERSION-$(hostname -s).tgz" && \ _get_sets=$(addel $_f $_get_sets) done if [[ -z $_sets ]]; then cat <<__EOT No $OBSD sets were found at $(echo $_src | sed -e 's/\(^ftp:\/\/[^/]*\)\(:[^/]*\)\(@.*\)/\1\3/') Set names are: $THESETS __EOT return fi select_sets "$_sets" "$_get_sets" [[ -n $resp ]] || return _get_sets=$resp ask_yn "Ready to $MODE sets?" yes [[ $resp = n ]] && return for _f in $THESETS ; do isin $_f $_get_sets || continue echo "Getting $_f ..." case $_f in *.tgz) ftp $_ftp_active -o - -V -m "$_src/$_f" | tar zxphf - -C /mnt ;; *) ftp $_ftp_active -o "/mnt/$_f" -V -m "$_src/$_f" ;; esac if [ $? -ne 0 ]; then echo "'$_f' did not install correctly." else DEFAULTSETS=$(rmel $_f $DEFAULTSETS) fi done } encode_for_url() { echo "$1" | sed -e " s/%/%25/g s/ /%20/g s/!/%21/g s/\"/%22/g s/#/%23/g s/\\\$/%24/g s/&/%26/g s/'/%27/g s/(/%28/g s/)/%29/g s/\*/%2a/g s/+/%2b/g s/,/%2c/g s/-/%2d/g s/\./%2e/g s/\//%2f/g s/:/%3a/g s/;/%3b/g s//%3e/g s/?/%3f/g s/@/%40/g s/\[/%5b/g s/\\\\/%5c/g s/]/%5d/g s/\^/%5e/g s/_/%5f/g s/\`/%60/g s/{/%7b/g s/|/%7c/g s/}/%7d/g s/~/%7e/g " } ftp_error() { if [[ -n $(echo "$2" | grep "$1") ]]; then echo $1 return 0 fi return 1 } install_url() { local _url_type=$1 _file_list _url_base _oifs _prompt _passwd ask "HTTP/FTP proxy URL? (e.g. 'http://proxy:8080', or 'none')" \ "${ftp_proxy:-none}" unset ftp_proxy http_proxy [[ $resp == none ]] || export ftp_proxy=$resp http_proxy=$resp rm -f $SERVERLIST ask_yn "Display the list of known $_url_type servers?" if [[ $resp == y ]]; then echo -n "Getting the list from 129.128.5.191 (ftp.openbsd.org)..." ftp $_ftp_active -V -a -o - \ ftp://129.128.5.191/$FTPDIR/ftplist 2>/tmp/ftplisterr \ | sed -ne "/^${_url_type}:\/\//s///p" >$SERVERLIST if [[ -s $SERVERLIST ]]; then echo "done." _prompt="Server? (IP address, hostname, list#, 'done' or '?')" cat -n $SERVERLIST | less -XE else echo "FAILED." cat /tmp/ftplisterr fi fi : ${_prompt:="Server? (IP address, hostname or 'done')"} while :; do eval resp=\$_${_url_type}_server_ip ask_until "$_prompt" "$resp" case $resp in done) return ;; "?") [[ -s $SERVERLIST ]] || continue cat -n $SERVERLIST | less -XE ;; +([0-9])) [[ -s $SERVERLIST ]] || continue set -- $(sed -ne "${resp}p" $SERVERLIST) [[ $# -lt 1 ]] && { echo "There is no line $resp." ; continue ; } echo "Using $*" eval _${_url_type}_server_ip=${1%%/*} eval _${_url_type}_server_dir=${1#*/}/$SETDIR ;; *) eval _${_url_type}_server_ip=$resp break ;; esac done if [[ $_url_type == ftp && -z $ftp_proxy ]]; then case $_ftp_active in -A) resp=no ;; *) resp=yes ;; esac unset _ftp_active ask_yn "Does the server support passive mode ftp?" $resp [[ $resp == n ]] && _ftp_active=-A fi eval resp=\$_${_url_type}_server_dir ask_until "Server directory?" "${resp:-pub/OpenBSD/$SETDIR}" eval _${_url_type}_server_dir=$resp if [[ $_url_type == ftp ]]; then _oifs=$IFS IFS= ask_until "Login?" "${_ftp_server_login:=anonymous}" _ftp_server_login=$resp if [[ $_ftp_server_login == @(anonymous|ftp) ]]; then _passwd=root@`hostname` else resp= while [[ -z $resp ]] ; do askpass "Password? (will not echo)" done _passwd=$resp fi IFS=$_oifs fi _url_base=$_url_type:// if [[ $_url_type == ftp && $_ftp_server_login != anonymous ]]; then _url_base=$_url_base$(encode_for_url "$_ftp_server_login"):$(encode_for_url "$_passwd")@ fi eval _url_base=$_url_base\$_${_url_type}_server_ip/\$_${_url_type}_server_dir ifconfig lo0 127.0.0.1 if [[ $_url_type == ftp && -z $ftp_proxy ]] ; then _file_list=$(ftp_list_files "$_ftp_server_ip" "$_ftp_server_login" "$_passwd" "$_ftp_server_dir") ftp_error "Login failed." "$_file_list" && return ftp_error "No such file or directory." "$_file_list" && return else _file_list=$(ftp -o - -V "$_url_base/index.txt" | sed 's/ //') fi install_files "$_url_base" "$_file_list" } install_mounted_fs() { local _dir while :; do ask_until "Pathname to the sets? (or 'done')" "$SETDIR" [[ $resp == done ]] && return [[ -d /mnt2/$resp ]] && { _dir=/mnt2/$resp ; break ; } [[ -d /mnt/$resp ]] && { _dir=/mnt/$resp ; break ; } [[ -d /$resp ]] && { _dir=/$resp ; break ; } echo "The directory '$resp' does not exist." done install_files "file://$_dir" "$(ls -l $_dir)" } install_cdrom() { local _drive _part=c _fstype get_drive "CD-ROM" "$CDDEVS" || return _drive=$resp set -- $(disklabel $_drive 2>&1 | grep '^ c: ') case $4 in ISO9660) _fstype=cd9660 ;; UDF) _fstype=udf ;; *) get_partition $_drive "cd9660" || return set -- $resp _part=$1 [[ -n $2 ]] && _fstype=$2 ;; esac mount -t $_fstype -o ro /dev/$_drive$_part /mnt2 || return install_mounted_fs } install_disk() { local _drive _dev _fstype _fsopts ask_yn "Is the disk partition already mounted?" if [[ $resp == n ]]; then get_drive "disk" "$DKDEVS" || return _drive=$resp get_partition $_drive "$MDFSTYPE" || return set -- $resp _dev=/dev/$_drive$1 [[ -n $2 ]] && _fstype="-t $2" [[ $_fstype == $MDFSTYPE ]] && _fsopts=$MDFSOPTS if [[ -z $(mount | grep "^$_dev") ]]; then mount $_fstype -o ro,$_fsopts $_dev /mnt2 || return fi fi install_mounted_fs } install_nfs() { local _tcp ask_until "Server IP address or hostname?" "$NFS_ADDR" NFS_ADDR=$resp ask_until "Filesystem on server to mount?" "$NFS_PATH" NFS_PATH=$resp ask_yn "Use TCP transport? (requires TCP-capable NFS server)" [[ $resp == y ]] && _tcp=-T mount_nfs $_tcp -o ro $NFS_ADDR:$NFS_PATH /mnt2 || return install_mounted_fs } install_tape() { local _z _bs get_drive "tape drive" "$MTDEVS" || return export TAPE=/dev/nr$resp if [[ ! -c $TAPE ]]; then echo "$TAPE is not a character special file." return fi echo -n "Rewinding $TAPE (mt rewind)..." mt rewind || return echo "done." while :; do ask_until "Skip how many files? (or 'done')" 0 [[ $resp == done ]] && return [[ $resp == +([0-9]) ]] || continue (($resp < 0)) && continue if (($resp > 0)); then echo -n "Skipping $resp file(s)..." mt fsf $resp || return echo "done." elif [[ -n $_bs ]]; then mt bsf ; mt fsf fi unset _z ask_yn "Is the file gzipped?" yes [[ $resp == y ]] && _z=z [[ $_z == z ]] || _bs=10240 ask_until "Blocksize for this file?" "${_bs:-8k}" [[ $resp == done ]] && return _bs=$resp dd if=$TAPE bs=$_bs | tar ${_z}xvphf - -C /mnt || return done } set_timezone() { local _zoneroot=/mnt/usr/share/zoneinfo/ _zonepath [[ ! -d $_zoneroot ]] && return if [[ -L /mnt/etc/localtime ]]; then TZ=$(ls -l /mnt/etc/localtime 2>/dev/null) TZ=${TZ#*${_zoneroot#/mnt}} fi : ${TZ:=GMT} while :; do _zonepath=$_zoneroot ask "What timezone are you in? ('?' for list)" "$TZ" if [[ $resp == ? ]]; then ls -F ${_zonepath} continue; fi _zonepath=${_zonepath}${resp} while [[ -d $_zonepath ]]; do ask "What sub-timezone of '${_zonepath#$_zoneroot}' are you in? ('?' for list)" case $resp in "") ;; ?) ls -F $_zonepath ;; *) _zonepath=$_zonepath/$resp ;; esac done if [[ -f $_zonepath ]]; then TZ=${_zonepath#$_zoneroot} echo -n "Setting local timezone to '$TZ'..." ln -sf /usr/share/zoneinfo/$TZ /mnt/etc/localtime echo "done." return fi echo -n "'${_zonepath#$_zoneroot}'" echo " is not a valid timezone on this system." done } sane_install() { local _s _m for _s in $SANESETS; do isin $_s $DEFAULTSETS || continue ask_yn "'$_s' was not installed.\nAre you *SURE* your $MODE is complete without '$_s'?" [[ $resp == n ]] && _m="$_m $_s" done [[ -n $_m ]] && return 1 return 0 } install_sets() { local _d=disk _locs="disk ftp http" [[ -n $CDDEVS ]] && { _locs="cd $_locs" ; _d=cd ; } [[ -x /sbin/mount_nfs ]] && _locs="$_locs nfs" [[ -n $MTDEVS && -x /bin/mt ]] && _locs="$_locs tape" echo "\nLet's $MODE the sets!" while :; do umount -f /mnt2 >/dev/null 2>&1 [[ -z $DEFAULTSETS ]] && _d=done ask "Location of sets? ($_locs or 'done')" "$_d" case $resp in done) sane_install && return ;; c*|C*) isin "cd" $_locs && install_cdrom ;; d*|D*) install_disk ;; f*|F*) isin "ftp" $_locs && install_url ftp ;; h*|H*) isin "http" $_locs && install_url http ;; n*|N*) isin "nfs" $_locs && install_nfs ;; t*|T*) isin "tape" $_locs && install_tape ;; esac done } munge_fstab() { local _dev _mp _fstype _opt _rest while read _dev _mp _fstype _opt _rest; do [[ $_dev == \#* || \ $_fstype == nfs || \ ! -f /sbin/mount_$_fstype || \ $_opt == *noauto* || \ $_opt == *xx* ]] && continue _opt=$(echo $_opt | sed -e 's/softdep//') [[ $_fstype == ffs ]] || _opt=$(echo $_opt | sed -e 's/rw/ro/') echo $_dev /mnt${_mp%/} $_fstype $_opt done /etc/fstab if [ ! -s /etc/fstab ]; then echo "Unable to create valid /etc/fstab." exit fi } mount_fs() { local _async=$1 _dev _mp _fstype _opt _rest while read _dev _mp _fstype _opt _rest; do [ "$_mp" = "/mnt" ] || mkdir -p $_mp if ! mount -v -t $_fstype $_async -o $_opt $_dev $_mp ; then cat <<__EOT FATAL ERROR: Cannot mount filesystems. Double-check your configuration and restart the $MODE. __EOT exit fi done /dev/null 2>&1; then echo "FAILED. You must fsck $_dev manually." _fail=y else echo "OK." fi done /tmp/resolv.conf for _ns in $resp; do echo "nameserver $_ns" >>/tmp/resolv.conf done ask_yn "Use the nameserver now?" yes [[ $resp == y ]] && cp /tmp/resolv.conf /tmp/resolv.conf.shadow fi [[ -n $(ifconfig -a | sed -ne '/[ ]inet .* broadcast /p') ]] && v4_defroute edit_tmp_file hosts manual_net_cfg } populateusrlocal() { if [ -f /mnt/etc/mtree/BSD.local.dist ]; then /mnt/usr/sbin/chroot /mnt /usr/sbin/mtree -Uedqn -p /usr/local -f /etc/mtree/BSD.local.dist >/dev/null fi } questions() { local _bd _td ask_yn "Start sshd(8) by default?" yes if [[ $resp == n ]]; then echo "sshd_flags=NO # disabled during install" \ >>/mnt/etc/rc.conf.local fi ask_yn "Start ntpd(8) by default?" if [[ $resp == y ]]; then echo "ntpd_flags= # enabled during install" \ >>/mnt/etc/rc.conf.local fi if [[ -n $MDXAPERTURE ]]; then ask_yn "Do you expect to run the X Window System?" if [[ $resp == y ]]; then sed -e "/^#\(machdep\.allowaperture=${MDXAPERTURE}\)/s//\1 /" \ /mnt/etc/sysctl.conf >/tmp/sysctl.conf cp /tmp/sysctl.conf /mnt/etc/sysctl.conf fi fi [[ -z $SERIALDEV ]] && return set -- $SERIALDEV _bd=$1 _td=$2 ask_yn "Change the default console to $_bd?" [[ $resp == n ]] && return ask_which "speed" "should $_bd use" "9600 19200 38400 57600 115200" [[ $resp == done ]] && return echo "stty $_bd $resp\nset tty $_bd" >>/mnt/etc/boot.conf sed -e "/^${_td}/s/std.9600/std.${resp}/" \ -e "/^${_td}/s/unknown/vt220 /" \ -e "/${_td}/s/off/on secure/" /mnt/etc/ttys >/tmp/ttys } finish_up() { local _dev _mp _fstype _rest if [[ -x /mnt/sbin/swapctl ]]; then /mnt/sbin/swapctl -a /dev/$SWAPDEV >/dev/null 2>&1 while read _dev _mp _fstype _rest; do [[ $_fstype == swap ]] && \ /mnt/sbin/swapctl -a $_dev >/dev/null 2>&1 done /tmp/sysctl.conf cp /tmp/sysctl.conf /mnt/etc/sysctl.conf fi echo -n "Making all device nodes..." cd /mnt/dev sh MAKEDEV all for _dev in $DKDEVS $CDDEVS $MTDEVS; do sh MAKEDEV $_dev done echo "done." cd / md_installboot $ROOTDISK populateusrlocal [ -x /mnt/$MODE.site ] && /mnt/usr/sbin/chroot /mnt /$MODE.site cat <<__EOT CONGRATULATIONS! Your OpenBSD $MODE has been successfully completed! To boot the new system, enter halt at the command prompt. Once the system has halted, reset the machine and boot from the disk. __EOT md_congrats } ROOTDISK= ROOTDEV= VERSION=40 VNAME="$(( $VERSION / 10 )).$(( $VERSION % 10 ))" SETDIR="$VNAME/$ARCH" FTPDIR="pub/OpenBSD/$VNAME" OBSD="OpenBSD/$ARCH $VNAME" SERVERLIST=/tmp/serverlist for _opt in d f l m n p s; do ulimit -$_opt unlimited done dmesg | sed -ne '/^OpenBSD /h;/^OpenBSD /!H;${g;p;}' >/var/run/dmesg.boot DKDEVS=$(scan_dmesg "${MDDKDEVS:-/^[sw]d[0-9][0-9]* /s/ .*//p}") CDDEVS=$(scan_dmesg "${MDCDDEVS:-/^cd[0-9][0-9]* /s/ .*//p}") MTDEVS=$(scan_dmesg "${MDMTDEVS:-/^[cmsw]t[0-9][0-9]* /s/ .*//p}") IFDEVS=$(get_ifdevs) SERIALDEV=$(get_serialdev) THESETS="bsd bsd.rd bsd.mp $MDSETS" DEFAULTSETS="bsd bsd.rd" for _set in base etc misc comp man game xbase xetc xshare xfont xserv site ; do [[ $MODE == upgrade && ( $_set == etc || $_set == xetc ) ]] && continue THESETS="$THESETS ${_set}${VERSION}.tgz" isin $_set xbase xetc xshare xfont xserv site && continue DEFAULTSETS="$DEFAULTSETS ${_set}${VERSION}.tgz" done SANESETS="0123456789abcdef d)@//\// dS+T^+,!0 e+0i+ d,h*H4+pK+E+2+DR+ d$0X000$0 d:/X000$0/// d<|/ d+70 d,D/ d)i+X00$0v+ di+X00$0 d$0X00$00:d dH<)@l/l/@2X Xd$`ddddddddddddd ʚ;5ym8@ E82(@AAA==(A*Td`dddpdlddxd|dddhdddtdXd\dQ dd 4 ;Hvh:Lvh< ;Pvh@ ;TvhD ;XvhH ;\vhL ;`vhP ;dvhT ;hvhX ;lvh\ ;pvh` ;tvhd ;xvhh ;|vhl ;vht ;vh| ;vh ;vh ;vh ;$f0 ;$f 0 ;$fT0\d;40d0@0H0;00000 000u8u8u8 z8{8$v8x{8{8|8|8}8L}8v8 v8v8z84v8Xv8H|8||8}8}8}8~8P~8~8~8~8 8T8888$8X88040`0;808888\88888888 8888L8̏8̎8888(8888d0d080;;;;;;;armishh1h1ʏ$%$%$%$%$%$%$%D/$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%2X2@2X22ܘ2$%$%$%$%$%"" ""x"",%,%,%,%,%$%$%$%$%$%,%,%,%,%,%$%$%$%$%$%$%$%$%$%$%102|2p2<2P2,%,%,%,%,%1<1\1111$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%,%,%,%,%,%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%$%0x#x#y#y#lz#dz#0{#$%l{#8<&L%<&4=&=&L%\>&$%4&'1'1'1'1\+1$%%*1L%L%//$%$%$%$%,%,%,%,%,%,%,%P&$%4&,%,%,%,%,%L%,%,%$%,%`%$`%D`%$%c%$%a%$%b%@D$$%$%$%$%$%$%$%,%,%,%$%$%$%%$%,%,%$%,%,%$%%$%$%$%$%$%$%$%%$%$%$%$%$%$%$%%$%$6!!?!?!@H!@?!P&$%4&,%,%$%$%,%$%$%$%$%$%$%$%$%$%%$%$%$%$%$%$%$%%$%2X2|22X2$%%$%$%$%$%$%$%$%%$%"""""$%%$%,%,%,%,%,%$%%$%$%$%$%$%$%$%%$%,%,%,%,%,%$%%$% W(W(W(Z( \($%`d($% e($%$%$%$%$%$%%$%102202p2$%%$%,%,%,%,%,%$%%$%1<1111$%%$%,%,%$%$%,%$%$%$%,%,%$%$%,%$%$%$%,%,%,%$%,%L%%$%$%$%$%$%$%$%%$%$%$%$%$%$%$%%$%$%$%$%$%$%$%%$%,%,%,%,%,%$%,%$%,%,%,%$%$%,%$%$%$%,%,%,%$%$%,%$%$%$%:#;#L<#(=#>#$% ?#?#r#"""$%@"$%\"$%"$%$%$%$%$%$%%$%$%$%$%$%$%$%%$%L#l#@#D# #$%X#$%#$%$%$%$%$%$%%$%$%$%$%$%$%$%%$%$%$%$%$%$%$%%$%$%$%$%$%$%$%%$%$%$%$%$%$%$%%$%,%,%$%$%,%$%$%$%tV,|V,V,V,V,$%$%$%$%$%$%$%$%$%%$%$%$%$%$%$%$%%$%,%,%,%,%,%$%$%$%$%$%$%$%$%$%%$%$%$%$%$%$%$%%$%$%$%$%$%$%$%%$%,%,%,%,%,%,%,%P&$%4&$%$%$%$%$%$%%$%$%$%$%$%$%$%%$%P###x#Ѕ#$% #$%,%,%,%,%,%$%,%$%$%$%$%$%$%$%%$%,%,%,%,%,%,%,%P&,%,%22X2$%2$% 2$%2t22$%2$%2$%,%,%,%$%,%$%,%$%2(2$%$%`2$%2$%3p3333$%3$%83h44$%X44$%%$%4*4+4+4,4H.4$%04$%333l3333P&$%4&P5tQ5xS5T5LV5$%V5$%V533,333$%d3$%83,%,%,%,%,%$%%$%$%$%$%$%$%$%%$%$%$%$%$%$%$%%$%$%$%$%$%$%$%%$%$%$%$%$%$%$%%$%$%$%$%$%$%$%%$%$%$%$%$%$%$%%$%$%$%$%$%$%$%%$%$%$%$%$%$%$%%$%$%$%$%$%$%$%%$%$%$%$%$%$%$%%$%$%$%$%$%$%$%%$%$%$%$%$%$%$%%$%$%$%$%$%$%$%%$%$%$%$%$%$%$%%$%$%$%$%$%$%$%%$%$%$%$%$%$%$%%$%$%$%$%$%$%$%%$%$%$%$%$%$%$%%$%$%$%$%$%$%$%%$%$%$%$%$%$%$%%$%$%$%$%$%$%$%%$%$%$%$%$%$%$%%$%$%$%$%$%$%$%%$%$%$%$%$%$%$%%$%$%$%$%$%$%$%%$%"("$%$%"$%$%$%,%,%,%,%,%$%$%$%,%,%$%,%,%$%%$%adG\b@(;(;Dv:4,;H,;T,;`,;l,;|,;,;,;,;,;,;,;,;,;-;-;<111 1@z;0X1111Dv:\111hh111|1(;|222 2402\2L~; /HNT:20;2;A2A2L;$F2F2;0W2W2Ђ;g2g2;tl2l2H;8;xeiH;evX;e2!eee0Ԃ2 2,;2<2Ѕ2$222>??  ` ~ ^ "' AAA AA'CEEEEIIIINOOOOOUUUUYaaaa aa'ceeeeiiiinooooouuuuyy"A"E"I"O"U"a"e"i"o"u"yA^A`A*A~ACE^E`EI^I`I~NO^O`O~OU^U`UYa^a`a*a~ace^e`ei^i`i~no^o`o~ou^u`uyx;2222$ee:;;ď;ȏ;̏;22;<`0303$93834a3a3a30=3lu3b3a38b3b3g34f3^3c3i3i3USB audiouaudioЗ;t|3,}3}3}3}3;eeeeee(e0eeXe`eHeee  xeeeeeee e e eH eP e8 ex e eh e e e e e e e e e e8 e@ e( eh ep eX e e e e e e eee e8eheeee( eX e e e  e  e#H e'x e) e+ eĞ:D;T;|;;l33l33l3J$  % 3u Du u <u 8u 2u 0&'u 1&u 0&u     )%uu 0 1 8%u   3 D D%uu < 8 2u 0&'u 1&u 0&u  ;;333J$t9L;ء;@; ;*Ԧ;T74L;:48;4H;l;;# # t;;8;0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-;{{;ذ;8 5 5X 5 5X55\;5l5,5555;'5"5@$5`%5&5(; 15,5.5h/505;<5$85T8595;5;E5A54C5C5DD5 ;I5;;d;TV5J$<;h5j5l5p5q5(q5x5~5}5 5~5X~5p;Ĺ; :5hv1! !vvvvvvv3 P q q2vqqqqCW 2D k"{"{"3" dAdAW 2]\ \ ;  ȹ;ع;;;Q;$;8;L;`;x;;;Ⱥ;;;(5T555;|5555;X55558;5555|;5555;6h6554; 6 655; 6 655(;6655X;$6P655t;6@655;X6655;h6655$;|6655@; 6 655;*6*655;.6.655;<6<655;@6@655 ;C60D655T;\H6H655;@T6lT655;\[6X\6̂;Tw6|w6 WD2?2?6H6H    |   XD31  ,77H    | SB1 B 1 11111NeN3NQ"NQ!NQNQ&3NQ&!NQ&1NQ1NM1NI1Nm1NE1NE^ & b .,f,b,b܂bܚbܑb܎b܍bmb܁ e T C B ꂀ"T"B"TB BBBB    eB" T.7.7/7   | Dx6x6\c<jH$N<-dhI$Xt8t}u2\L2%p$805 ܩ9<`$J%  X"tD*0P%p?H6 L1PU*D`$Ph4eqj6/"<3Xx'^3X eL*p3'($D1<02pJt"]P9d"q|1\~(0Y$T46h1<4 3Ș/P8'D\5hg%#N27|2HB%I"V.<g`!w&(1* <d4u8l,3TL6tq(  t$@*"/ 4dBL&L8(U9_.oD'~#H e8f/<$L<# 5A.HS' ^g< %d'l%8*D>:(lM#Y#8g`*  `fgde̾"( XLV5@.,2@'!@@%_9)xPg4"\J9<TD#`<yا0p<@0<gh&t,0D&<.D8p?3$P81#"dJ \2->J)E],Q#0]*giep%)8T%f1h% z8z%&+%t"-l%D5D%8%6%<%3%<$%3L&"&t5t!&Ȣ* +&lg(4&E3$H&1<T&̬<c&Ԛ4t&i%~&W(h&8r%& J& &9&$&p"& "&-1X&^44&p$|&\/' cg '\<'4")'|V,5'*g$E'l{#P'B88b'<p'y8'tO- 'x)3P'k1d'O('n1t'x,'d3L'bg (h'(&(d!(#`,(H%`5(xR!?(20L(0T(@-d(1#o(({(D4()P<L)p#PY)N74a)9)xs)3()Y/l)W*)s#h).) +)"4)d4*|& *e*<*'64,*44;*0<K*`#[*Щ!k*O P}*a8*0('*4*4&&*<*!*xh*4*]) +x'L+ 5` +1++Qh>+8),M+$dW+ h+<5`v+ o!H+5+02L+8<+'(+y3t+C&+$+ $+`!# ,.,,k9#,@$,4,2B,ThX, .c,D<w,>4 ,1p,,,(#5d,2,̎8,#,;#l,3-$$8-ܗ.l-"L)-!6-(TD-Ԡ58Z-C2i-O(x-PWg-`1-:4`-d-pw$\-x*p-465-Ȣ8 -(5\-'\-L2 .p21 .<+.f(\8."#K.Ȱ"Z.X4$g.:.v.28.wh .1H.h<./ .\<.u8...$L.  /@D$/w$@ /"+/|31$`02d:2(XgD2l,@ S245P`2h@)o2<2l$26H2 2U342(02t42|3H 3E'3`&!<3 !3<<3(p L3teX3Y7(r38",3D 3b/3 R'3XM5T3\<3d23,#,3Z"3,%405<43!4d/4Lz-<4d<G4(2[4\dd4X!s4<$\z4`54c34P8&L4 1`4PH84446`4$24|e4<5d9 5+5cg5!'25<"L54x]52de5T8x5$5#50L25.X5@75w" 58<5e54h5d}-5" 6 6@6*64"`9683F6'8S6J$^6+ o6)06X.6H96"3H6<"6c/6<"6)\6046H|8 7'7T<*75`;7HB)F7TdN7H" `7|8s737+47H8L7% 7,%7J5\7\9 7&7<57"x7<<8#P8x"0,8|598X<@8-Q8<j8-#,8܈488<48$e8T<8e-88 848X_- 8`'89<92`9*$98$-9u)89% C9Ю'LL9<$!|U9,hb9*Po9D'w9/7`9`49[590D9<@5T9 994l9؞&$9#\9~h:kg :2:fg&:[<(0:l"p::<D:+8L:$X:/#<i: h}:(1\:3:|%):':#0:<:9/h:H&:\.$;(.;"&; #2;Px& <;H E;m%N;<X;)* k;$_gr;4\;t"0;3\;X0P;(;,!;d;5&;P2(;');'X<4H$P<<<p#$(<>4H7<l<G<\g Q<A%|^<D70p<(1(<i& <2$<2<*p<p(<W58<|2<`D&<'<7<<8 =-@=,!0)=|'3='x==9 I=l@:Q= \= 1m=`, w=`G$t=!H=#5=j4=2p=.=9/h=4*p=M!|>4 e>L}8#>ag->Sg(>>\8Y>I!a> r>,7>4>'<>8A%h>1>1&><>&> 9T>Ly- ?~!?0<!?(@:A&? #4?e=?"M?ح<R?W1(^?4"r? ez?py.X?xx8?7?p/7?h?4`2?g?;$?#L?9 ?Hh @<4@ȯ<@p2(@m<>@ 9%P@d_@*Hz@d@.,@,%@,'@He@$<@d@t>1@l! @9 @P!e AP+XA+%A(2A@$?AL3 NA|v5`Al4oAq.A87A 2LAtV,AQ!Ah<A!#$At!tA3AP2A\' B@4 B Q$$Bp<$3B"5x@B1+JB<RBHK"H`BelBd9xxB#4Bx1\BR(HB<B)%xB̗4BH<B7 B2LBCHe KCA&|VC$P!aCdjCL .zC9 ChCm-CJ!<CfCv'CP7C\5C%C!C$\DL4xD8"DW21D+'@D'"4ZDX2bD-sDh2@~DT;8hDy6PDe D8D7 D4D(8D3% E(p%E]5%E ,1E4;E0ME$XEZ8lE eE|Z8HE05`E~4E@: E#pE_#EhE{7E|5DFP3Fu5,FL'8AFX!$HFQhQF e+ ]F!%gF(Y*4sF>'hF4`FA4XFؘ,|F`)hF$F\"PF'(PF0 'XFXWgGLe Gl9*G8G9 +G.8G$DG%MG $aG\4prGЦ!\G7G6G4#G)TG<G,Z"G93tG܄9H3lH"$HXXg+H%6$8H3DH(&LH8#0YHد<_Hf@lHk"H41HT2xH"Hԃ6$H|S%HfHpuhH<$H(xI<I|Pg"I3&'Il(&2I#=IfJIL5[Ip 8 mI2|Id+1IRgI&I8q-DI$&xIhS'I@"Iİ"I<$lI"JL:&tJ/#,&J04J<<+pDJ$93PJL#fJT.8vJ0<J<J`l!HJd-lJA2JH6#J<4J"J8J $ K$\KXi4'Kp3 =K4lHKH1`OKlH%D^K!'iKL<rKX*}K0"HK2pK'K`W#KdD dKeK<K"LKTH*LІ%!Ld($8,Lwh7L3ALp2`ILfQLq$`WL?:%cLlC4mLd4|L6PLh40L<-L"0LPgLx"L70L*gLL&- Lpu6Md3M\-`M<'M4;M/$OM<eMP&lM4'rMa%lzM@$M#XML3pM1PM"xM pM$hM< N$`% NPx8&Nd+N0xBN+(PNtj"<ZN4fNXm-0sNl"N44N~hNd1N(<N(HN@fNh/5N9lO,]5OX-P'O6:O&PHOH5RO/( lQH8yQ8Q$hQT#Q]8Q6`Qľ"Qg,Q$QgR0RT<Rn10R6)=R#xPR2^RuhkR,TsRF$\RO%R$R R>+R4hRq2lR5R4<SeS\) Se)Sd9S)MS%$RSk4xcS"HqSuh8zS#PS(5hS0{#<SdS' S(8SA6ŚhS\+%PS8S4 TTe"T!'T7H7T$)NTT2P^TegeTo" qTfTeT,4lT0Tn&T8V$tTl1XT<<TfTx%$U,.8XUD7-U%H7UT"MU3lVU4-\oUH0{U#UJ0UP$(U #lU5XU+U8),U#"4VwhV؁#"V#t6V4"GV"50RVi&]V,a"4hV`A38wV3(V@z8V}4VD$V02,VH*V%V#TV"VpL6W5W%`W ,l*W@H!@2W؄5FWHb4WW*bW-\pW!WPA0W<Wp8W2W<WHJ"Wl%W.4Wo9(XL# XtZgX\>+,0Xh6,;X<IXD)TXfcX(rXX) \XRhX'X%Xl<X6'X47XeXxk0(XH5:0Y89HY '4$Y"/Y`(?Y 4tQYt.\YČ8lYĎ$(sY.Yܧ6Y\*Y\!tY[$`Yl<" Yh5Y|8Y< YV$LZ44dZQ3&Z@#<:Zp"8LZ6xWZ$"hfZ,4XpZ`9{Z'ZfxZ0ZX&Z%Z`,|Z 'Z6 Z<Z'@Z9$[k* [Q.@#[|e,[4'3[<@[l<T[d_/$a[, gh[h<$x[ȭ<[4f3[5 [ 2P[t2[xh[38[$([Ь<\!"<\2,\d>\<V\'^\D"Ls\8{\$L\f\8*\x3\2p\<$\$*@\$!#<\$2-X\#]='],N6| ]0Z"h,]d86]1?] dN]H Pj]0C+<y]@W5X]3]*]8e]w6]~h]8-$]|" ]"  ^h!p^$H%^$7^1A^,"4[^tuht^g), ^d,*H^l<$^4$^<^8.#^h<^.8_<_e*X&_$*(84_\gD_hdU_|.`_6Hu_e_,`2_ȏ& _%\_#*_H._$_8d_'_De _]1`̼(L$`e2@;`Y7R`d2tj`.y`ԅ&t`4%D`0e`D8h`%`$,`8#\`И<`cga88|a %a):axuhCati4$NahZaP0gaa8~a}6Xan&0a.#$aF8tai3at7(aX7Da, b\gbb%l b`.3b"Gb`%dOb#Xdbġ.ubdbT2bX!,bt, bL$b`$b#b 2bt(`bcp;&CcT$gPc<<gc&sc.c2Xc(Pc8;4xcRgc8c 5Tcԙ8cV48cL8' d("dts2P*dwh2dW1Bd(a)PLd'xVd!eddp0#<d(d|4&d#d(1d'Ddl<d*dx} <dQhd d eL)le8a5\,e#x?eE+ Ke![effeeoe\exeh3el#e1&`eH8he5e4)8eU1eP<edf@.lf*gf"2f@<HfDt#[fDV.gf8b3Pzf1fd%f+4hf7*f$f$ef6Hfd<f668f&tg<gH+-gD =g},Jg,5hTgcgggwhxgeg3\gK)|gL.Dgj8LgF8g #<gdeg82hTd h #h&!hf-hd%7h9r@h gLhg3dbh 'lhQgxh83hdq/h'<h"h<@h3hL$th%(hԇ%|i whi-& "it4p,id;iDM.$Gi\5HYi$bih%ri<|ifiL_1i8iN7pip)ix$i#i7$il!\ j.8lj@"7X8j 4Lj7dhj <oj68{jo+j %pjX#XjD<jd'@jhi6hj4x54jЌ1jF6k|-k\*/#kP$ 2kP,Bk>%8PkP6]k(nkHh{khk~h k])kl<k dkx*k<k 4$k7kT70l <$lH6l%`/l9|>l- KlHfTll'5`l4pll<lL elhlv8l\`9l0$Dltepl(90l< %(l<m0P.m)82m{4=m06hNm 96$em`*PxmPZ'm750mPJ5Tm dmdm<mH+5ma/dm1'ml&lm5m5n55n #(n"4nt |AnF1|Mnh(XYnF3pn/n-n(n@"hn,% xnegnTb( n(Sgn8.nx"$n,Xgo-@o\U1o+1o"Ao3pMo< ^o60qow8o$1o`go#Ho"\o(h4oD}*oZ#\oK4po<p6p@<$ p1'p"D5p09p,N+|Hp<\p.jpd"hwp d5p .hp<pL1pehpR0Ppl,p\gp+gp<p)* qļ6qc6\*q,48xBq 4Mq\`2Yq-`eqPhXlqhzqD<$q"q9-\q'4q0$Tq6 q 58qT, ql%qc%q< r<r<*r)<?r~1KrT% YrQgerL5\rre zr-Xr<r& r$6r,<ri&@rt7r'DrXQhrG0suhsd<sp9 (s3D;s,gCs-SsH!]s1lsT1ps $spds"8s`< s%1sS.sp|7ts<t8t|1t4$"tD<-t<Fto&\Qt g\t0x#ct6ytT1|tp5htU5t<2t0#8t$<t5t<u4< u!u#" 8u<@u^gJuP+/<Wuq78ru`e{u upl3\uL<u"4u4u$whu`f(u#u$+uX5v8[gv`'Hv8"p6v<$Gvğ Zv8-gv '|tv(x8v<vK tv44v*vB3v3xvldvxhv$w2@!w4\0wp3(L"LLX9H^1n\/{')Ld<$H"$</,8 p|, 30e2e$cg l8 3.xh@ `9Ix(V3k<'s.C&@-#$43 eĀ9րP-DP'@+204 gl4(t#X&.#$=Ty!TX"f n*'xs8"@}d3)\L`22'0< 7с';0xܖ$v8 G%0<,@q"><O!^ee0|t 08H98P4"300Â-т4-08_7d 3 \%';%EeN*6[3 d,%rdg`03@dE,,*+<%8.PʃP-%Ճ&1T.'tT$` D83h'|''.̛!? "4IP\2tV@3*e( sX#h~$L"d8$|5@H$(„'˄fل̋ P6,0[((#D*07t3lGl<Sp.\<cL2$uX*<P[1&0!ti3˅(Ӆ$@~8c!.5,a1P!}84,D<]ȩ.h,wh~<$|<0 &3 0'ˆl&҆%|ކ9 Pe &>. |#xr'83T)Rg2N%8?\9J<Z /KDe#Xx8:xtT-lC6X@X,,#@,#5,pN.lj<ω1T։N+U44r2",D de"$8+8A 3M`'DZMhjG,w9de)l%t24@P*8ˊ48ۊ`e"4l#JgQ(]4e7w3H< v%t9<94ɝl(ԝ.'L۝h"1HR18deFT8Q<eL(<k6}|9 ! "T6,43D5\˞X'<֞4])`2h:(86<4hح!x+ e'h4t9 A8'4\L d4X5mH1$l!.tl2Ÿh%֟#; 7xM4`Xx%4\fl1q-T<g02L,2d<̧,gӧĀ8ڧD8B!2 8P5 4<l#"b3<98"0PD"LbH)k~8~xNh"-84,(g<1`ȨThҨ8بH&99 & P<Č%<,g<,H&5P<?d|58N,3W$,da,6N`d` ,mx'#dxed %dX*p _4p05hxe°)Lװuh( L4 6+P(TH$#x,@/pn$p5 I"tAt''H(Z<b|J2ph#p{"#t4h4u/1<ȱ<<ױ%gޱ+Hh<$T54<$/1@7d<HЯ<N6%\\8 k)3vP.45h9xD,ò8ѲO4߲ !e8f й9 d9 !\3.86\H6,B|<V 6@d^5z@(gdd4&3dʳ5)ֳs%,L::'pD.<&a7T.`/<.lH8"8V .aP<r%~v+\ 8('X$D)tδ| Pݴ%(,5534HhD[g&X'80E=&OPl!`Lhnx'x<#q"4lp"@#p48<&xʵ)gK$7\$F2i$r4%`~d04h/$h>4H|2q#| 041|0h,_9-T&5_9R|5,]|%*l8dt#0l)h2,< 50,)3L-PY$<$"l'`(07p<EC5Op{/YQ!c6v|8D~C8,_gx,L>'p&LX8P4fg+d<p&,E.X%0%-"7 )Ḻ<4W<o|_.l1 Hh,,5(=#5h8!XY2fwh() z2(23$<?P%xG6:\_%\hX!er 5H3xcgx<"4<e<22!LK7<48`<&01p6$A&A̒<H [3[8q2X('TH$ltR42! lz)\A'dȺ69@<+ $0' 'yh8H4+lF"$Y3lfo-tر0l .T$ `3 ,* <@ g<'|6P2 5L<*(]g6 7H8'U&(dT!ui&7p 32( <8LX,<x<02@dD%d/#,44',?d38dat{4pi`2t#'TN4-0$ lJ'HX<3\m(,g$X`g8 <#Ȕ80)hD9L8RK.c 3TqX=/~@*'$h'i< 8(Q/wh "|60wha.L <&)#76<K̮<Y 5cp54p4%`{ \(4:%dM"t468,6 `2DJ%T $3, L2&+e7T<HL!"4] 3`o|+\~T'@D!4\$L%f<N T08$'h@&4! !P.5"l30WhCLfxKcgT<[/g .@{5',8;7\'@9  <O-5L.@"4 XR(X0g (p(4Th@P#dO.&W`-&T`"t5<&,/У1B-x+);'&5I.,fQg0<$|*/@H'<*hS($[؎#(l,<ud5d W(4c6|x,<$XPgf8M5Te,%8t8%HY61 5<|4FO(S% [9`oo({l, _g&, -`w8&Ĥ$p< |2@(cg\$'x<3e=T'+Fyh]Qgs9 l37< <6\`<`>!<pj3< 6'P$'070Hu8T- `L2s yhV,6tT4>,& 8P$lPy'x44,I*H%$4{8'<8+04Fč"PVI4lax1o`4g2@(+pl1(|<"A2TN" $6!P62T)06-83\2p>t2pKԭ<U4cD4n`2w1\\X$l$/L*th'-xa)`4<R!$ ȅ,  "L^,&w86|`4@0$Q8/D`$<0u3P:#H4 ,<ܤ4h58(l|88 2Ѕ2,5"((1L#>l<M\F!V<$j"8uD< #4 < hI < T`2&`d0@0'07<5\ ^%<()D=@,M$HTfa$<8uԴ5\X2Dwh@'\5P00t$,,%0r1T,]g \g& X1)}12{30A:#KĤ \\$)*tiDXgq2\x>.@|+!},(r?:d&Ь9#e6(P5e (h8#pR,L0<5L>@G"TScgaD<$qH'DzDa/`lO-,D,cg$2828$40 e D3\!<-8 2!L@&(G&U(<d04mX.h}"*Xl3d/H, P+8$5HO4$e< .7\,<.d<"(D8!U1b'1j]gw#<-"+` e<,, 9tl2L80< +$Ȯ<48$$BhW@V(cdm/(}\4l,*7< 8-,50xI61&z(dD%<$dU,c*ė&@N&@*Lh8 /E<T'aD%Pn+|p#X !"@*48% @ yh<(g(d74%83 245BdT<\#mf|p"\ (t3H( # |4$L,L<!\;6d*l'(5'HBteL<$T,<b$9j85wL%~P!-/2tH!<%h؆2dP#4 9 I5DW2$`|,K"\*l"&$80N8@2\ i/| @)  h4L d  e6X t9 e Z% . 3 eA 4r2tU %a O'tl 3T 1  "  c3I d+HF(s7OH2ePghIhx1`wh,^94ܒ$D!`)T0e/LXq.@dd$+`f%?B(M@$e!"s)  3hfd 1M0<R!d3p<$D5l"`5 `!T(801(9<=@)LH4#XT`1$a$5qwhM#؊#H}8,,gę"PH57X\6P 3`L* X'$!p*8d3x"0B(8Mh4``58sy4,' XI"7$_7@<$-hl/xq8`34!/@(e60tH`!P\<u10|R''@]g #X$- \*(y<(-8'q"@ '<T2 (H)L:Ġ)J$LY<e"$p- ~jg5"(2T&8#4`ee  d@A$\<$.?!7D4TG,](|m$'$4|t5Dd 78\5-5.DD'750$4"0%(x%1<D1 Q`N1^̉0\k2Xz$-5lāhX# e"@(| gx#>:xS5l <k/88<"4,'*;`4E5O|H4ZR,h)l|%p:7-4Do1\2\@c4X<(4e #4 "$ @)#( 1&2 ,hB eS |U,a yhu Pg} 1 43  ! |#4 ` 0 &t P7 -8 7P < 6!$o3<!!L<12!^)F!2$T!H3h^!H2s! |!5!74D!x)<!pe!8\! f1!(,!$E+L!,f"2"e+"((+"_949"t-,I"\'<S"0f^"(4q"z%"&"L3"\'X"`1"-""4","H#\'`#"%#L. /#<6;#'DI#!$[#7$d#T gj#48r# $#7#d*(#"#- #4%$#<'#t"t#i0d#/l#5T$4$83,0$x!<$ tZ$.m$N5}$<$o6$,m-$u8$pK+$!$$X g$ 5$+$%%\<$%|(!%f74%"X?%=1|K%z.[%0Pk%O-v%pg%#%8%'L%$#D%D\8h%Tw4%D/ %D)"%L< &)@!&L3+D,&'&`5&.C& LhU&f[&6@+X3TJ+O)R+4lZ+) y+` g+) +/T +e+{5T+~1+v8+T<+P'+P<+6*,p(H,2l*,<H,<O,V&TX,t9`,X7,x3,t<,D<,;.P,%,"0,de6,$|3P-<(-%)-36-й$=- F-v+T-1Pb-00ps-9 -)-9#-p)-4$-%$-(S14-"6-#).v8.<@).&2.(6\D.'<X.0t`.4j.`ez.`k&\.$.#L.'.T74t.P9.4C5X.x#.f. 2D.<.<.'` /4 /P5'/cg./0,g5/P%>/Q# J/p5^/2<o/<.p/H</-(/</|0&/)/t9/p8*D/Lh/)/H)P0.0|P(%04<=0T "L0ę#`_0H.48i0``!8~0890L<0<0X$0<0d.T0*$0870X;'\1$\1t$!14(<31<8C1hW1. e1<w1.#@1@%1@2<1 `21K%l1l31d1X<1<1#%2|d 2T/24"4 2_g)22626N2,5_2a2Xn24w2242 5D2<)24ag2&2\d2- 2d g2d22<2 5L 30[4H3r#'3<.3C%`<3di.(F3<"Z30c3s5p3:4<{313^g3h g3e38<K8 X8`17l8 6,x8$\58I2,8<828( 8458O08"08$Hh8d( 99& 9"9x 8*91@49<>9DeG9M5\V9C8 h94$r9x<9<9x99Te79x89H'<9m'9&9\q"8: :~(|":) ;:0<I:E%Q:@ Z:d`:"|:<:L':Q7:d"L:j1L:<:#P:B%(;5;q4;&`";<,;307;H4PC; yhM;(,,];T+ g;dt;ȁh;Lh;@#)L; g2x;F2$;f-;\$;8C$;g; ;h&$>#$&>ج*2>2F>]' Q>h+H[>l:3i>,vhx>O1T> %>#8>%>dD%>t3`>ȏ,> 6<> 1>`r8>8ag?h!?L(D ?ag0?5h(;?.K?2<X?@"d?'20t?h;.?D\$<?R.?`9#p?w%@?C5$?4h?x6?h<?&L?l3 @x#X@xd'@x#1@$#$D@egP@%Y@>&Dd@6Lz@$D'@p g@P6P@uh @p2\@2<@L 3@l&@Ķ.A"hAV3(A"1A1@AA4'tJAl8PADO8L`AA50iA(%A(V$A\'A(g`A)XA U#AO! A\gA$%A2Ax,AH94A*Bx#@$B(d/d;BE2LBdN2`BLggsBcgzB&B5B~h B bgB&B؀9Bح'<B$yhB9h B1(BP6:0BeCHeC \!C%\*CT3 4C~h=C$HC#h`C+XkCl5Chz4Ct5"\C gC\,Ct2PC_gC\>&XC5Ch.C^gCu#DD{8!D\*.D< 3Dp~1<F.TLF"aFt8PoFhwF"Fd FD7F},F0xFL!FI2F8Gjg GlN%8G~(L-G@5:Gz*<IG^gSG*qG" GR.GdgG*G!GN6lG3DG?8Gp&H$DH7) Ḫ6 *HN%@;H(0FHX3`WHH iH4U5yHȹ5H |HP+H%#H!`HD2Ht0LH'H<eIx5P&I@`#2IX$)!@J4*4J.JL"J3JL{-JT_,LJԚ+LYeY1Y,1+Y.+8Yn'EY#,UY(&\eYw!@vYC8Yz3lYL2Y1#HY,=8Y"Y`"Y<Z#` Zd1PZZ(0"Z\<-Z$\;Z\7MZ0\Z(C4DqZV,}ZdZ!8Z<ZD&Z,Z3HZD5Z9Z&0Z6Z<<ZTe[%$[ X9[_q1I_#U_=4h_!t_9 _ 2_|2-_c%_D9 _B50_x8_D 1 _\8$_!_ 0< ``<#`<<+`ܼ'9`̈#D`X4Q`p%``42n`2y`x8`D l`̭<`t&`!`,5`| 3h`@wh`*`8,gaDq1a-D1a$Ca PaS+Ya8iat'sa G7}a84aD8`a(aL&aԔ&a@v$a<$a@2da0yhaC lb1bШ(bueOu<[uH&euȺ<$vu#u^*u%!u!u\*u"4uA-u/hu}(8u88dv'Lv G' v< )vdE 6v*dFvx8Mv\3LWv،&8fvо',uv<$v#v)lv$8vď0(vT<v| 1v)p wT'(Tw}8,w(h;w47 @Lw)4_wdqwA3Tw8$Lw<$wH5w 2Hw܆hw,6hw2%8wP}#wDl3, x`i,\xXg+x>:;x-'&3X$h9'D?&8Q5]$b7r~2|<2T[5@ 83)ڀD/ \%p"<:81!̕<8$D0 5R5l^h3ti<w2P5lБ&H03-LĤ!xȁ\4؁3x8@&eX4&,46h<8 $CXdKH8g00|$e;: eg"pe6<6ɂ e҂`2݂8<spec_vnodeop_opv_descwi_set_nwkeyucom_unlockpfslowtimonanouptimeuvm_map_callrandomreadehci_device_ctrl_closeem_set_mac_typeaxe_tickuvm_page_lookup_freelisteephy_mii_phy_autolongjmpwi_usb_rx_list_initffs_vnodeop_opv_descvfs_opv_descskdb_trapvfs_allocate_syncvnodeuhci_pci_attacharpresolvechrtoblktblsys_minheritputcharural_update_promiscbufq_default_allocchild_returnuaudio_add_outputrtlabel_unrefuvm_map_inituvscom_attachipsec_soft_first_usenkmempagesuhci_device_isoc_donewdc_atapi_drive_selectedcopyinstraue_miibus_readregsys_getgidext2fs_vnodeopv_descsdofilewritevwi_inquire_usbuftdi_matchdumpmagttyflushsys_setsockoptvop_lookup_vp_offsetscomdefaultrateieee80211_watchdogwihap_sta_disassocdefrouter_lookupinetswohci_powerpowerhook_establishwi_get_fid_usbwdog_periodcdce_rxeofip_reassrt_maskedcopyin6addr_anyVOP_ACCESSusbd_get_quirksip6_get_prevhdrscheduler_startdb_logpciide_triones_productsdisk_finduvm_maxkaddrehci_pci_cansphy_cdral_pci_detachicsphy_resetrlphyattachipmforwardingmainbusprintohci_waitintrumsm_attachsys_closeusbd_do_request_flagsrt2560_set_rxantennartflushclone1in6_purgemkludgeffs_inode_allocdes_encrypt2sys_setsidieee80211_encapusbd_intr_transferaudio_attach_miem_init_rx_addrs__ashldi3vn_statvop_getattr_descunp_detachsiop_scriptnd6_nud_hintether_ip6multicast_minumodem_breakusbd_submatchchange_sign16_swap_bytes_be_mts__mainwdc_ioctl_getaue_stopufs_quota_deletehardclockenc_xform_aes_ctrrt2560_wakeup_expirewi_read_data_iomyip_ifpwdc_reset_channelrt2661_get_rssiumodem_set_comm_featurein6_domifdetachvtagssiop_pci_attachfilt_audioreadwskbd_cndetachdb_get_variablecd9660_vgethotplug_get_eventpcaled_caieee80211_inputcrypto_dispatchgeneric_armv4_bs_wm_2if_group_routechangefiq_claimohci_device_intr_closeurl_csr_read_2dest6_inputgsignalacphy_caehci_pci_matchipport_firstautoehci_strmii_mediachgwi_txeofaue_devsipsendredirectsbpf_setifem_encapunp_internalizetk_rawcc__wdstartevcount_intrfc_lfcemptyvfs_export_lookupif_cloners_countifnetyieldohci_endpdm_freemuhid_seltrue_filtopsfilt_seltruesc_print_addrlogcomspeedusbkqfiltervn_writechkin_ifscrubral_pci_caarmv4_tlb_flushIpdevnames_sizemichael_updatealaw_to_slinear16_be_mtsscsi_mode_select_bigmainbus_bs_wm_2route_dstinit_execwskbd_cdsys_getdirentriesbcmpgeneric_bs_r_1ieee80211_node_detachdb_set_breakpointsuaudio_set_paramsnd6_dad_startuaudio_add_extensionexec_maxhdrszuhci_device_ctrl_doneblf_zerokeydb_force_whitespaceieee80211_ifattachmmmmapieee80211_clean_nodessensor_getuvm_map_spacefitssetjmpprefetch_abort_handler_addresswdc_disable_intraes_ctr_reinitricohrtc_clock_readrt2560_get_rfpdc203xx_dma_finishpci_subclass_communicationsurlphy_funcsuvm_deviceopslogread_filtopsre_ifmedia_stsvndxfer_poolfilt_fifowriteem_set_multiffs_specop_ptcp6_mtudisc_callbackcopyoutstrext2fs_fifoop_opv_descatu_capte_l2_s_prot_uuvm_swapinieee80211_countrycode2regdomainradio_attach_miusb_transfer_completelxtphy_serviceswcr_newsessiontcp_attachwskbd_cngetcvop_print_vp_offsetsbuf_dirtysoo_writesensors_countem_phy_powerdown_workaroundsystempagem_zeropdc20262_dma_startural_alloc_tx_listffs_specop_entriesunp_gcingbdevswumodem_matchbaddynamicportsohci_root_ctrl_closeau_set_lr_valueX_db_line_at_pcural_ack_rateuvm_mk_pclusterbswap16domainnameehci_endpdlockinitwsmouse_detachttywrite_filtopswi_usb_devsnd6_ns_outputbpfkqfilterVOP_LEASEre_ifmedia_updwi_headttyunblockbiocloseremovedeudav_miibus_statchgigmp_timers_are_runninguvm_deallocatefilt_procattachufs_quota_free_inode2filt_procdetach__divdi3pciaddr_resource_reserve_disabledi80321_io_bs_allocsys_clock_settimesiop_led_offural_txeofwdc_floating_busuvisor_calocnamesdisk_busydb_breakpoint_alloctcp_pulloutofbandevcount_sysctlsqphy_statussddetacharprequestsiginituipaq_cdpci_mapreg_mapuhci_device_isoc_abortuaudio_activatevn_default_erroruaudio_query_devinfousb_task_thread_procip_sysctluhidev_closemsdosfs_vptofhscsi_mode_sense_bigffs_fifoop_opv_descusbd_clear_endpoint_stalldb_vnode_print_cmdums_cabio_registersetdisklabeldeflateknote_removesii3112_drv_probepmap_bootstrap_pv_page_allocroutedomainhid_locateicmp6_errorVOP_MKDIRusscanner_scsipi_minphysip_protoxsys_settimeofdayi80321_sdram_boundssdstrategyaddlogehci_sync_hcuvm_page_physgetrt2560_bbp_readmsdosfs_syncscsi_mode_senseip_savecontrolstackgap_randomulpt_detachfiq_setregsffs_clrblockusbd_set_hub_featurepdc202xx_chip_mapbpf_filterchgproccntip_draindb_map_print_cmdumass_init_shuttlesoqremque__adddi3pci_classuvm_map_inheritfifo_printinfocd9660_syncem_display_debug_statsin6_ifawithscopevop_inactive_descaudioreadumodem_set_line_stateuvm_schedulersync_printnchashvnopspool_cache_initsys_lchownieee80211_rssadapt_inputmsdosfs_removecd9660_readdb_read_tokenieee80211_regdomain_compare_rnwi_get_idzeroin_addrbmtphy_cdehci_device_bulk_closewdc_set_driveuscannerioctluvm_map_protectusbd_get_xfer_statusre_encapprintfin6addr_nodelocal_allnodessched_lockehci_alloc_sqtd_chaincdce_devsrandomwriteuhci_device_intr_methodsprelist_updatehmac_ipad_buffercrypto_drivers_numip6_protoxsys_recvfromswcr_freesessionttrstrtsys_sbrkrandomuaudio_mixer_add_ctlsysctl_doprockcopyaudioattachsiop_modechangeext2fs_initrtfreecuio_getptrcd9660_linkhostnamelenupl_cdcd9660_specop_entriesusb_needs_reattachm_tag_freexscale_cache_purgeID_rngttyopenuplcom_rtsraw_ctlinputwi_usb_ctl_unlocknd6_ioctlphyslockaxe_miibus_statchgpte_l1_s_protousbd_get_stringipsec_exp_allocationsbpfcloseusbd_probe_and_attachsys_writevsys_setpriorityumodem_set_line_codingm_tag_prependE_abs_script_sched_slot0_Usedaxe_cmdurl_unlock_miiumass_detachusbd_free_iface_dataip_defttlwi_usb_attachurl_rx_list_initusb_schedsoftintrarpintralaw_to_mulawkqueue_registerpciaddr_resource_managecred0in_delmultipmap_procwruvm_forkvfs_op_descsuhci_device_intr_abortuid_findumass_activatend6_rtrequestuplcom_cduvm_km_suballocusb_delay_msucomparamif_getgroupattribsbpfdetachsys_closefromfifo_ioctlumodem_closeehci_devdttydefcharssigexithidirtypagesrt2560_reset_tx_ringin6mask128dead_lookupbus_space_read_raw_multi_4atapiscsi_cauvm_amap_poolin_pcballocVOP_LOOKUPbrgphy_loopdb_shift_exprphysical_startbs_notimpl_bs_c_8pcred_poolenqueue_randomnessexphyattachusbd_set_idleserverworks_pci_intrieee80211_find_node_for_beaconemul_nativeaxe_txeofwskbd_inputdes3_zerokeyre_miibus_statchgobio_matchacphy_cdcrypto_getfeatvop_rename_vp_offsetssys_ovadviselockmgr_printinfousbd_pipe2device_handlecpu_do_powersavemainbus_bs_freeaue_rx_list_initi80321_bs_vaddrbufq_default_freeufs_quota_alloc_inode2ieee80211_name2countrycodemicrouptimesocket_poolpgrphashsys_setpgidprofhzcache_enterdb_watch_tablei80321intc_attachedexec_elf32_makecmdsradio_cdradio_caext2fs_bufatoffsys_setlogininitarmmainbus_bs_r_1db_trapem_id_led_inituaudio_halt_out_dmathecustcp_do_rfc3390ieee80211_req2nodesys_setresuidsvwsata_dmactl_readsimple_lock_debuggerauth_hash_hmac_sha2_384_96crypto_kinvokern_deletesd_get_parmsiskmemdevstat_rush_requestswi_watchdogatu_start_scanipsec_def_compfc_lmdistancewdc_atapi_ctrlnch_poolsomaxconnural_readatu_external_firmwareipsec_exp_timeoutip_directedbcasti80321_pci_decompose_tag_bus_dmamap_loaduihashtblscsi_get_xsau_get_portaudiommapumct_activateticks_per_secondamap_initffs_flushfilesetherip_allowubsa_baudrateiq80321_pci_intr_establishicmp_sysctlsys_lseekulpt_resetmainbus_bs_subregionaudio_check_paramspool_cache_getnprocsdes3_decryptllinfo_arpmsdosfs_pollpci_lookup_quirkdatamsdosfs_accessaddupc_intrdvd_read_bcaamphy_servicewsevent_finiip6stathotplugread_filtopsuplcom_set_line_stateuvm_pageboot_allocconfig_pendingmii_phy_updateswwritei80321_i2c_matchether_crc32_lepiix3_4_setup_channeluvscom_set_crtsctsaue_csr_write_1rn_searchugenread_isoc_filtopsipipstatsecureleveluftdi_cadb_consoleurl_matcharpt_keepsavectxdb_printsymums_disablepte_l2_l_cache_mode_ptsys_seteuidwskbdpolluvm_map_checkprotmax_protohdrsensor_addmixer_openatu_tx_list_initcdce_activatedes_is_weak_keyohci_pci_matchural_rf_writedb_access_irq_spwdc_atapi_intr_dataumass_scsi_attachbufpagesrandomkqfilteruipaq_attachusbrev_strpciaddr_resource_allocateiic_execrlphy_cdsys_keventcopyargsarc4_reinituhci_device_bulk_methodsrt2560_attachmi_switchcd9660_statfsrndwrite_filtopssysctl_sensorsuaudio_drainkern_sysctlnd6_delayin_pcbinitsqphymatchbs_notimpl_bs_rm_4nmbclust_updatehw_prodfdremoveuvm_tree_RB_NEXTigmp_fasttimophtree_SPLAY_INSERTscsi_user_doneehci_device_ctrl_startuserconf_cmdbuflinear8_to_linear16_lewi_get_pmumass_bbb_stateaudio_init_recorddb_print_loc_and_instohci_device_ctrl_abortvop_pathconf_vp_offsetssvwsata_dmacmd_readrt2560_updateslotrt_mpath_matchgateubsa_stopbitscdce_startuaudio_identify_assensor_task_schedulert2661_reset_rx_ringuvm_map_entry_poolcrgetuhci_activateunp_bindtcp_delackuhci_device_isoc_closecsignalreaddisklabeldb_print_cmdusbd_clear_endpoint_stall_asyncehci_pci_shutdownvirtual_availbs_notimpl_bs_rr_2tcpstatuvscom_readstatwddkdriverdb_break_tablei80321_softcfillmapentrytcp_timer_persistsata_chip_maprelookupudav_newbufsys_umaskpci_subclass_i2osyn_cache_reaperfilt_fileattachsysentieee80211_find_rxnodepmap_alloc_specialsbs_notimpl_bs_r_8tcp_setpersistufs_ihashlookupubsa_intrmemmovesii3114_mapchanicmp_rediracceptugen_set_interfacevop_reclaim_descusbd_get_hub_statusdb_boot_halt_cmdural_attachip_outputbpf_mtapuaudio_add_selectorfindblknamenkmempages_maxkue_rx_list_initpool_initbpfreadpool_putm_copym2umidi_casysctl_structohci_hash_rem_tduhci_poll_hubpmap_pinitaxe_ifmedia_stssysctl_rdstringuvn_attachlasttimefiforead_filtopsehci_freexcryptoclosesysctl_disklockcnkqfilterem_read_ich8_bytedesiredvnodesbs_notimpl_bs_r_2ufs_pollusbd_remove_devicepmap_map_sectionmsdosfs_readlinkpmap_devmap_bootstrapdes1_encryptusbd_get_device_statusspec_vnodeop_plookupnchinitexec_mapdb_qualifysnprintfcomcngetciicbus_printsyscallext2fs_readlinkaudioprobeether_ioctlumass_bbb_transferrnd_attachedtqphy_serviceuscannerkqfilterip6_forwardinganon_swap_offural_cdkue_resetarp_allocated_bus_dmamap_load_mbufwdc_print_capswi_watchdog_usbslinear8_to_mulawifindex2ifnetcd9660_ioctlem_initrt_mpath_conflictusbd_get_config_desc_fullin6_savemkludgein_pcbnotifyallfilt_audiowdetachuvm_pglistallocsyn_cache_addohci_device_ctrl_transferulpt_do_writeincoreurlphy_cdhzdcphy_mii_phy_autoulpt_statusmsgdefrouter_resetcd9660_ihashinsrt2560_bbp_initsiop_script_writewdc_atapi_send_packetcheckaliascue_activatettyretypestartuphook_listre_tx_list_initpte_l1_s_cache_modekue_detachrt_timer_queue_changelf_initwi_ioctl_usbcpu_attachuvm_km_pages_lowatrn_mpath_countsd_switchwdc_preata_drivemii_phy_matchrt2560_eeprom_readural_amrr_timeoutsdclosevop_poll_vp_offsetsvop_generic_kqfilteruaudio_set_speedpffasttimoinitsiginfosys_getuiddb_set_cmduvm_unlock_fpageqcpuidsexec_setup_stackobio_bs_vaddrpager_map_wanted_lockuao_createdb_free_watchpointsaue_lock_miiidentify_arm_cpuffs_realloccguplcom_set_crtsctswskbd_load_keymapxscale_cache_cleanD_rngcd9660_bufatoffaudiocloseugenintrgroupmemberuvmspace_inituhci_powerrt2661_ioctlether_sprintfatu_calculate_paddingfintek_refreshmsdosfs_unlockselwaitpmap_init_l1udsbr_get_infoicmp6_mtudisc_callbackssys_forkip_setmoptionsuvscom_reset__qdivremumct_matchspec_openi80321_io_bs_vaddrpmap_vac_me_kpmapswcr_sessionsfilt_bpfreaddb_watchpoint_freeehci_alloc_sqhaue_shutdownuvm_fault_wireusbd_abort_pipekernelstacksi_freevm_nphyssegip6_randomidproc_filtopsfiq_nullhandleruvm_lock_fpageqelf32_os_pt_notewdc_print_current_modesfiledescopensys_vforkehci_freempmap_vac_me_uservop_reclaim_vp_offsetscomcnspeeduvm_pager_initcpufuncswinChkNamedvd_read_copyrightbio_delegate_ioctlvmi_list_slockdb_history_prevem_setup_receive_structuresmyip_initializedsync_vnodeop_psys_mkdiruao_reference_lockeduaudio_get_propspmap_devmap_tableufs_fhtovpcrypto_donewskbd_translatedumppcbrttrashohci_root_ctrl_abortmblowatgetnewvnodeufs_inactivepciide_natsemi_productskue_load_fwuaudio_opennd6_mmaxtriessiop_intrsys_socketuhci_abort_xferuhci_detachuaudio_getdevugenopenSHA512_Lastdead_vnodeop_opv_descohci_shutdowni80321intc_imaskfilt_uscannerdetachwi_init_usbugenioctlspec_close_clonevop_generic_bwritenanotimere_cdufsspec_writedead_vnodeop_entrieslxtphy_caiso_disklabelspoofmidireadfifo_badopfdfreefintek_catty_countdeflate_globaluftdi_detachraw_disconnectipsec_ipcomp_default_levelsensor_task_registersis_south_matchKERNEL_BASE_virtuaudio_identifyremove_coproc_handlerumass_polled_transferucom_to_tiocmbrelvpre_intrwdc_logauth_hash_hmac_sha2_512_96msdosfs_mountfspcibr_flagsem_82547_update_fifo_headehci_root_intr_startwi_stopip6_sprintfsync_fsyncumsm_activatevop_setattr_vp_offsetssetstatclockratecd9660_strategyohci_allocmuserconf_parseural_tx_bcntiocm_to_ucomip6_keepfaithext2fs_allocusercryptowskbd_deliver_eventdb_eregscom_fifo_probefdcopyatu_send_mibuaudio_setb_to_qbus_space_read_raw_multi_2uhci_pci_matchcmd0643_9_chip_mapobio_bs_allocusb_blk_freelistudp_sendspaceulpt_caSHA1Updateifg_headvfs_rootmountallocehci_device_isoc_transfercue_tx_list_initnetintrbs_notimpl_bs_sr_2rw_initcd9660_openi80321_bs_mmapuvmcnt_dumpixp_setup_channelohci_root_ctrl_startcmaskbrgphy_cd_bss_end__ext2fs_blkprefdb_pool_print_cmdwi_alloc_nicmem_ioicsphyattachdb_delete_lineuhidkqfilterVOP_ISLOCKEDsys_kqueueSHA512_Transformieee80211_tree_RB_REMOVE_COLORuao_referenceurio_causbd_kill_pipeuhci_freemin6_addrscopedb_searchieee80211_ifdetachuvisor_attachbs_notimpl_bs_wm_4vfs_getcwd_scandirmaxlockdepthwi_usb_tx_unlockraw_usrreqnblkdevuhci_find_prev_qhbs_notimpl_bs_wm_2uhidev_detachurioclosescancttyinput__stack_smash_handlerumsm_matchukbd_consopsbiodoneural_activatedb_set_breakpointcrp_req_queue_tailmulaw_to_ulinear16_be_mtsehci_free_sqtdwi_usb_txfrmmaxslpext2fs_makeinodeehci_device_intr_methodsswap_bytes_change_sign16_lecue_startaue_csr_read_2usb_eventsufsread_filtopsufs_symlinkudsbr_attachufs_mkdirvfs_getcwd_getcachepci_subclass_satcomusbd_get_no_altsin_iawithaddr__anddi3rt_missmsgdofilereadVOP_BMAPre_txeofignore_addrsip_dooptionsvn_locksvwsata_lba48_write_regcue_tick_taskusscanner_activaterip6_ctlinputubsa_activatecdce_caumass_cbi_adscsbdropmidi_out_stopmsgbufphystcp_debugusbd_transferinpcb_poolohci_hubdohci_pollnextralocblf_keysys_setegidnoswap_bytes_mtswdc_wait_for_statusbus_space_write_raw_multi_4ucom_status_changern_matchfifo_readcd9660_symlinkautoconf_verbosein6_setpeeraddrunp_externalizesys_munlockalluvm_faultuhci_waitintrrandomioctlsoreceivesiop_iwrpool_getuextralocdb_show_radix_noderootfsudav_csr_read1ohci_root_intr_startucom_shutdownrip6_outputinflatert2661_setup_tx_descscsibus_cdndflushcompose_tab_cmprn_insertspec_pollfilt_kqdetachmidi_cddb_flush_lineaue_unlock_miiipsec_exp_bytesbufqueuesconfig_deferem_check_for_link_bus_dmamem_allocm_tag_initfilt_usbreadusb_add_eventbsearchif_attachusscanner_matchpciaddr_ioaddrm_reclaimnameiem_read_pci_cfgbs_notimpl_bs_sr_4ext2fs_readdirip6_ctloutputdead_pollvn_accesstqphy_funcsversionwihap_init_bus_dmamap_synclzs_dummykqueue_initrt2661_read_eepromuplcom_set_line_codingaxe_rx_list_initata_dmaerruvm_pagezeroin6_setsockaddrigmp_leavegroupcom_common_getcre_pci_cabs_notimpl_bs_rr_8mountlistuserconf_histbufwdc_atapi_the_poll_machinecomsoftwihap_mgmt_inputpdc203xx_read_regudav_initVOP_REVOKEconfig_deactivatescsi_probe_bussesclallocipsec_esp_trans_default_levelbiowaitpci_subclass_inputfilt_ufsreadrt2560_rx_intrunixswsccsdb_stop_at_pctqphy_caehci_check_intrccpupmap_updateehci_device_setintrobio_cduvm_map_replacegeneric_bs_sr_1em_setup_linkacard_chip_mapnexttickeventtcr1_writeboothowtofdinitarc4randomnsphy_funcstcp_delack_ticksupl_stopttopenata_get_paramsether_ipmulticast_minconfig_rootsearchrip6_sendspaceieee80211_countrycode2namescsidebug_lunsuao_dropswapenxiosys___getcwdusb_cdrnd_event_headin6_maxmtupmap_enterrt2560_iter_funcamphy_funcsundefined_handler_addressSHA1InitRMD160TransforminflateInit2sys_setreuidusbd_ratecheckwi_usb_open_pipesudav_tick_taskuvm_map_findspacepdc203xx_pci_intrwsevent_initcryptoopencomcnattachuserasymcryptodb_var_rw_intrt2560_set_bssidusbd_devinfo_freesdsizesys_pwritevudav_lock_miikqueue_scanvop_print_descuplcom_breaktcp_closeicmpsrcohci_free_stdumidi_evlensd_patternsX_db_search_symbolscsi_initmsdosfs_advlockswcr_idwdog_registerkue_attachif_indexlimpdcsata_chip_mapusbd_free_xferdb_varsfallocbufferslxtphy_cdatu_joindeadproc_mutexdb_breakpoint_freeumsm_methodspfctlinputcomcnprobephys_mapuvm_anon_removeumass_bbb_methodssoft_intrqufs_lockcomintrboot_eaddr_validsys_accessem_read_mac_addrnsphy_statususerconf_initrt2560_ioctlkillpg1url_tx_list_inituhci_stri80321intc_attachvputonfreelistuhci_device_ctrl_transferwdioctlext2fs_mountrootobio_printem_ife_disable_dynamic_power_downpciide_mapregs_compatumodem_methodsregyearem_update_stats_countersurl_ioctlpage0setrunnablepool_do_putusscanner_sensedata_cbwi_set_ssidcue_ioctlnd6_prefix_onlinksensor_delatapi_to_scsi_senseugen_seltrue_filtopswdc_atapi_ioctlumct_intrcue_attachosversionelf32_read_fromau_get_lr_valueticks_per_intrem_free_receive_structuresatu_get_mibhid_is_collectionwi_usb_tx_list_initem_set_d0_lplu_statetvtohzvmi_listudp6_usrreqratecheckin_rtchangevfs_syncwaitudav_ifmedia_statusaue_crcffs1_reallocblksieee80211_node_lateattachcansignalhotplugpollmsdosfs_check_exportlf_setlocknbigpipecue_devsin_controllmaxrlphy_funcsuvm_pagecopysysctl_quadsys_readexec_process_vmcmdskue_tx_list_initrt2560_update_promiscem_phy_igp_get_infocmd_chip_mapmidi_attachieee80211_tree_RB_FINDrddkdriverohci_freemuaudio_matchi80321_bs_tag_templateucomioctluhci_remove_ls_ctrlmbstatdcphy_statusuhidev_intrttyinfodb_flush_lexttyinramdisk_devsohci_root_ctrl_donegetnulldevusb_get_next_eventdb_dmesg_cmdpciide_dma_initextent_destroydb_lpip6_forward_srcrtenc_xform_rijndael128if_group_egress_buildloop_clonerwhichqsgetcttsetwatermididetachdb_last_addrural_update_slotem_clear_hw_cntrscom_obio_matchpmap_enter_pvmsgbufenabledunp_disconnectufsfifo_writesys_listensys_mounthotplug_put_eventehci_root_ctrl_donepgsignalehci_waitintrfirstclinear16_to_ulinear8_bedb_read_bytestcp_rndiss_inituhub_detachaudio_silence_copyoutuvm_page_rehashvop_getattr_vp_offsetsvop_islocked_vp_offsetsrt2560_media_changeffs_fsyncfintek_attachau_portofinetdomainehci_abort_xfermemcpywdc_enable_intrkthread_exitaxe_activateuaudio_chan_set_paramcue_newbufsi_getdisk_constructvfs_unbusyip_nhopsrip_usrrequhci_setup_isocfilt_usbrdetachspec_writeaudiostartrsiop_wdtr_msgcom_obio_cdipsec_esp_network_default_leveldb_map_equalin_broadcastpool_page_free_oldnointrfd_getfilemsgbufaddrucomclosesdioctlutsnameexit2__hex2asciiaue_resetkue_open_pipesacer_setup_channelip6_mloopbackext2fs_cgupdateuhci_add_hs_ctrlcurpriorityrddumpem_enable_intrcpu_setperfufs_lookupsiop_pci_resetugen_attachufs_bmapdoasyncfreeudav_miibus_readregip6_randomflowlabelsync_vnodeop_opv_descttpolldegetlogpollkthread_createmulaw_to_slinear16_le_mtsugen_set_configsi_finddb_elf_sym_initwdc_default_read_raw_multi_2current_ipl_levelffs_fifoop_entrieslogclosegeneric_bs_wr_4nbufinstall_coproc_handlerSHA256_Updateohci_rhscudav_detachufs_strategyohci_device_requestkue_watchdogphysical_freeendbounds_check_with_labelether_input_mbufif_qflusharc4_timeoutumct_openpci_subclass_networkusscanner_data_cbext2fs_checkpathns_scx200_chip_mapsocantrcvmoreuipaq_rtsrt2560_update_ledfile_filtopsmsdosfs_renamesysctl_proc_argssiop_adapterext2fsfifo_reclaimdes1_zerokeypipe_wfiltops__lshldi3trr1_readcd_load_unloadpmap_activatebmtphy_resetvop_create_vp_offsetsmidi_getinfoconfig_make_softcunp_discardcue_csr_write_1ip6_outputwi_read_record_iouhid_caudav_rxeofrt2661_bbp_readswap_syscall_lockufs_kqfilterem_is_valid_ether_addrums_enablescsi_autoconfcheckdirsexecswmulaw_to_slinear16_beSHA256_Update_intrt2560_set_txantennaumass_atapi_attachin6_are_prefix_equalin6_controlem_setup_ledleapyearsys_sigsuspendcd9660_unmountwdc_atapi_the_machinepciide_dma_startehci_device_bulk_abortswcr_authcomputetrapsignalcurprocmainbus_bs_allocrushjobpmap_devmap_registerrn_inithead0db_single_step_cmdwd_flushcachend_defrouterblf_decfdcloseexecevcount_attachlimcopywi_do_hostencrypttcp_timer_rexmturl_ifmedia_changei80321_gpio_pin_writeuftdi_attachcrypto_pool_initializedsiop_pci_cart_timer_initudsbr_cdnd6_useloopbackieee80211_next_modeputsaxe_tx_list_initehci_pcd_ablerip6statmulaw_to_ulinear16_le_mtstcp_debxcnpollcd_casys_truncateesigcodeacphy_servicescsi_xfer_poolsysctl_wdogarmv4_tlb_flushIDudav_csr_readohci_add_donert2661_ack_rateem_read_phy_regieee80211_tree_RB_NEXTi80321_pci_initsrv_ipohci_add_edwdc_xfer_poolusscanner_cdcdce_newbufbus_space_copy_2soacceptkqueue_pollcdgetdisklabelvop_bmap_vp_offsetsdb_call_depthpool_page_alloc_kmemem_mng_write_commitem_swfw_sync_acquiredb_printfehci_device_isoc_doneuhidreadin6_ifaddloopufs_creatend6_optionscd9660_seeknd6_llinfo_settimermsdosfs_unmountelf32_load_psectionuftdi_writeSHA512_Finalrn_mpath_nextuhci_device_bulk_transferarm_pcache_unifiedmidi_out_startdb_add_symbol_tableuhci_remove_intruplcom_setm_tag_nextohci_intr1uaudio_id_namemsdosfs_writebs_notimpl_bs_w_1cue_resetexec_script_makecmdsiic_matchieee80211_reset_erpfilt_pipedetachcd9660_rootdb_unaryrgephy_statusiophyattachselrecordffs_validatecomstopatu_wait_completionaxe_ax88772_initrip_outputext2fs_accessrt2560_read_eeprommld6_fasttimeokthread_qimaxwsmouse_matchvop_unlock_vp_offsetsohci_free_seduserconf_pdevuvm_object_printitiq80321_devmapclock_secs_to_ymdhmsmbpooltcp_canceltimerstqphymatchrip_recvspaceroute_initdb_store_countlink_rtrequestwdc_get_xferuvm_vmspace_poolspec_lookuppipe_createfifowrite_filtopssysctl_vnodepdc202xx_setup_channeliodatand6_sysctlpciide_amd_productspci_subclass_multimediavn_openuhci_freexif_clone_createcdce_tx_list_inituao_detachcpufunc_controlmallocamap_pp_adjrefapollo_chip_mapin_pcbrtentryrt2560_get_macaddrknote_dequeueuhci_root_ctrl_startwi_cmd_usb__udivsi3tcp_outflagskqueue_statcdce_ioctluaudio_io_terminaltypecd9660_rrip_analyzeohci_hash_find_tdexphymatchbio_unregisteruriowriteip6_v6onlysys_preadvdb_tok_stringuserretsys_recvmsgpipe_statskipjack_setkeyvn_writemtdphy_servicevop_mkdir_vp_offsetsVOP_LINKubsa_devsicmp_inputuvm_km_free_poolpage1umass_cdvcountrd_root_sizevm_page_zero_enablein6_delmultistathzenc_xform_cast5wdog_ctl_cbuaudio_mixer_get_portuftdi_get_statuswskbd_cnattachwdc_ata_bio_intrvirtual_enduhidev_get_reportsys_getloginbuckstring_inituhci_free_std_chainiq80321_pci_init2icmp6_rediracceptext2fs_vnodeop_opv_descdetruncdb_elf_symbol_valuescopyoutpfindcomconsaddrip_ctloutputuhidev_set_report_asyncwsevent_readenc_xform_arc4arp_ifinitdb_write_variableufs_dirbadcd9660_readdirvfs_unmountallrgephy_loopohci_allocxcopyrightsdattachxscale_optionswdc_default_lba48_write_regtcp_timer_keepusscanner_attachusbd_devinfo_vptcp_mss_updateiopiic_cdpciide_lookup_productfree_pagesffsfifo_reclaimehci_root_ctrl_startdb_proc_print_cmdrt2560_initrw_enter_readdb_show_all_procsvunmapbufehci_device_ctrl_transferip6_sourcecheck_intervalroute_outputrti_deletevop_kqfilter_descsys_geteuidhostzeroisbroadcastchange_sign16_swap_bytes_bedb_output_positionem_mng_write_dhcp_infoicmpmaskreplin6_pcblookup_listenmsdosfs_mknodcd9660_specop_pip6_defmcasthlimsys_munmapsii3114_dmactl_writeudsbr_hw_iftcr1_readfilt_solistenvsnprintfarplookupuvm_map_pageableproftimer_trampolineem_write_reg_iochainallocuplcom_methodspmap_copy_page_xscaleifmedia_baudratei80321_calibrate_delayem_82547_tx_fifo_resetusbd_setup_default_xferuvm_pagelookupsoshutdownuserconf_hist_cmduftdi_cdtcp_rndiss_reseeduserconf_listproc_cansugidcd9660_rrip_getsymnamedb_command_tablebpf_iflistem_reset_adaptivewdc_downgrade_modeieee80211_node_leaveip6intrqaxe_newbuftodr_handlend6_rs_inputwdc_atapi_real_start_2pciide_mapreg_dmasoabortlinear16_to_linear8_beem_init_lcd_from_nvmuaudio_trigger_outputem_get_bufem_82547_move_tail_lockedcast_encryptunp_inologkqfilteruvm_tree_RB_INSERTdb_extent_print_cmduprintfdb_clear_single_stepuvm_page_printitmainbus_cai80321_local_dma_initrt2560_intrsoftdep_flushworklistsys_issetugidinitclockscd9660_mmapsd_reassign_blocksif_detachaue_watchdogmidiprintwdc_ata_bio_startnd6_cache_lladdrifqmaxlencatqsession_poolext2fs_specop_opv_descunp_connectuvm_pagermapiniic_smbus_read_byteif_detached_startudsbr_set_infopool_serialxscale_cache_flushD_SEuplcom_activateirq_entryaue_ioctlvfs_mountedondb_expressionboard_powerdowncputypepmap_deactivatert_lookupfc_lookup__bss_start__linear8_to_linear16_be_mtsif_downndqbfilt_rndreadallocsysVOP_GETATTRuhci_root_ctrl_methodsieee80211_fix_ratesiop_add_reselswuvm_km_pages_headwihap_deauth_reqieee80211_node2reqwi_usb_matchelf32_check_headertcp6_usrreqrt2661_bbp_initdb_historyeephy_cdinphy_cdukbd_parse_descmidi_unit_countttytstamptcp_rndiss_cntural_set_txantennaieee80211_crypto_detachpmap_unwireipaddrip6_auto_linklocaluvm_pageunwirehw_serialehci_device_intr_abortauth_hash_hmac_md5_96wskbd_get_mixerdevuvm_unmap_puaudio_halt_in_dmacdattachuserconf_deviceurioreadin_localaddrsys_sigaltstacki80321_i2c_casii3114_dmatbl_writeDES_versionbrgphy_resetsoisdisconnectingauth_hash_key_sha1Blowfish_initstatewi_media_changenull_decryptsyn_hash2rttimer_queue_headarm_pdcache_sizeexphy_caucom_dtrrtredirectuvm_map_printitwdc_atapi_pio_intrem_init_lcd_from_nvm_config_regiondb_read_variableulpt_cdsoftintr_initdb_regsdb_stack_dumpttymodemdb_lbuf_endmtx_enteraxe_devskqueue_pooluaudio_mixer_set_portvntblinitallcftablesuhub_activatein6_ifattach_linklocalVOP_REALLOCBLKSuhci_globalresetE_abs_tag0_Usedugenwritesys_setresgidmsdosfs_sync_vnodesplassert_failarm_picache_waystty_initaxe_ioctludp6_recvspaceuvm_km_freeusscanner_intr_cbsys_killuserconf_numberperflevelcomconsiohpmap_set_pcb_pagedirinsw16em_watchdogrt_setmetricssys_getegiddb_set_single_stepem_phy_m88_get_infort2560_rssadapt_updatestatsem_check_mng_modeserverworks_setup_channelumass_init_insystemem_validate_eeprom_checksumdirchkexphy_resetipip_outputpipeclosealaw_to_slinear16_le_mtsext2fs_fifoop_entriesVOP_REMOVEpci_mapreg_typewi_usb_activateconsiniturlphy_statusext2fs_dirremoveuvm_vnp_uncachesysctl__stringffs_clusteracctconfig_detachmtdphyattachifaof_ifpforaddrcryptop_poolsc_pld_shminidatacleanrt_timer_queue_destroywi_cdsd_cdicmp_mtudiscipport_hifirstautosys_fstatem_phy_ife_get_infoem_read_eepromenc_xform_3desrgephyattachuserconf_enableukbd_sunlayoutext2fs_vinitdb_endlpuplcom_intrumass_bbb_resetcryptodevallowsoftem_driver_versionobio_foundgeneric_bs_w_1sa6_anysys_getpriorityatu_radfirmpci_subclass_cryptosysctl_diskinitE_ldsa_abs_reselect_Useduvm_km_vallocieee80211_send_mgmtcue_getmacnatsemi_chip_mapbrgphy_bcm5421_dspcodeieee80211_dump_pktsys_unmountuvscom_dtruipaq_detachbootdvmainbus_bs_tagelf32_probesumct_detachin6ifa_ifpwithaddrvgonelsofreeeephyattachinphyattachuvscom_shutdowndb_del_symbol_tabledb_add_exprsiop_timeoutpmap_removebpf_mtap_afuaudio_determine_classicmp6_fasttimoext2fs_removeif_clone_destroyehci_close_pipewdccommandmyipbpf_setfuserconf_historyuvm_page_unbusyfilt_hotplugreadtk_noutext2fs_mountpmap_collectBlowfish_expand0stateuhci_check_intrukbd_enabledb_symformat_elfpciide_compat_intrgeneric_bs_rr_4cpu_sysctlcd9660_vnodeop_pcd9660_deftstamphotplugkqfilteri80321intc_smaskip_randomidaudio_rintaue_tx_list_initnosuidcoredumpukphyattachvop_poll_desccddumpdb_search_cmdasttcp_disconnectvop_open_vp_offsetsuvmspace_execuhci_timeoutwi_usb_detachsys_mmapehci_bus_methodsbootuaudio_hw_ifnd6_is_addr_neighborblf_ecb_encryptunp_rightshostnameaudio_cddb_print_llinfocmd680_setup_channelpci_enumerate_busem_disable_pciex_masterupl_outputi80321_intrext2fs_bmapuvmexpnextstateventenc_xform_blfehci_detachufs_diremptyreinsertfinishdupukphy_serviceqsphy_resetdeflate_decompresspool_destroylogwakeupshutdownhook_listip_dosourceroutesoread_filtopsieee80211_media2ratecpu_swapoutbdevsw_lookupdisk_changeuplcom_matchsc_devsamap_lookupsdoreallocblkscache_revlookupamd756_setup_channelbpfread_filtopssoinitem_get_speed_and_duplexVOP_MKNODuvmnd6_ifdetachin6_ifaddrroute_protobrgphy_funcsfilt_ugenread_isochw_uuidext2fs_truncatere_newbufcd_play_tracksscsi_do_mode_sensevirttimer_trampolineip6_maxfragpacketsdb_errorehci_confdprefetch_abort_handleruvm_km_threadem_rxeofuhci_root_intr_methodslminscsi_probe_bussys_fpathconfarpt_pruneohci_device_bulk_methodssoconnect2knote_poolcnopennatsemi_setup_channelscsi_test_unit_readyural_set_bssiduscanner_activatericohrtc_reg_writearc4random_bytesnmbclustural_get_rfvop_reallocblks_vp_offsetssominconnrt2661_mcu_wakeupuhci_device_clear_toggleredebugnchashtbluvm_vnp_syncem_transmit_checksum_setupiopxs_cdwihap_assoc_requaudio_chan_ptransferarpt_downrdgetdisklabelulptclosearm_pdcache_line_sizebpf_tapdb_lookupSHA256_Finalmii_phy_automax_datalenmsdosfs_initohci_device_ctrl_startvop_readdir_descwi_write_record_ioext2fs_writelf_clearlockgeneric_armv4_bs_wr_2db_lastsymsiop_resetbusurl_memip_srcrouteuaudio_add_mixeruhidioctlip6_accept_rtadvpte_l1_s_cache_masksys_setregidusbd_device2interface_handleurl_csr_read_1usbd_dopollvinvalbufsys_ftruncateuhci_device_isoc_startubsa_dtraes_ctr_cryptm_splituhci_remove_hs_ctrlsoftintr_disestablishfifo_pollkrp_req_queue_tailumodem_ioctlurl_stoptcp_timer_initdb_tab_stop_widthradioattachdb_putncharssii3114_dmactl_readmainbus_bs_unmapnd6_maxnudhinttcp6_inputwdc_atapi_donesosetoptehci_set_qh_qtdtcp_msscache_purgeudav_stop_taskbpf_mcopySHA384_Finalauth_hash_hmac_sha1_96siop_printstatsfork1curpcbdb_activevfs_hang_addrlistcue_tickdead_writeufs_dirrewriteinsmntquettreadtk_canccdb_write_bytesext2fs_blkfreeudp_outputfind_last_setcd9660_vnodeop_entriesrt2661_set_chantcp_rndiss_msbsys_chmoducomreadprelist_removeffs_vgetrt2661_tx_intraxe_encapinitproc__umoddi3em_put_hw_eeprom_semaphorearm_dcache_alignugenclosert2661_media_changeip6_log_intervalnull_encryptwihap_auth_requvm_page_physdumprootconfX_db_sym_initsyn_cache_timersolisten_filtopsatu_internal_firmwareprocess_kernel_argsin6_update_ifa__wdcerrorcdce_detachvop_bmap_descrt2560_tx_intrsuser_ucredmulaw_to_alawsd_shutdownwi_shutdownmem_noext2fs_buf_allocral_pci_matchatu_xfer_list_freeuhci_free_stdwihap_sta_deletepciaddr_resource_reservemainbus_bs_rm_2pmap_free_l2_bucketRMD160Update_intrevarprequestkernel_mapuhci_device_isoc_enterwi_init_iodumpdevwsmouseioctlcd9660_lockem_check_polarityieee80211_mgt_subtype_nameugen_do_readchange_sign16_swap_bytes_le_mtsdb_not_taken_bkptuaudio_chan_initvfs_mount_foreach_vnodekqueue_kqfiltermidiclosewi_mgmt_xmitaudio_openuhid_do_ioctlzeroin6_addrstrncasecmprt2661_shutdownatu_tx_startcpu_swapinrt2560_encryption_introhci_device_bulk_start__guardwdc_atapi_minphysin_ifaddrnd6_optionwin2unixfnmax_hdrffs_readm_freevop_default_descurlphy_attachscsi_inqmatchfdesc_poolcmd_pci_intrusbd_add_drv_eventvop_strategy_vp_offsetspool_page_allocin_pcblookupm_tag_delete_chainfilt_pipewritecd9660_polliicprobencpool_head_slockbadaddr_read_4bzerotickfixintervalarmv4_drain_writebufufs_closefixjobcdb_show_all_cmdsehci_shutdownpci_subclass_daspscsi_execute_xsin6_addmultirn_newpairvop_setattr_descdb_find_breakpoint_herebiossys_obreak__udivdi3blf_setkeyusbd_set_config_norgephy_cdusbpollpciide_cdlastddateem_check_downshiftucom_do_ioctlpmap_curmaxkvaddrin6mask0bpf_validateusbd_get_string_descvaccessuao_set_swslotmbinitchange_sign8usbd_get_reportabortwskbd_default_bell_datascsi_readsafe_cmdamap_allocVOP_LOCKMD5Finalwskbd_matchcp_timeaxe_rxeofcd9660_vget_internallinear16_to_linear8_lert2560_decryption_intrdb_page_print_cmdwi_intrvgetrd_attachugenpollieee80211_create_ibsstisr_readwsmouseopenwinChksumserverworks_chip_mapfreeclusterchainmld6_initrw_test_and_setmainbus_bs_w_4disk_initcd9660_fifoop_opv_descohci_hash_rem_itdohci_bus_methodsrt2560_get_rtsatu_cdrip6_ctloutputwdcrestartnetioem_set_pci_ex_no_snoopaue_sendusbd_getnewaddrnd6_na_outputext2fs_fhtovpumass_cbi_transferext2fs_createem_local_timerusbd_bulk_transfer_cbwi_sync_mediavfs_opv_init_explicitpipe_pollnsphy_cabmtphyattachucomopensysctl_dopoolcd9660_fifoop_puhub_matchpmtu_expirecrypto_getreqtcp_respondsys_readvamap_cow_nowroundrobinbadaddr_readuvm_map_createvfs_opv_initissignalwdprintnetclsfilt_uhidrdetachcdevvprt2560_bbp_writeuhci_intr_setsoftintrigmp_joingroupinflateIncomprandompolluiomoveohci_device_isoc_doneoutsw16wi_usb_wridrespmsdosfs_startlf_allocdb_loop_countwi_intr_ackpciide_dma_table_setupfiq_releasebpf_reset_dslinear16_to_mulaw_lend6_dad_stophid_start_parseuseloopbackuvm_waitnexecsi80321_mem_bs_mapieee80211_regdomain2namepmap_referencesys_bindrt2661_watchdoguaudio_trigger_inputloioctlrw_exit_writebs_notimpl_bs_wr_8rt2560_free_tx_ringumct_initpmap_bootstrapbs_notimpl_bs_wr_2blf_cbc_encryptipsec_auth_default_levelsys_mqueryarm_picache_line_sizebigadjkmeminit_nkmempagesspec_vnodeop_entriesusbd_new_devicefillinusemaprecvitfill_kproc2bmtphy_funcsums_cdfilt_sowriteuvm_kernacccnpollcsys_linkucomsubmatchlog_openevcount_initfragtbl124userconf_totdevi80321_bs_tagvop_inactive_vp_offsetsrt2661_tx_cmdxscale_cache_flushIDrt_tablesrt_ifmsgwdc_atapi_real_startobio_bs_maprealitexpireipstatunix2dostimescsibus_caubsa_attachuvscom_openurl_newbufusbd_delay_mspool_page_free_kmemcrfreecnputcuhid_do_writepte_l2_s_prot_wip6_lasthdrohci_device_isoc_abortuhub_uhub_caugen_matchtcp_reaperlastnowpool_sethiwatrt2661_tx_datasvwsata_mapreg_dmawi_read_record_usbuftdi_methodswdgetdefaultlabelmicrotimert2560_tx_datauvm_swap_getaudiosetinfopciide_serverworks_productsext2fs_reloadurlphy_matchcsefindelf32_copyargsisochariophymatchuvm_km_alloc1siop_cdcdopentcp_usrclosedaue_ifmedia_stsboard_resetskipjack_backwardsphysmemurl_cdinferiorxscale_cache_purgeD_Eukbd_attachclusterallocext2fs_fifoop_pcryptof_readuplcom_cart_if_remove_rtdeleteltsleepwskbd_attachin_pcbbindxscale_cache_flushIumass_cbi_statemtdphy_cauhci_timeout_taskuhci_root_ctrl_closertalloc2endtsleepwihap_check_txuvm_pageratopsigactssharedb_set_watchpointbpfattachuftdi_openif_detach_queuesitimerdecrusb_create_event_threadether_outputpci_cdem_phy_setup_autonegpmap_bootstrap_pv_page_freeauth_hash_md5crypto_kdonebpfilter_lookupm_copym0axe_miibus_readregvm_physmemSHA256_Transformiso_shipdirrdwriternd_timeouticmpmaskpipe_ioctlural_set_chanwskbd_enablepmap_devmap_find_vacd9660_mountrootnetlckbpf_allocbufsset_stackptrrt_gettablemsgbufmappedohci_device_setintrcomprobe1getphysbufcdsizedb_symbol_valuesuhci_device_ctrl_startumass_lookupdb_evarsupl_activateiic_smbus_write_byteufsfifo_closewakeupgetnanotimeatu_devspciide_matchi80321_mem_bs_mmaptcprexmtthreshkprintf_mutexrt_getifadb_malloc_print_cmdwi_get_fid_ioenosyslockmgrrtlabel_name2iduvm_vnodeopsvfsconfVOP_OPENcompwroffurio_attachSHA384_Initbuckstringuhci_device_bulk_startsiop_scsicmd_endusbd_fill_deviceinfoscsi_interpret_sensesqphy_cdugen_do_ioctlext2fs_flushfilesmsdosfs_vnodeop_pdes_ecb3_encryptcomconsattachedbrgphy_probelxtphyattachwi_usb_txeof_frmufs_readlinkrdopendoscheckpathpcbmapaudio_readatu_newstateuscannerclosend6_option_inituvm_km_alloc_poolpage1brgphy_serviceaudiopollpiix_setup_channelext2fs_setsizein6_init_prefix_ltimesnchstatscd9660_fhtovpmsgbufpE_ldsa_abs_selected_Usediq80321_pci_intr_stringsys_setgiduserconf_common_attrfilt_ufswritert6_flushrd_ioctl_serverehci_timeout_taskuvm_mlk_callatapiscsi_attachgeneric_bs_r_4E_ldsa_abs_slot_Usedmmrwffs_bufatoffem_init_hwiq80321_pci_intr_disestablishwi_usb_rridrespuvm_errno2vmerrorsubkey_table_gendohookswdc_atapi_tape_doneem_pci_set_mwiehci_free_sqtd_chainieee80211_rssadapt_chooseem_disable_intrukbd_activatetmr0_readsiop_sdpiic_probeem_poweraue_setmultiif_detached_ioctllocnampvop_close_descwi_usb_causerconf_showip_mtudisc_timeout_qaddress_exception_entryffs_fhtovpgetvnodefilt_ufsvnodecrypto_get_driveridpool_setlowatehci_pci_givecontrolleruscannerpollkmembaseswi_entryrip6_inituvm_aiobuf_poolisofncmpsysctl_emulsys_sigprocmaskdb_commandrt2661_select_bandin6_if_upfilt_pipereadsoreservepidtakendb_formatrt2560_reset_rx_ringbrgphy_bcm5703_dspcodeuvm_mmapusb_activatescsi_report_lunsufs_quotactlradioactivateem_swfw_sync_releasearoundin6_pcbnotifystrrchrusbd_clear_endpoint_togglecrypto_threadgetdevvppci_mem_finddefrouter_selectamap_unrefext2fs_statfsbpf_mtap_hdrcrdupamap_wiperangecuio_copybacktickdeltaisodirinodb_strlcpycfrootswsmousepolllease_checkchrtoblksiop_get_lunswscsiprintuserconf_pdevnamminphysukbd_matchurl_tickrtalloc_noclonetimeout_mutexcd9660_specop_opv_descether_addmultivop_mknod_desccdce_cdip6qffs_vptofhifunitvfs_isbusyirqstackbawritetputcharsvwsata_dmatbl_writewskbd_detachpmap_postinitcsedeletepool_print_pagelistffs_fragacctrt2661_rx_tuneffs1_ballocsys_fchowndcphy_attachuvisor_methodsums_activatedb_breakpoint_cmdcd_powerhookvwaitforiomii_phy_tickuscanner_do_closecd_read_subchannelextendfilelortrequesticmp6_inputuserconf_addwdc_atapi_resetohci_device_intr_methodswi_func_iocreatedeuvscom_closesbreleasedb_history_sizemsdosfs_islockedmax_linkhdrem_dma_freeumass_attachalaw_to_ulinear16_lecryptof_statudav_resetget_stackptrsysctl_rtablemsdosfs_reclaimvop_mknod_vp_offsetssqphy_serviceuserconf_hist_eoci80321_intr_disestablishext2fs_getattrrtlabel_id2namesbdroprecorduvisor_activateuvm_coredumpem_write_phy_regi80321_handlerwdsizeacphy_statusip6_sysctlsuserdiskconfural_tx_dataatu_get_card_configvn_syncer_add_to_worklistusbd_get_interface_descriptorgeneric_bs_rm_1tk_ninsysfilt_opspciide_mapchanclusterfreert2560_beacon_expirerootdevaudio_fill_silenceehci_device_isoc_startufs_ihash_slockm_tag_firstmixer_closeem_82547_move_tailcdmatchpmap_map_entryusbd_get_config_descriptorpciide_machdep_compat_intr_establishdumpsysicmptstampreplif_detached_watchdogatapiscsi_detachem_mng_write_cmd_headerusbd_ar_pipecy693_setup_channelext2fs_fsyncdoforceuhci_root_intr_startsys_fsyncwi_usb_stopuserconf_add_readre_pci_probeusbd_reset_portrt2661_set_macaddrifconfsiop_led_onpciide_pci_intramap_wipeoutuser_configcast_setkeydb_map_currenttcp_rndiss_nexttcp_outputnsphyattach_bus_dmamem_mmapi80321_attachupdate_ledsext2fs_updatetcp_timer_2mslaue_openpipesudsbr_detachi80321_gpio_initffs_reload_vnodeif_addgroupmsdosfs_setattrVOP_RMDIRwdog_tickledb_delete_breakpointciphy_cdieee80211_setmodeuhid_matchpool_allocator_freefilt_proceopnotsuppumodem_paramfifo_lookupffs_reallocblksrandomcloserootvpaxe_miibus_writeregem_print_hw_statsugen_do_writeuserconf_maxlocnamespool_reclaimpci_subclass_serialbususb_quirksbpf_sysctlvflushehci_opencddetachpmap_clear_modifytcpctl_varsarptimertcp_reass_limitruaddrdstrategym_copymsystemsbcopy_pagedb_free_breakpointsif_uppiixsata_chip_mapumsm_cart2560_shutdownehci_intr1rgephy_resetupl_intrucomprintural_matchVOP_BWRITErt_timer_queue_createwddonemsdosfs_ioctlpciide_dmatbl_writeupl_matchrt2560_stopsys_openrgephy_funcsurio_matchinet6domainural_enable_tsf_sync_bus_dmamem_alloc_rangepgdeletert2560_next_scanuvm_pageidlezerowskbd_do_ioctl_scphtree_SPLAY_MINMAXdb_symtabsi80321_irq_handlerieee80211_media_changeucom_detachraw_attachural_set_rxantennadb_boot_sync_cmdastpendinguhci_noopether_ip6multicast_maxpipe_pooluao_initvop_abortop_descifa_ifwithrouteumidi_get_quirk_data_from_typespec_kqfiltertcp_notifyieee80211_match_bsscd9660_tstamp_conv7ural_free_tx_listffs_dinode1_poolrandomattachsys_sstkem_smartspeeddb_print_positionrtflushclonedb_radixgetblkem_tbi_adjust_statsdead_vnodeop_pxscale_cache_flushD_rngmaxsmapwdc_ata_biosoconnectural_initvtypesnobuffersdata_abort_handler_addressrtrequest1__lshrdi3db_find_watchpointusbd_errstrtcp_identtcp_rst_ppslimrtrequestuhci_openifinitcd_load_tocunpst_recvspacezlib_versionkue_initxscale_cache_purgeIDraw_inputcd9660_reclaimkue_ioctlfilt_logrdetachnd6_ifattachunpdg_recvspaceoutswm8pipe_closeaudio_draincd9660_inactivesoftdep_mountmsdosfs_rmdiruvm_km_getpagemsdosfs_fsynccfdataffswi_usb_tx_lockusbd_do_request_async_cbufs_checkpathem_init_eeprom_paramspmap_pte_init_xscalepfxlist_onlink_checkdb_elf_lookupm_tag_findinittodrblf_encadler32vputpte_l1_s_cache_mode_ptvector_page_setprottcbhashsizecd9660_setattrfilt_hotplugrdetachusbd_get_configcyhc_slockufs_quota_initz_freekqread_filtopsbrgphy_bcm54k2_dspcodeusbd_setup_pipexscale_setttbaudio_closexscale_cache_cleanIDem_get_software_semaphoreem_read_part_numaue_csr_read_1cryptowriteieee80211_beacon_allocatu_attachubsa_get_statusbioopscpu_classesbpf_setdltmsdosfs_statfslboltpipe_initusbd_open_pipe_intrsyncerprocrt2560_set_macaddrufs_ihashinsin_setpeeraddrwdcactivateeephymatchinphymatchatu_taskwindow_inflatedb_readlinert2661_enable_tsf_syncether_ifdetachvop_fsync_vp_offsetsuhidev_get_report_descuserconf_histcurrndstatscy82c693_writemsdosfs_inactivepciaddr_do_resource_reserve_disabledcurrent_intr_depthpanicstraudioioctlpdc20265_pci_intrupl_newbufumass_scsi_cbscsi_delayext2fs_sync_vnodeunpdg_sendspacesession0viscpywsmouse_do_ioctlE_abs_lunsw_return_Usedhw_vercopyin__umodsi3comparamsiop_common_resetural_stopudav_sendcd9660_defattruaudio_round_blocksizeohci_device_bulk_closeehci_reverse_bitsrtalloc1bs_notimpl_bs_sm_8uao_swhash_elt_poolufs_ihashgetdes_set_odd_paritysigacts0findblkmajorpager_mapntohlsorflushugen_caiophy_funcsttioctlarpintrqvprintfslpqueohci_root_ctrl_methodsttycharssyncdelaywi_usb_infofrmugenreadffs_mountext2fs_specop_entriesuaudio_chan_rtransfericmp6errppslimSHA512_Update_intbadaddr_read_2usb_desc_iter_initusb_neventspool_inactive_timelinear8_to_linear16_beuhci_add_intrconfig_process_deferred_childrenohci_ifcdpool_cache_reclaimxscale_cache_purgeID_Eluphymatchbs_notimpl_bs_sm_2in6_setmaxmtuem_camsdosfs_roottqphyattachusbd_finishsoftnet_intrhandbpf_getdltlistm_tag_getsb_lockem_enable_tx_pkt_filteringohci_root_intr_abortuhci_pollrt_labelscrypto_unregisterupl_watchdogsuid_clearttwriteatu_initchange_sign16_leehci_activatert2661_set_basicratesswapdev_vpre_miibus_writereguipaq_methodsdead_readufs_pathconffile_pooldb_boot_reboot_cmdohci_timeoutvop_symlink_vp_offsetsunputcendluphyattachVOP_CREATEprobe_switchcdce_stopvop_readlink_descuvm_map_referencespec_ebadfphtree_SPLAYuvscom_get_statusnd6_recalc_reachtm_intervalpagetables_startin_ifinitfifo_closeohci_device_ctrl_closepciide_mapregs_nativein_pcbhashlookupem_setup_transmit_structuresre_eeprom_putbyteem_enable_pciex_mastermainbus_bs_mmapural_writeucom_cleanupcd9660_vnodeop_opv_descVOP_ABORTOPehci_pcdchange_sign16_swap_bytes_leem_identify_hardwareuhci_idoneuvscom_set_line_codingdefault_chip_mapsys_acceptuvm_map_entry_kmem_poolwi_inquireehci_pci_takecontrolleradm1032cloneprobetcp_rst_ppslim_countukbd_detachif_clone_listsys_futimesrt2661_update_promiscsdgetdisklabelwi_do_hostdecryptsiop_table_syncinternal_commandpci_subclass_wirelessciphyattachin_losingsis_chip_mapVOP_SYMLINKgeteblkrt2661_detachusbd_set_interfaceem_force_mac_fcscsibusmatchcrypto_kregistervn_ioctluhci_remove_bulkwi_usb_ctl_lockufsspec_readdb_show_calloutrt2661_set_txpreambleaxe_cdpipespacefiqvectorohci_alloc_stdcmd646_9_irqackip6_sendredirectscast_decryptddb_sysctlukphy_caitimerfixip_stripoptionsaxe_setmultisyn_cache_countulptuseinieee80211_add_xratesnd6_timer_chcpu_resetudav_ticktcp_ctlinputether_multiaddrstart_cleanerffs_blkfreeexit1ohci_detachbdevvpifa_ifwithdstaddrehci_cdi80321_bs_mapmidi_ointrdb_watchpoint_allocudav_ifmedia_changein6_nigroupscsi_mode_sense_big_pageauth_hash_sha1uihashrijndaelEncrypttcp_keepintvlvop_reallocblks_descuvisor_detachvop_remove_desccdwriteufswrite_filtopsttybgconfig_searchwihap_sta_findusbd_printuvm_km_valloc_prefer_waitsyn_cache_poolpci_subclass_mass_storageffs_allocwrite_multi_1aue_tick_taskatapiscsi_cdcpufunc_faultaddressdb_preveephy_funcsinphy_funcsucom_hwiflowbswap32rgephymatchipsec_exp_first_userlphy_serviceusscanner_sensecmd_cbplimit_poolip6_defhlimumass_setup_ctrl_transferunp_connect2usbd_set_pollingrn_walktreepool_prime_pagepciide_ite_productssys_chownuvm_pagewirevop_lease_vp_offsetsem_stopin6_joingroupsys_munlockhotplugattachuvm_anfreeuhci_bus_methodsdofilereadvipip_sysctlbs_notimpl_bs_sr_1vn_statfilerw_exit_readieee80211_iterate_nodeswi_intr_enabletablefullumct_set_line_stateuhub_exploreupl_txeoftcp_maxidlemclpoolvfs_getcwd_commonset_cpufuncscttyioctlrt2560_node_copyffs_vnodeop_psys_lstatfilt_rndwriteohci_timeout_taskohci_hash_add_tdiso_uiodirurl_activatecttyopenpmap_link_l2ptinet6ctlerrmapfifo_vnoperatedisknamesmidi_iintrumass_quirksdumploRMD160Updatemsdosfs_mountacphy_funcsuvscom_activatenullcnpollcuvm_km_initpciide_acard_productsbzero_pageffs_sbupdateudp_sysctlbs_notimpl_bs_wm_1vmmapbsyusb_add_taskurl_int_miibus_readreguserconf_histlendb_list_breakpointsem_read_eeprom_eerdusbd_set_protocolnkmempages_minvop_mkdir_descukbd_accessopsusbclosesis96x_setup_channelpcipowerudav_matchcdce_get_descvector_pagesys_sched_yieldvmspace0scsi_decode_sensettywaitwsmousedevprintuvm_map_setuptcp_syn_cache_sizewdc_default_vtbletextifa_ifwithnetmemchrrd_attach_hookohci_device_ctrl_doneqsphy_statussqphyattachpte_l2_s_cache_maskcomp_algo_lzsscsi_mode_sense_pageboot_argsSHA384_Updateumass_scsi_setupproc_pooluplcom_dtraue_intrmainbus_bs_wm_1udp6_inputsys_writert2661_next_scanmap_forwmergedb_get_valueural_set_txpreamblegeneric_armv4_bs_rr_2sb_maxusbd_fill_iface_datacd_set_pa_immedulptopen__bss_end__cnstopextent_print_allihashtblieee80211_set_shortslottimesys_dup2em_phy_resetdb_inst_countdb_read_lineusscanner_caem_poll_eerd_eewr_donewdc_ioctl_findsiop_productswd_get_paramssys_readlinkrt2560_setup_tx_descext2fs_sizecpufunc_faultstatus__ashrdi3bs_notimpl_bs_mmapohci_intrxscale_cache_flushI_SEpmap_dump_ncpgip6_auto_flowlabelsvwsata_mapchanuipaq_cafintek_worklistlf_splitifafreeVOP_STRATEGYtzucom_rtsxscale_cache_syncIrip_sendspacexscale_cache_cleanID_rnguhidev_writeamap_addtcp_freeqif_setgroupattribsuhci_device_requestcom_attach_subrsii3114_dmacmd_readdvd_authrt2560_node_allocexphy_servicesiop_maumass_scsi_cmdcdreadrt2661_get_rfrt2560_enable_tsf_syncspec_inactiveehci_device_intr_startSHA512_Initwi_func_usbulptioctlsys_sendtoicmperrppslimgeneric_filtopsknote_dropuftdi_setcue_watchdogin6_selectsrcsoftclock_siem_82547_fifo_workaroundwi_usb_threadin6_pcbsetportalldevsrt2661_iter_funcwddumpicmp_do_errorvmcmd_map_readvnpmap_dumpcomconsfrequsbd_get_interface_altindexamap_extendsigpropvmapbufaxe_rxstarti80321intc_intr_initdehashtblsocketopssiop_pci_matchX_db_sym_numargsnd6_maxndoptip6_iduvm_map_clip_startrawcbtablespec_readfiq_nullhandler_endumodem_cdunp_markacphyattachdes_key_schedicmp_mtudisc_timeoutpmap_zero_page_xscalettyread_filtopsiic_printusbd_bulk_transfervop_lookup_descdb_map_addrgetinoquotatmr1_writefifo_ebadftmr1_readscsi_do_ioctlrtable_existsehci_free_sqhcd_resettimedeltaX_db_foralluhci_pci_caem_is_onboard_nvm_eepromudpstatcd_read_tocural_amrr_updatecdioctlcue_stopuvscom_detachifmedia_addatu_usb_requestlxtphy_funcsskipjack_zerokeyusbd_set_config_indexlogopenluphy_servicert2560_txtimeem_ich8_flash_cyclert2661_rxratebreadntcp_hdrsztcbtable__xordi3i80321_mem_bs_initfrag6_draindosdiremptyidleigmp_slowtimoifpromiscfork_returnsys_getsocknamecd9660_lookupvop_fsync_descricohrtc_cawi_usb_intrusbd_alloc_buffermask_rnheadproc_isundersi_headpte_l2_s_protoufs_roottcp_sysctlVOP_SETATTRusbreadpmap_kremovesigactsinitohci_pci_caem_ife_enable_dynamic_power_downusbd_set_reportexec_elf32_fixupradioopenem_write_ich8_datart_newaddrmsgvop_generic_lockcomconsiotuvmfault_anongetconsttyuvm_pagealloc_stratural_bbp_readusermountext2fs_dirrewrite__ucmpdi2vn_closefilepci_findvendorumass_discoip_mtudiscvfs_free_netcredpool_cache_do_invalidatemld6_start_listeningcpu_mainbus_cakue_matchpmap_kenter_papidhashtblaue_matchusbd_get_protocoltcp_drainem_write_ich8_bytepmap_l2dtable_ctorm_pullupbpendtsleepenterpgrpxscale_tlb_flushID_SEnull_zerokeycrypto_freesessionMPFailcnbellm_copydatainswm8wdc_atapi_timer_handlerumass_atapiscsi_devatu_stopcd_setchanuaudio_value2bsduvm_cnt_headmtx_leavefilt_signalsigactsfreert2560_free_rx_ringwdc_default_write_raw_multi_4uaudio_feature_namettymallocupl_attachums_intrbs_notimpl_bs_sm_4pcisubmatchkue_setmultimmioctldb_nextumass_matchsendsigohci_device_ctrl_methodsbpf_ifnameehci_allocmohci_cdural_ioctlvfs_busyfilt_ufsdetachlf_getlocksolistenpdc205xx_drv_probewskbd_compose_valuepciide_dmactl_readobio_bs_unmapiic_scanip_ecn_ingressmsdosfs_bmapfifo_bmaprip_ctloutputffs_vtblif_getgroupem_set_promiscuserconf_morekqueue_ioctlmax_processesem_free_pci_resourcessys_wait4rip6_recvspaceamap_share_protectusb_all_tasksfs_sysctlukbd_cnattachieee80211_ibss_mergeem_release_software_flagboot_filefilt_sordetachpsignalieee80211_regdomain_compare_cnconfig_pending_incrsys_osigaltstackusb_task_threadamap_pp_establishatu_activateuvm_anon_initffs_reclaimbmtphy_causb_free_devicexscale_cpufuncsif_link_state_changepmap_virtual_spacepage0_endusb_disconnect_portbpfpollnumemptybufsupdatepriohci_activateciphy_fixupbmtphy_serviceuhci_device_bulk_closeumidi_search_quirkulinear8_to_linear16_be_mtsuhid_cdwskbd_cnbellruntimeuhci_intr1pciide_print_channelsoutswwi_seekfilt_soreadpmap_remove_allrtable_addzeropageipsec_def_encpool_logsizebrgphy_bcm5401_dspcodesoftintr_establiship4_input6pdevinit__iordi3inetctlerrmapffs_specop_opv_descresetpriorityau_set_portrt2560_set_slottimeenoioctlwi_usb_start_threadsigacts_poolem_read_kmrn_regpcaled_matchexecsigsconfig_initcpufunc_null_fixupskip_fcicmp6_redirect_inputrw_enteraue_read_macpciaddr_print_devidmixer_ioctldb_access_abt_spscsistrategynd6_ra_inputffs1_blkprefin6addr_loopbackttypendin6addr_linklocal_allroutersqsphymatchin_revarpinputstrlcpyX_db_symbol_valuesieee80211_wep_cryptiopiic_attachehci_device_isoc_methodsumodem_setusbd_reload_device_descext2fs_advlockknote_fdclosevop_lease_descehci_device_intr_doneif_clone_detachpipe_rfiltopsubsa_openin6_cksumcomcninitpciide_print_modesstrncmpem_erase_ich8_4k_segmentvfs_opv_numopsdes1_decryptvfs_shutdowngetsockbs_notimpl_bs_c_4upl_startin_interfacessyn_cache_respondllinfo_nd6sbcheckreserveuvm_iopreemptbioattachieee80211_begin_scanunixdomaindb_next_free_breakpointuvm_tree_RB_REMOVEscsibusattachetheripstatumct_rtsaudiowritesyn_hash1ulminwihap_data_inputi80321intc_do_pendingdb_last_symtabproc0paddrrn_addmaskpciaddr_do_resource_reserveusb_attachbpf_bufsizeselscanpciide_promise_productssoo_poll_randseedumodem_activateulpt_attachrtafidx_maxsig_filtopsohci_device_bulk_transferukbd_cdricohrtc_getcalwskbdopenrt2661_eeprom_readem_startttclosurl_rxeofipsec_soft_allocations_bus_dmamem_mapnet_sysctlcom_cduaudio_identify_acxscale_cache_cleanD_Ewskbd_do_ioctldead_ioctlfill_eprocaue_initusb_match__wdccommand_startsysctl_iflistvwakeupcmd680_channel_mappci_subclass_bridgeif_clonerswdcbit_bucketvgonewdc_probe_capspmap_initializedtcp6_ctlinputdb_stack_trace_cmdusb_allocmemufsspec_closend6_prefix_offlinkuvm_anon_dropswapwi_detachucom_lockigmp_inputvop_ioctl_vp_offsetskmemusageswcr_sesnumlf_getblockpciide_irqackusbd_add_dev_eventumodem_attachtcp_rttdfltcleanerprocpdc202xx_pci_intrfifo_reclaimsbappendstreamrt2661_bbp_writem_tag_copy_chainem_write_kmrn_regusbd_intr_transfer_cbusb_event_threadsowrite_filtopsstrncpycseaddrevarp_in_progressdb_disasmsdreadicmp6errratelimsys_opipelinear16_to_ulinear8_leupdatefatsem_set_pci_express_master_disablecue_memata_perrorvfs_getvfsaue_txeofffs_sync_vnodeproc_stopvfs_vnode_printdb_history_lastusbd_set_port_featurebpfilter_createsysctl_locklockfpoolwihap_disassoc_reqaudioread_filtopscpu_switchtoieee80211_find_nodeucom_cahtonluvm_km_kmemallocusb_find_descin6_mask2lentcp_dooptionsdos2unixtimesys_sigactiondeupdatehci_ifcd__negdi2in6_purgeaddrcpu_modeluhci_softintrsii3114_read_regarm_dcache_align_maskuvm_tree_RB_FINDcttyreadcd9660_unlockpciide_dmactl_writeuserconf_cmdsural_taskiophy_statusschedclockbpfioctlconfig_attachohci_alloc_sitdcue_rx_list_initem_get_hw_eeprom_semaphorebmtphy_statustrr0_writedisk_unbusysysctl_fileugen_detachi80321_io_bs_freesoisconnectedurlphydebugamap_clean_worksuhci_alloc_std_chainusb_block_freememetherip_sysctlVOP_PATHCONFumass_fixup_sonydk_mountrootdb_run_modeauth_hash_key_md5siop_script_syncxscale_cpwaitvattr_nullsys_getsockoptrt2661_tx_mgtre_rxeofumct_paramuhidev_attachfrag6_nfragpacketsdb_linewildcardin6_restoremkludgeuvm_anon_lockloanpgvfs_sysctlcpu_get_controlite_chip_mapVOP_READLINKumass_cbi_methodsdb_ed_styleufs_seekmii_submatchuvmexp_printohci_root_intr_transfermsdosfs_pathconftimeout_wheelbpf_m_xhalfaverunnablecd9660_getattrttyfreettysleepehci_root_intr_doneatu_get_opmodeunp_disposerd_open_hookscsi_inquireufs_getattrBlowfish_encipherieee80211_mhz2ieeevfs_exportuplcom_closeuvm_km_pgremoveramdisk_ndevsex_region_plfscaleip_optcopyvfs_registerieee80211_proto_attachsys_dupulinear8_to_alawmcllowatmii_printbpfilterattachpci_find_deviceswcr_initenc_xform_skipjacktimeout_tododb_lccpu_read_cache_configumsm_detachwdc_sii3114_vtblpanicget_pc_str_offsetL_cksumdataciphy_resetural_rxeofcue_rxeofmsdosfs_lockseltruepci_subclass_systembpf_m_xwordsoftdep_initializencvhashtblunp_shutdownwi_resetext2fs_sysctlgeneric_bs_wm_4cluster_callbackkthread_run_deferred_queuevop_lock_vp_offsetswdreadlastdaycheck_execdb_max_linewi_usb_cdtcp_initpte_l2_s_cache_mode_ptdeferred_config_queueciphy_funcsucomreadcbem_wait_autonegipport_lastautouhci_endpdsis_setup_channelcd9660_fifoop_entriescom_raisedtruaudio_chan_opendb_last_commandicsphy_statuswinSlotCntvn_kqfilterem_validate_mdi_settingfiq_getregsext2fs_synci80321_io_bs_unmappte_l2_s_prot_maskcryptoreadpciide_intr_flagudav_ioctlcrypto_registercache_purgevfsem_led_offpostsigsys_pathconfcue_open_pipesin_addmultigetmicrotimebs_notimpl_bs_rm_8maxumass_clear_endpoint_stallohci_setup_isocaue_newbufscsi_probedevaxe_ax88178_initi80321_i2c_attachtcp_templatemsdosfs_readdb_object_print_cmdfintek_write_regohci_initcomopensata_setup_channelusbd_setup_xferieee80211_tree_RB_MINMAXpiix_chip_mapbcopyiic_attachwsmouseclosewdog_autourl_tick_taskcue_detachusbioctl_bus_dma_inrangekqueue_wakeupip6_unknown_opttcp_reasssys_getfhext2fs_vgetrt_timer_timerrtbl_id_maxcomcnputcKERNEL_BASE_physSHA1Update_intehci_alloc_sqtdcuio_applygeneric_bs_rr_1axe_resetdefrouter_addreqin6_clearscopefifo_vnodeop_entriesusbd_set_addressaudio_free_ringudav_openpipesffs_setblockipsec_expire_acquirekue_stopatu_send_commandinflateResetmemcmpwskbd_init_keymapobio_bs_subregionumct_dtrmsdosfs_createcd9660_startdb_output_linecomstartpool_allocator_kmemdb_examinecfroots_sizedb_end_linetickadjiq80321_irq_mapsiop_clearfifovop_rmdir_vp_offsetstisr_writesbreserveundefined_initvrecycleem_phy_hw_resetubsa_matchextent_printaudio_caieee80211_alloc_nodeblf_ecb_decryptcrcopydb_symformatem_read_eeprom_ich8ural_newstatewdcloseundefined_handlerssys_revokeural_free_rx_listip6_setpktoptionssysctl_stringsys_rebootpmap_dump_allbufpoolMCFailwdccommandext_bus_dmamap_load_buffercpu_forkumidi_activateaudioopenwi_write_data_iodb_print_ifattylistwdopenuvm_vslockre_initcast5_setkeydeflateReset__bin2bcdttyoutputkue_cacd9660_tstamp_conv17wskbd_calxtphy_statusuftdi_8u232am_getratetqphy_cdwdc_atapi_intr_completecryptodev_cbumodem_detachuhci_root_intr_abortrn_mkfreelistvop_bwrite_descVOP_READin6ifa_ifpforlinklocalufs_ioctlffs_freefilelastdtimesys_setuidiq80321_pci_init_wdc_ata_bio_startstart_updatesiop_common_attachudav_cdusbd_clear_port_featureufs_quota_free_blocks2re_stopsenditcluster_writernd_event_tailuriopolluvm_setpagesizeehci_root_intr_closetcp_xmit_timerucomwritein6_recoverscopeskipjack_encryptem_mng_host_if_writensphy_serviceaue_ticki80321intc_cdticksvwsata_write_regmclpool_warnmsgi80321intc_cadb_termrt2661_node_copyscsi_preventmmclosenumfreepagescd9660_accessffs_statfsuhci_shutdownrijndael_set_keywdcprobeiophy_cdudp_recvspacewdc_ioctl_strategyuaudio_cai80321_mainbus_matchbus_space_copy_1syn_cache_unreachuserconf_histszsys_getrlimiti80321_mainbus_foundbpf_attachdfintek_cdicmp6_ctloutputulpt_statussvwsata_dmactl_writeufs_dirremoveumct_setrgephy_servicecinitif_attachsetuppipe_writevop_symlink_desccryptof_pollin_pcblookup_listensbappendm_copybacknextgennumberuvm_swap_puticmpbmcastechofifo_advlockevcnt_attachSHA512_Updatedb_continue_cmdrt2661_mcu_beacon_expireehci_timeouturio_activateconfig_scanwi_get_nwkeypmap_copy_page_funcripsrciso_nchstatsem_update_eeprom_checksumkue_txeofugenkqfilterural_amrr_startscsidebug_targetsnlineswdb_restart_at_pcdb_sstep_printohci_rem_edether_ifattachusbd_devinfo_allocinflateSync__wdccommand_doneumass_adjust_transfersignal_initffs_updatedb_print_formatrt2560_tx_bcnbrgphy_bcm5750_dspcodeunix2dosfnspec_advlockmtdphy_cdfragtblraw_sendspaceubsa_cauvscom_breaknullopre_attachip6_ecn_ingressusb_discovercomdiagextralocunsleepwdprobeX_db_lookupmtdphy_funcsuipaq_seti80321intc_matchblf_encryptohci_alloc_std_chainipintrgetnanouptimeohci_pci_detachuhci_pci_detachudav_activatei80321_pci_attach_hookdes3_encryptmaxdmaprt2661_tx_dma_intrural_alloc_rx_listusb_block_allocmemmainbus_bs_w_1ext2fs_symlinkdb_skip_to_eolip6_savecontrolau_check_portspciide_chan_candisableq_to_bmountrootsyn_cache_resetdb_inputcharuhci_device_intr_doneuhidev_opendb_boot_cmdsundefined_entryprocess_read_fpregsip_initreaddeohci_freexural_txtimecd9660_rrip_getnameufs_check_exportdes_encryptsysctl_rdintpdc20268_setup_channelural_eeprom_readusscanner_detachlodirtypagesem_probeumct_get_statusfindwin95VOP_WRITEsys_nanosleepre_rx_list_initstart_init_execem_get_phy_cfg_doneatu_detachifa_ifwithaddrclock_ymdhms_to_secssiop_add_devuhci_root_intr_transferdb_write_cmdif_clone_attachuplcom_get_statussys_getfsstatohci_abort_xferbpfopencdstrategyem_config_collision_distnatsemi_irqackkmemstatsnd6_slowtimo_chenc_xform_nulluvm_km_valloc_aligndb_max_widthmntvnode_slockfilt_audiordetachulptwritecomwriteuvscom_intrVOP_RENAMEcdclosecast5_zerokeysys_fchdirsysctl_ifqalleventsrandompidwd_cdurl_initfilt_ttyrdetachrt2560_update_plcparp_inuseuhidwrite_bus_dmamap_destroyvn_polluhci_device_isoc_methodsinet6swrouteswdosdirtemplatemainbus_cddb_uvmexp_print_cmdre_ioctluaudio_query_encodingsys_mincorepdc203xx_setup_channelieee80211_tree_RB_REMOVEuaudio_add_processinglastsecondswdog_timeoutpci_probe_deviceuaudio_signextwsmousedoopenwi_get_txpowerural_plcp_signaludav_stopbrgphy_statususbd_error_strsusbd_sync_transferaudioactivateffs_vnodeop_entrieslun_switchamphymatchtcp_maxpersistidleudav_tx_list_initspec_ioctlufs_initsync_vnodeop_entriesproc_reparentrt2661_select_antennauvm_exitfc_bmapcallspr_rmpageffs_initcluster_wbuildsvwsata_dmacmd_writebootsyncuvm_initaue_attachieee80211_crypto_attachsys_ioctlsys_xfspioctlif_free_sadldb_dotucomstopieee80211_node_joinfilt_bpfrdetachumodem_openicmp6_initdisassemblebs_notimpl_bs_rm_1filt_ttywritepool_update_curpagesiop_script_readhid_end_parsein_setsockaddrcy82c693_readrandom_statebpf_moveiniq80321_hdlg_irq_mapostypevndbuf_poollastpiduplcom_resetuvm_page_physloadaudiogetinforeset_entryucomstartwdc_exec_xferwdcresetipintrqsensor_task_createohci_noopudsbr_statusmaxprocusb_frag_freelistip_slowtimordsizeuaudio_add_inputrijndaelKeySetupEncubsa_rtsip6_nexthdrrtdeletemsgumidi_cd__bss_startdcphy_cdpciide_via_productskue_rxeofsiop_attachrijndael128_encryptVOP_KQFILTERukphy_funcssys_msyncvop_rmdir_descdeflate_compresswskbdreadsbappendrecordevcount_detachsd_causcanner_seltrue_filtopsem_verify_write_ich8_byteixp_chip_mapsoftdep_fsync_mountdevinitmsgbufehci_device_bulk_startwsmouse_attachpciide_intel_productsuipaq_dtrconfig_activatememsetcuio_copydatapipe_free_kmemufs_getlbnsbrgphy_bcm5704_dspcodeohci_strphysioin6_selecthlimupl_sendwdattachdb_symbol_is_ambiguousmii_phy_delete_mediausbd_set_report_asynccrypto_kdispatchicmp_mtudisc_clonert2661_rf_write_spllowersodisconnectpool_allocator_oldnointrumct_closesys_setgroupsmainaue_csr_write_2lxtphy971_funcsthreads_pendingucomttyohci_device_bulk_doneusbd_initmtdphymatchuplcom_opensiop_lookup_productural_set_basicratesip_flushmidipollkue_startre_watchdogaudio_pollsiop_scsicmduvm_unmap_removepmap_alloc_l1svwsata_chip_mapi80321_mem_bs_unmapicmp_errorinpcb_pool_initalizeddb_hangmanukbd_delayed_decodebs_notimpl_bs_sm_1upl_rx_list_inituvm_swap_markbaddes_set_keykqueueopsaudio_pintvholdpciide_map_compat_intrubsa_parityurio_detachdb_help_cmdrt_if_removewdc_atapi_in_data_phaseusbd_no_quirkrt2560_ack_ratere_read_eepromsis_hostbr_matchuipaq_matchmidiopenm_adjalaw_to_ulinear8mld6_stop_listeninghotplugioctlsvwsata_read_regpmap_map_chunkppsratecheckscsi_free_xskmemlimitrt2560_rf_writetcr0_readamap_copyphysical_enduvm_rb_spaceuhci_allocmuhidpollieee80211_ieee2mhzieee80211_dup_bssi80321_io_bs_maplf_findoverlaplf_wakelockdb_sym_numargskue_attachhookdumpconfwi_rxeofehci_pci_detachskipjack_forwardsbrgphy_cahpt_pci_intrfilt_rndwdetachdead_badoppciide_dma_finishblf_cbc_decryptcalcrusys_unlinkdb_cmd_listmainbusmatchrt_setgateulpt_activatetcp_ack_on_pushpmap_growkernelext2fs_rmdirsysctl_intupl_tx_list_initkqueue_closestrlcatpte_l2_s_cache_modeifnet_addrssysctl_int_arrulinear8_to_mulawau_set_gainbs_notimpl_bs_wm_8cdce_matchumidi_quirklistsoftintr_dispatchdisk_unlockpciide_cypress_productsufs_ihashremcttywrite_bus_dmamap_createurl_stop_taskpciaddr_device_is_agpsdmatchusb_freememudav_txeofpool_chk_pageproc0cdce_initufs_renameaxe_cauaudio_chan_pintrext2gennumberudav_attachusbd_get_hid_descriptorrt_ifannouncemsgsoo_readpciide_vendorsufs_openpmap_modify_pvehci_pcd_enablei80321_intr_establishm_catsplxohci_pci_attachrtinittqphy_statuscluster_collectbufssiop_handle_qtag_rejectwi_write_data_usbumass_scsi_minphysuvm_swap_inituaudio_chan_alloc_buffersuaudio_add_featuretcp_nowttystatsaue_miibus_statchgdb_trace_until_matching_cmdproc_printitural_bbp_initdes1_setkeyunp_gcsys_clock_gettimeip6_hdrnestlimitcsefreepool_catchupxscale_cache_syncI_rngfrag6_initsiop_sdtr_negbuf_replacevnodemsdosfs_vnodeop_opv_desclba2msfiq80321_pci_intr_mapre_miibus_readregtimeout_setrdread__subdi3ntohsmsgbuf_putchar_bus_dmamem_freeinet_ntoadb_boot_poweroff_cmdsd_flushcd_setvolext2fs_mkdirohci_openext2fs_direntermii_pollstatrlphy_cawdgetdisklabelrw_exitpciide_machdep_compat_intr_disestablishdupfdopeni80321intc_calc_maskchange_sign16_beifmedia_list_addpidhashvfs_mountrootrt2661_updatestatsxscale_context_switchuvm_totalencdebugdb_unread_chartimeiic_searchstart_initelf32_olf_check_headeruhub_attachrt2661_prepare_beacontcp_mssdfltrt2661_alloc_rx_ringi80321_bs_unmapuvm_swap_freetcp_rndiss_sboxwdc_atapi_update_statusatu_newbufdata_abort_handlerbs_notimpl_bs_r_1axe_initrnd_wseldb_look_charuhidev_set_reportin_pcbdetachmsdosfs_vfsopsaue_ifmedia_updradiodetachcd_sizettycheckoutqrt2560_watchdogread_multi_1icmp6_mtudisc_callback_registerdb_set_variableuvscom_set_lineaue_carnd_event_spacepmap_clear_referencert_getmetricswdc_ata_bio_kill_xferin6_ifdetachdb_search_symbolcn_tabwdc_atapi_intr_commandip_forwardextent_createrdclosebpf_freeddisklistslinear16_to_alaw_leswap_bytes_change_sign16_besys_fstatfsurl_txeofkue_devsbs_notimpl_bs_sr_8m_injectem_mta_setudav_setmultiip6_mforwardingnd6_setdefaultifaceffs_isfreeblocki80321_mem_bs_freeuvm_map_lookup_entryhztoicsphymatchBlowfish_expandstatevop_pathconf_descbs_notimpl_bs_w_4m_pullup2dead_strategypciide_dmacmd_readswi_handlerspec_fsync__wdcwait_resetip6_optlenuvm_map_deallocateicmp_reflectmii_phy_activateext2fs_reclaimpciide_acer_productsffs_ballocsys_getgroupsurio_cdieee80211_node_attachuhub_cduvm_km_pages_freewi_start_usbgeneric_bs_wm_1ip6_raw_ctloutputkernel_textufs_startbrgphy_mii_phy_autoohci_devd__end__kinfo_vdebugnsphy_reseturl_sendcdce_encapuvm_rb_insertufs_bmaparrayfragtbl8i80321_mainbus_attachuvn_sync_locksysctl_initaes_ctr_setkeyumct_attachurl_resetwdc_get_logusb_needs_exploreufs_quota_alloc_blocks2fc_fileextendsfilt_sigattachre_startwsmouse_cdricohrtc_settimeVOP_FSYNCffs_sysctlipport_hilastautoarpinit_doneem_shutdownspec_closecd9660_closeem_initialize_receive_unitsys_shutdowncngetcehci_rem_qhsii_fixup_cachelinernd_statesm_gethdrem_dma_mallocugen_activateconfig_rootfoundcue_cdputcsiop_resetsii3114_mapreg_dmaricohrtc_attachsysctl_rdstruct__divsi3uhidev_cdumass_scsi_devwsmousereadem_config_fc_after_link_upxscale_minidata_clean_sizeschedcpui80321_gpio_pin_readrt2661_attachurlphy_servicesbappendcontrolem_get_cable_lengthukbd_set_ledswihap_sta_timeoutsiop_update_scntl3pciide_nvidia_productsugenread_intr_filtopssoftdep_flushfilesdb_access_und_spipv4_inputm_getclrpool_headwdc_atapi_send_cmdusbd_interface2device_handlepcaled_cdipforwardingdb_lexohci_device_isoc_transferusbd_open_pipe_ivalaudio_calc_blksizebufhashtblsyn_cache_lookuparc4random_stateprtactiveaudio_mmapksym_upcaseufs_makeinodeip6_process_hopoptsufsfifo_readusbd_find_edescfifo_writefilt_ttyreadsys_getpgiduhci_runcom_common_putccache_lookupaudio_clearem_get_auto_rd_donerdioctluhci_allocxin6_purgeifobsd_pci_mem_findrijndaelKeySetupDecdb_boot_crash_cmdurl_detachbs_notimpl_bs_rr_1umass_scsi_sense_cbrijndael_encryptricohrtc_clock_writein6_ifawithifpieee80211_recv_mgmtaxe_detachdumpsizepci_matchbyidukbd_keydesctabusscanner_devextent_freeuvm_aiodone_daemonusb_cookie_noi80321_gpio_pin_ctladdupc_tasksched_syncusbd_clear_hub_featuresc_err1db_mount_print_cmdcomcloseem_clear_vftaiopxs_mainbus_casetsigvecsys_sendmsgi80321_bs_barrieruhidopenvn_marktextiic_cdbrgphy_bcm5411_dspcodestrcmpsys_quotactluhidev_matchvop_close_vp_offsetsem_blink_led_startrndread_filtopstcp_mtudisc_increaseulmaxatu_txeofin6_pcbconnectdehashluphy_cakue_cdhook_disestablishexphy_funcsudsbr_setfreqbpf_catchpacketffs_isblockucomwritecbdb_stack_trace_printusbd_find_quirkuaudio_getuvm_aobj_poolhotplugcloseuscanner_do_readdb_show_frame_cmdsys_adjfreqpci_cadb_examine_cmdqsphy_funcsuvscom_seticmp6_reflectsetrunqueueudv_attachsettimecdce_rx_list_inituhub_intrarm_pcache_typertable_initata_set_modevop_access_descmii_phy_auto_timeoutsyn_cache_getnetisrdb_clear_breakpointsttyrubrevarpwhoamiieee80211_get_ratevop_generic_islockedauth_hash_hmac_sha2_256_96uaudio_match_altbufcachepercentm_pulldownacer_pci_intrpmap_initufs_rmdircryptodevkey_cbrlphymatchieee80211_next_scanminudsbr_startpmap_zero_page_funcarmv4_tlb_flushD_SEuhci_device_ctrl_abortip6_initconfig_detach_childrenrawcbpdc203xx_write_regukbd_cngetctcpcb_poolz_errmsgi80321_pci_make_tagBlowfish_stream2wordem_release_software_semaphoreuhidcloseipip_allowsys_pollalaw_to_slinear16_beuvm_map_clip_endufs_makedirentryem_write_eeprom_eewrusbd_set_configem_write_pci_cfgvnode_hold_listlastdosdateudav_unlock_miiuhci_add_bulkral_cdufs_linksys_mkfiforicohrtc_matchdb_cmd_searchifa_ifwithafural_read_eepromin6_leavegroupsqphy_caiminem_reset_hwsddumpsys_chflagsobio_bs_tagdelaysdstartdb_machine_command_tableskipjack_decryptddb_regsieee80211_media_initricohrtc_gettimeuvm_km_putpagecom_enable_debugportpage0_dataext2fs_vnodeop_pvn_isunderusbd_get_port_statusuvm_pageoutpffindtypepdevnamespci_subclass_dockuipaq_breakqsyncwi_setmultire_gmii_writeregfifo_opencd9660_vptofhwi_attachusb_camii_phy_downuvmspace_forkraw_initknote_enqueueswap_bytesums_accessopsudpcksumtcp_sendspaceurl_csr_write_4db_maxoffffs_oldfscompatrijndael_decryptwdcdetachmaxlocksperuidfilt_ugenrdetachin6_matchlensys_madviseupl_openpipesehci_device_ctrl_methodsrt2560_plcp_signalscsibusdetachdisk_attachwskbd_displayioctllm75probencpusdb_cmd_loop_donearptfreeubsa_detachipq_lockedfilt_ugenread_intrdb_show_arptabcom_detachfifo_vnodeop_pvop_write_descaxe_stopvop_read_vp_offsetsbs_notimpl_bs_w_2ural_set_macaddrdead_printem_enable_mng_pass_thrueephy_serviceinphy_servicemii_media_tableswap_bytes_mtswdstrategytcp_rndiss_encryptttyprintfi80321_pci_bus_maxdevssigcodedb_elf_search_symbolhpt_chip_mapipip_inputdb_delete_watchpointcomttybuf_undirtysysctl_tstringdb_watchpoints_insertedxscale_cache_cleanDusbd_start_nextfilt_ttywdetachuvm_tree_RB_INSERT_COLORpool_allocator_nointrvop_unlock_descsys_sysarchrt2560_disable_rf_tuneBlowfish_decipherbio_validateigmp_initmii_phy_add_mediaputphysbufcpu_reset_needs_v4_MMU_disablevop_remove_vp_offsetsMD5Initem_txeofpcaled_gpio_pin_writeqscryptodesc_poolbus_space_write_raw_multi_2cpu_info_storeffs_vfsopssysctl_mallocwihap_ioctlieee80211_outputusb_dev_openfrag6_slowtimouvm_map_hintwant_reschedpmap_bootstrap_pv_allocatorphtree_SPLAY_REMOVEmsdosfs_mkdirkthread_create_deferreduhci_free_sqhieee80211_ioctluhidevsubmatchboot_eaddrscsidebug_busesscsibusactivatend6_timertcp_do_ecncomcnpollcuaudio_bsd2valuevop_open_descatu_matchbioopenqsphy_servicere_fixup_rx__cmpdi2cd_patternsraw_detachaudiodetachpmap_get_pdeural_read_multibooted_kernelaudio_writemulaw_to_ulinear16_lebs_notimpl_bs_wr_1domainnamelenehci_pollacard_pci_intrpciattachusbd_get_report_descriptorip_rtaddrfiledesc_initrt2661_enable_mrrload_dsard_server_looptag_switchurl_ifmedia_statusatu_get_cmd_statuscue_csr_read_1vrelewi_set_pmohci_alloc_sedem_set_media_typeem_update_link_statusprtrealloccheck_consoleamap_freein6_domifattachwdc_atapi_reset_2ugen_get_alt_indexswreadusb_blk_nfreend6_prefix_lookuprt2661_mcu_cmd_intruhci_device_ctrl_methodscddonesync_inactivespec_printlocleanpagesarc4_stirext2fs_lookupmsdosfs_openehci_hubdext2fs_linkcpu_switchvop_generic_revokeohci_hash_add_itdfifo_printusbd_get_bufferieee80211_add_erpieee80211_decapfilt_sigdetachtcp_do_sackradioprintext2fs_renameipsec_def_authmii_activateuhci_add_loopusbd_setup_isoc_xferttywflushcd9660_rrip_offseturl_startumidi_hw_ifwskbd_default_keyrepeat_datacomcnmodeclosefvop_rename_desccomioctlumass_cbi_resetsoftdep_sync_metadataif_clone_lookupgetmicrouptimemii_tickip6_dad_countem_pci_clear_mwiatu_complete_attachumct_breakuvm_pager_dropclusterfilt_generic_detachuvscom_rtssensor_task_unregisterehci_intrlist_timeoutpool_print1db_breakpoint_listcd_get_parmspmap_extractnd6_ifptomacwsmousedoioctlamap_unaddural_watchdogbooted_devicecd9660_printohci_rhsc_enableif_congestionnfilescd9660_islocked__bcd2binuscannerreadatapi_printin6if_do_daduhci_root_ctrl_transferrevarpwhoarewecue_txeofatu_rxeofaue_detachcryptodev_keyieee80211_iserp_stapipe_kqfilternforce_pci_intrext2fs_openpmap_devmap_find_pausb_insert_transferaxe_matchmsdosfs_vnodeop_entriesukbd_keymapdatamulaw_to_slinear8stopprofclockdb_hangnullioctlukbd_is_consolecertance_irq_mapcryptof_closepte_l2_l_cache_modeisohashparsediskumidi_print_quirkre_eeprom_getwordalaw_to_slinear8wi_set_debugbreadem_intramap_lookupem_fixup_rxipctl_varsapollo_setup_channeluaudio_chan_rintrpmap_page_removert_timer_remove_allwskbddevprintuhid_intrpcaled_gpio_pin_readwdc_output_bytesatu_ioctludsbr_matchieee80211_media_statusiophy_caem_read_reg_iopmap_set_pt_cache_modemichael_keytcp_usrreqdb_playssd_interpret_senseudp_usrreqifmedia_initext2fs_vfsopsext2fs_inactivedead_bmapdb_guessesif_getgroupmembersdb_show_all_poolssoo_kqfilteruaudio_add_processing_updownfifo_pathconfcpu_startupamap_refehci_device_bulk_transferuhci_device_isoc_transferfilt_fifordetachdb_command_loopwdc_ioctlamphyattachfilt_fiforeadrt2661_updateslotfdexpandtickssrandomwdc_ata_presentpdc20262_dma_finishmsdosfs_closehotplugreadext2fs_setattrsysctl_clockratevn_rdwrohci_close_pipend6_need_cacheip6intruftdi_activateurl_setmultiusbd_get_device_descre_setmultiwdc_default_write_raw_multi_2uvm_pagedeactivateuscanner_attachvop_write_vp_offsetscy82c693_initufs_unlockmainbus_bs_r_2tcp_ctloutputrt2661_plcp_signalmono_timeukphy_statusMD5Updateblktochrvop_create_descifmedia_setem_setup_interfacebio_lookuppmap_createuvm_map_extractnd6_prelist_addufs_removeboottimecd9660_readlinkxscale_cpu_sleepVOP_ADVLOCKdb_watchpoint_cmdwdc_atapi_intraxe_watchdogfrag6_inputuhci_device_intr_closeunpst_sendspaceieee80211_add_ratestcp_rscalettwakeupuvmspace_freeext2fs_inode_poolswbufffs_ino_poolcryptopollpmap_pageidlezeromulaw_to_ulinear16_bemii_phy_statusmsgpdc203xx_irqackcpufunc_domainsVOP_PRINTfdsharepci_subclass_memorybuficmpv6ctl_varsfintek_matchcdstartfilt_generic_readwriteuserconf_disableumct_methodsspechash_slockusb_detachipforward_rtuhci_device_intr_startdb_elf_forallohci_device_isoc_closeuplcom_attachurl_int_miibus_writereguhidev_activateuvisor_cddb_set_temp_breakpointdb_buf_print_cmdsys_nosysat_pollallproccdevswxscale_cache_flushDumodem_get_statusuaudio_process_assys_mlockallwskbdcloseuvm_sysctluscanner_cdgetsn_bus_dmamem_unmapdisksortsys_fchflagsnamei_poolrt_timer_countvfs_buf_printuhci_device_intr_transferusscanner_scsipi_cmdpowerhook_disestablishcryptodev_opfilt_audiowriteukphymatchuvm_pager_putohci_device_bulk_abortudav_caip6_ecn_egressin_canforwardohci_device_intr_abortieee80211_tree_RB_INSERTpmap_destroyscsi_mode_selectkernel_pt_listpowerhook_listetherbroadcastaddrieee80211_rssadapt_updatestatssii3114_chip_mapvfs_getnewfsidaue_rxeofem_cducom_attachudp6_ctlinputitimerroundarm32_vector_initwdog_shutdownscsi_print_sensewskbd_update_layoutwdc_cdmmopenffs_inode_freeSHA384_Update_intohci_device_intr_transferamphy_statusukbd_intrrtioctlkue_ctlieee80211_tree_RB_INSERT_COLORprofprocswdc_free_xferip6_inputicsphy_cdwi_usb_cmdresppagemovegeneric_armv4_bs_rm_2route_srcspeedup_synceraudio_blk_msigmp_sendpktloop_clone_destroywdc_ata_bio_doneifmedia_baudrate_descriptionsv_putcm_getptrukbd_caem_kumeran_lock_loss_workarounduhid_activateufsvnode_filtopsreadbuffersuvm_fault_unwireuserconf_common_attr_valuhci_add_ls_ctrlobsd_pci_io_findumidi_detachext2fs_vnodeop_entriessys_getitimerhid_get_datadonicewdcstartetherip_inputcpu_configureip6_freemoptionssqphy_funcsieee80211_amrr_chooseaudio_alloc_ringieee80211_end_scancdce_txeofpool_page_alloc_oldnointrpmap_fault_fixupdcphy_servicern_refinesgeneric_bs_rm_4hmac_opad_buffersockargshpt_setup_channelvop_generic_abortopsetregsupl_rxeofusbread_filtopssobindvmcmd_map_zerodb_read_charvfsinituvisor_closeupl_caubsa_paramcnclosedb_tok_numbersddonetcp_do_rfc1323ip_fragsfilt_fifowdetachwdc_dmawaitmii_phy_setmedialo0ifphostidpool_chkaudio_ioctlwi_alloc_nicmem_usbusbd_free_bufferuvm_pagermapoutipqmaxlenext2fs_vptofhip_maxqueuesysctl_ttyieee80211_chan2ieeeuhub_cain_socktrimext2fs_dinode_poolieee80211_node_cmprtallocsys_mprotectmsdosfs_reallocblksvop_readlink_vp_offsetsuhci_alloc_sqhdequeue_randomnessurioioctlrt2560_alloc_tx_ringcue_casyncer_maxdelaydeadprocstart_reaperehci_root_ctrl_methodsuvmspace_unsharesys_fcntlnforce_setup_channelvfs_free_addrlistsys_setrlimitsys_sigpendingloop_clone_createem_hash_mc_addri80321_timer_initeduvm_map_cleanicmp_redirtimeoutulinear8_to_linear16_lettyclosewdrestarttrr0_readdisk_resetstatugen_isoc_rintricmp6_nodeinfocomp_algo_deflatemaxvfsconftimeout_addcpu_cdip6_forwarddb_fncallnumcacheobio_bs_freecmd0643_9_setup_channelural_write_multicpu_initclockscue_sendwskbdioctlmii_downrn_mpath_hashkinfo_vgetfailedbrelseprobe_addrsext2fs_unmountpsratiosdminphysohci_device_isoc_methodswi_usb_tx_lock_tryaxe_unlock_miiaudiokqfilterttyoutdevice_lookupuvm_map_pehci_device_requestDebuggerwi_usb_txeofudsbr_stopcdminphysnumcleanpagesschedhzurlphy_caem_allocate_pci_resourcesi80321intc_write_steerrip6_inputre_setpromiscuvm_tree_RB_MINMAXtcp_totbackoffuserconf_baseSHA256_Initpci_subclass_displaylooutputtasklistcue_setmultirijndael128_zerokeysoisdisconnectedcpu_coredumpxscale_cache_clean_addrrevbitssvwsata_drv_probedvd_read_disckeypmap_clean_pageuvm_aio_aiodonecrp_req_queuepmap_clearbitcrypto_freereqclrbitsdb_boot_dump_cmdxscale_cache_clean_minidataieee80211_proto_detachmii_phy_statusuvscom_matchcommajorscsidebug_levelcrypto_newsessionem_mng_enable_host_ifgeneric_armv4_bs_r_2socloseinstall_coproc_handler_staticwakeup_nsys_connectbuf_daemonuaudio_get_minmax_ratesskpcrd_sleep_priluphy_funcsdb_leohci_root_ctrl_transferrt2661_get_rtsipv6ctl_varsroute6_inputbs_notimpl_bs_w_8vop_read_descswitch_exitboard_startupcluster_newbufsys_socketpaircnreadpcimatchcertancepci_addr_fixupudp6_sendspacedounmountuvm_swap_allockthread_create_nowalaw_to_ulinear16_betcp_ackdrop_ppslim_countdb_elf_line_at_pcarm_picache_sizepool_cache_destroyttspeedtabulinear8_to_linear16_le_mtsns_scx200_setup_channelkqueue_readcd9660_mountuserconf_maxdevre_pci_attachcue_initfork_tfmratesiop_del_devacard_setup_channellxtphymatchusscanner_sensei80321_bs_initpv_sizewskbd_activatewi_media_statusurl_miibus_statchgnd6_purgedb_mult_exprtcp_keepidleif_attachheadnextcdb_listbreak_cmdwi_scan_timeoutiszerodevuhci_devdciphy_causcanner_matchem_read_ich8_wordupl_inputauth_hash_hmac_ripemd_160_96vop_advlock_vp_offsetsumass_caem_hardware_initgeneric_bs_sr_4lf_freesys_fhstatnullmodemohci_hash_find_itdwihap_sta_deauthif_attachdomain1ieee80211_amrr_node_initraw_recvspacediskerrwi_startcd_cddb_machine_commands_installieee80211_state_namesys_preadem_media_statusehci_root_intr_abortkernel_pt_lookupkmem_mapcd9660_check_exportconfig_pending_decrqsphyattachaxe_startsoqinsquediskstatsums_detachcdce_attachavail_enddes_ecb_encryptudp_inputnchrtoblktblbooted_partitionihashrn_search_mresettodrpcaled_attachufs_readdirgeneric_softclocksys_flockarc4random_initializediq80321_startpvwi_usb_do_transmit_syncspec_badopmsdosfs_linkbs_notimpl_bs_c_1ohci_root_intr_methodsicmpctl_varsigmpstatradioioctlmichael_finalvn_initialize_syncerdxscale_controlcd9660_quotactlicmp_senduhci_root_ctrl_donesiop_morecbdcy693_chip_mapcdce_watchdogvop_bwrite_vp_offsetssiop_ppr_negwdc_ata_errtime_uptimefilt_uhidreadsowakeupinsidebs_notimpl_bs_r_4db_putstringprefetch_abort_entrysigactsunsharetimeout_hardclock_updaterdattach_edataupl_detachrijndael128_decryptttkqfilteri80321_pci_conf_writem_tag_deletecd9660_ihashremip_fragmentusbd_endpoint_countsys_statfsSHA1Finaluaudio_attachrawin6pcbtablepmap_protectpool_cache_invalidateslinear8_to_alawkprintfdevice_unrefulpt_matchrc4_keysetupdcphy_matchscsi_startin_cksumvnode_poolrt2661_rx_intrdeflateInit2vnode_free_listtcp_savetiuvm_pagereallociicprobeinitrt2661_stopiic_ignore_addruvm_fault_unwire_lockedklist_invalidateuvm_km_createthreadaudioprintpool_printitubsa_flow_endpciide_attachdes_check_keysogetopthid_report_sizearc4maybeinitricohrtc_cdmidiwritedb_deletewatch_cmdarp_intimerpollscandomaininitsii3112_setup_channelvflushbuftime_secondacer_chip_mapip6_forward_rtusbd_get_interfacewskbd_get_mapentryusbd_read_report_descsbcreatecontrolsys_mlockhotplug_device_detachuaudio_add_altbioioctldvd_read_structvdevgonehtonsehci_pci_attachubsa_setdb_show_callout_bucketkqueue_writesys_syncbucketieee80211_reset_scanaudio_selwakeupcominitmb_mapenodevobio_bs_barrierffs_mountfsudsbr_reqin_delayed_cksumslinear16_to_alaw_bein6_is_addr_deprecatedfintek_fullspeedi80321_mem_bs_allocicmperrppslim_lastrtstatttvtimeoutatu_startabtstackspeclisthbdwriteversion_to_spcVOP_INACTIVEpte_l1_c_prototcp_syn_cachehaltpciide_sis_productseephy_cainphy_cawihap_sta_is_assockputcharums_ioctlbootargssys_getsiddb_trace_until_call_cmdRMD160Initwi_write_record_usbcue_csr_read_2uhci_device_setintrfileheadrc4_cryptusbd_alloc_xfernextvnodeidcttypollural_startsys_swapctlbd_reqwskbd_set_mixervolumebs_notimpl_bs_rm_2in_selectsrcmsgscpu_exitbpfilter_destroyunp_attachohci_device_isoc_starttcp_syn_bucket_limitsys_renamernd_rselusbd_nbusesfrag6_nfragsip6_log_timeem_deviceseephy_statusinphy_statusrtalloc_mpathsii3114_chansetupxscale_cache_purgeDuaudio_match_alt_chandisasmufs_ihashinitunp_deferuvm_km_valloc_waitsys_sigreturnsbflushehci_device_intr_transferipsec_require_pfsswapdevsiop_devwd_cakue_sendsysctl_intrcntaxe_tick_taskvn_readbwriteleavepgrpqsphy_cdarmv4_tlb_flushDkernel_pt_tablepmap_get_pde_pteuvmpageropsuvm_page_initohci_root_intr_closeem_write_vftastatminehci_root_ctrl_closewihap_sta_allocem_fill_descriptorscast5_decryptxscale_setuprt2661_set_bssidpcaled_gpio_pin_ctltcp_timer_funcsipqent_poolbufq_default_addif_attachdomainubsa_requesticmp_ratelimitinvalhashieee80211_rssadapt_raise_rateuhci_rem_loopuvm_km_page_initrttimer_poolieee80211_regdomain2flagrt2560_rxratergephy_load_dspcodeusbd_get_config_descem_read_ich8_datasosenddosetrlimitrn_initcmd_channel_mapbufq_default_getloopattachusb_match_devicesiop_update_residuscanner_detachural_rxratewdc_input_bytesRMD160Finaldb_listwatch_cmdrt2661_set_slottimeusbd_do_request_flags_pipeprocess_read_regschainlengthwdc_pdc203xx_vtblural_disable_rf_tuneau_get_gainrn_lookuppciide_ati_productsuvm_map_reserveuaudio_find_ifaceuserconf_show_attrsys_execveite_setup_channelamd756_chip_mapfdallocuaudio_match_alt_subrt2661_alloc_tx_ringscsi_donechkvnlockhw_sysctlrt2560_newstatedb_siftinguhci_device_bulk_abortdb_look_tokenpmap_alloc_l2_buckettcp_syn_cache_limitconsintrnumvnodescryptof_ioctlcomreadurioopenuvm_pagefreeehci_device_isoc_abortukbd_decodeext2fs_inode_allocswcr_encdecdb_examine_formatin6_pcbbindcluster_rbuildreapercoredumpfilt_kqueueugen_cdmalloc_rounduppipe_readaudiostartpuhci_root_intr_closeifioctlsys_utimesdb_symformatsusbd_do_requestnd6_storelladdrrip_initsocreateobio_searchusbd_find_idescpmap_cache_stateureadcatu_get_dfu_stateaue_startufs_setattrrijndael128_setkeyieee80211com_headlogprimemhookdoclusterreadcast5_encryptsys_exitsbtryusb_desc_iter_nextuvisor_matchm_applyswcr_processcryptof_writeudav_startaxe_lock_miirt2560_detachwdc_exec_commanddb_watchpoint_listwdcintrusb_seleventcd_playsys_clock_getresaxe_attachsyn_cache_insertspec_bmapttystats_initpciprintpci_mapreg_probemidiprobeem_allocate_receive_structuresncvhashpool_cache_destruct_objectucom_matchnd6_umaxtriesohci_device_intr_donedcphy_resetuaudio_merge_terminal_listi80321intc_read_intsrcnd6_debugmainbus_bs_r_4umodem_cawindow_deflatedb_delete_temp_breakpointehci_root_ctrl_transfercpu_cpuspeedpciide_cmd_productscpufunc_idget_random_bytesurl_csr_write_1SHA1Transformesymfiqhandler_stackcrypto_invokeosreleaseubsa_breaki80321_io_bs_initVOP_RECLAIMucom_cdusscanner_donesiop_update_xfer_mode__modsi3tcpqe_poolpgrp0mainbussearchurl_watchdoguvisor_initwihap_timeoutuserconf_changemakefstypedb_paniccddkdriveruvm_anon_adduaudio_closeuserconf_helpufs_advlockicmp_initsii3112_chip_mapuvm_growcsecreatevfinddevE_ldsa_abs_reselected_Usedif_detached_initral_pci_attachpciide_unmap_compat_intrdopowerhooksehci_device_bulk_methodsether_delmultivfs_op_initdb_history_currmainbusattachrn_mpath_initheaduvscom_paramexec_sigcode_mapsys_gettimeofdayipsec_soft_timeoutwdccommandshortieee80211_rate2mediavcleanuhci_device_bulk_doneiophy_servicecd_getvolsplassert_ctlwdc_atapi_startsys_getresuidsys_fhopendos2unixfnpciaddr_do_resource_allocatescsibussubmatchrtentry_pooluaudio_cduvm_km_pgremove_intrsafeext2fs_sbupdatedefrtrlist_delsys_fchmodvop_strategy_descudsbr_caatu_watchdoguvm_unmap_detachvop_islocked_descehci_add_qhupl_inituserconf_common_devvfs_mount_printuscanner_do_writestartusbd_devinfosiop_wdtr_negvn_isdisksys_selectbadaddr_read_1vnode_free_list_slockcryptoattachzombprocdb_branch_takenlogreadumsm_cdrn_mpath_capabledead_lockieee80211_name2regdomaintcp_issphysical_freestartfc_largedistancesys_setitimerisofntransurl_attachnd_prefixext2fs_specop_pvfs_unregisterselwakeupem_update_adaptiveumct_set_baudrateffs_reloaddb_set_watchpointsem_initialize_transmit_unituaudio_ctl_setmidi_out_docnwritert2661_reset_tx_ringumass_bbb_get_max_lundb_show_panic_cmdehci_device_bulk_doneuipc_usrreqnd6_na_inputdb_next_free_watchpointvflush_vnodefilt_rndrdetachmulaw_to_slinear16_lewsmouse_activatescsi_scsi_cmdem_media_changerip6_usrreqin6mask96colddb_clear_watchpointsunp_scansbappendaddrehci_powerbpf_maxbufsizeextract_entropyufs_islockedusb_detach_wakeupffs_unmountfifo_inactivesys_pwriteisohashtblwihap_shutdownuvmspace_allocrevarpinputcd_pausehashinitttstartumass_setup_transferrd_ioctl_kallocciphy_statuswdwriteipsec_keep_invalidpciide_channel_dma_setupuao_detach_lockedpci_devinfoumct_set_lcrrt2661_newstatesdopentcp_tracemii_phy_resetip_getmoptionsmidi_attach_miuhci_hubd_piixin6mask32__moddi3disk_countohci_confdpmap_page_protectdead_openkue_setworddb_list_watchpointsatapiscsi_matchtmr0_writeuserconf_attrwdc_kill_pendingem_commit_shadow_ramrt2661_powerbmtphymatchicmp6_redirect_outputroute_cbvop_revoke_vp_offsetsva_nullexphy_cdreadeplxtphy_resettcp_slowtimoamphy_cdcd_play_msfpmap_remove_pvtcp_newtcpcbsys_fhstatfself32_load_filesys_getpeernamert2560_prio_intrem_write_ich8_wordumidi_attachi80321_bs_subregionchange_sign16_be_mtsem_write_eeprom_ich8ehci_device_intr_closeehci_intrdb_taken_bkptdb_eqnamescsi_strvisbpfwritedoingcachesys_getrusagepdc205xx_do_resetmainbus_bs_mapaue_reset_pegasus_IIcryptoioctlnd6_prunert2560_set_chancomconscflagm_getffs_truncateuhidevprintmii_attachuvscom_cattylclosecmd680_chip_mapmd_diskconfwdc_svwsata_vtblpool_allocator_allocwdc_default_read_regin6_ifremloopchar_typeohci_free_sitdusbctlprintvn_closeuftdi_readudav_csr_writeuhid_do_readin6_createmkludgedoclusterwriteusbd_close_pipeffs_writebremfreefilt_sowdetachnd6_initip6_maxfragslimfreedb_show_regsuhci_reset__wdccommand_intretherip_outputrt2661_startaes_ctr_zerokeyuvm_km_free_wakeuprootvnodeehci_initifmedia_ioctlpmap_pmap_ctoricmperrpps_countuserconf_modify__one_cmpldi2wi_usb_rxeofcpufunc_nullopcd9660_ihashgetumct_camii_phy_detachatu_media_change__muldi3mbtypesumct_cddb_qualify_ambiguous_namesuhidev_caurl_lock_miiiq80321_pci_intr_evcntip_mtudisc_timeoutvfs_opv_init_defaultrandomopenin6addr_linklocal_allnodesamphy_cabufinitinswubsa_closebootconfigscsi_quirk_patternsuserconf_linesuaudio_ctl_getdeflateInitlimit0brgphy_load_dspcodeciphymatchE_abs_targ0_Useduniqdosnamedb_recoverudsbr_activateusb_async_procext2fs_mknodvttoif_tabdb_delete_cmdbgetvppgrp_poolucomstartreaducred_poolxscale_cache_purgeD_rngdes3_setkeyarp_maxtriessensors_listpmap_uareacd9660_bmapaue_eeprom_getwordrt2661_initdcphy_funcscom_obio_attachufs_dirbadentrylogioctlicsphy_funcsubsa_databitsgeneric_bs_wr_1_bus_dmamap_load_uiostrlenrt2661_intrdb_machine_initvop_abortop_vp_offsetsuhci_cdfifo_kqfiltermidiattachkue_activatepool_page_freewsmouse_inputwdactivatecopystrwdc_do_resetwdog_ctl_cb_argsys_pipert2661_free_tx_ringural_setup_tx_descusb_detach_waitarm_pdcache_waysarp_rtrequesthw_vendorxscale_setup_minidataext2fs_reload_vnodeelf32_check_brandwi_cor_resetudp_initproc_trampolinesys_rmdirem_attachcd9660_vfsopsem_get_bus_infoinflateInitallocbufsocantsendmoreproc_zapvop_revoke_descusb_rem_taskpte_l2_l_cache_masksiop_sdtr_msgcdactivateether_inputuvm_vsunlocklockstatus_splraisequotaoffarpioctlffs_fifoop_pfs_posix_sysctlaudio_init_ringbufferulinear8_to_linear16_beif_slowtimouhci_root_ctrl_abortwd_shutdownudbtabledb_load_countwi_setdefwdcattachchange_sign16_le_mtsufs_printem_rar_setfatentrywi_update_statssiop_startusbd_printBCDntp_tick_accsys_statrt2661_txtimein_baddynamichotplugopenlineswmsdosfs_symlinksys_symlinkicmp6_sysctlclfreeconfig_found_smem_check_phy_reset_blockalaw_to_slinear16_leuhidread_filtopsusbd_interface2endpoint_descriptorfdreleasedb_line_at_pcehci_disownuvm_swapout_threadsural_bbp_writeknote_attachmax_keylenbus_space_copy_4__assertif_congestion_cleardb_put_valuein6_prefixlen2maskem_ich8_cycle_initudp6_outputcn_devvpcom_activatewi_get_debugmaxfilesuvm_pageactivatein6_addr2scopeidip6_sourcecheckvop_access_vp_offsets_bus_dmamap_load_rawffs_mountrootrd_cduplcom_paramuvm_map_pageable_alldofilewriteehci_device_isoc_closeipquscanner_camsdosfs_strategytimeout_delem_ioctlural_media_changeuhci_alloc_stdrt2661_load_microcodeieee80211_chan2modeif_delgroupspec_strategyiic_cauvm_pglistfreemidiioctlusbopenums_attachext2fs_readsoo_statwskbd_cnpollckue_newbufdisk_detachrusage_poolstrchrubsa_methodshid_clear_localscsi_sizergephy_capci_mapreg_infomainbus_bs_barrierrt2661_free_rx_ringuvscom_cddb_deletegenericconfget_bootconf_optioncrypto_driversiftovt_tabsysctl_int_lowertcp_backoffmainbus_bs_w_2sys_chrootehci_odevdwdc_ioctl_freeubsa_cdavail_startieee80211_rssadapt_lower_rateumodem_dtrehci_device_clear_toggleuhci_portreseticmp6_redirtimeoutenc_xform_dessoisconnectingmtx_init1pci_subclass_processorvop_link_descaobj_pageruvm_tree_RB_REMOVE_COLORgeneric_armv4_bs_w_2MD5Transformumidi_matchmld6_inputgeneric_armv4_bs_sr_2vop_link_vp_offsetsrgephy_mii_phy_autobpf_d_listuhci_root_intr_donesyn_cache_cleanupip_pcboptsfc_purgemidi_ca__data_startem_detect_gig_phyifmedia_delete_instanceE_ldsa_abs_data_Usedurl_caucom_breakpdc205xx_pci_intrem_duplex_reversaludav_miibus_writeregacphymatchicmp6statdb_single_stepgeneric_bs_w_4inflateEndwsevent_pollmap_backmergeieee80211_pwrsavesys_profilvmcmd_map_pagedvnciphy_servicein6_pcbhashlookupbpf_detachdVOP_UNLOCKehci_root_ctrl_abortsyn_cache_initieee80211_find_txnodevop_readdir_vp_offsetscd9660_wchar2charip_ecn_egressether_ipmulticast_maxuvm_init_limitsukphy_cdsii3114_dmacmd_writein_pcbconnectem_free_transmit_structurespciide_dmacmd_writeokaytocloneVOP_POLLVOP_IOCTLstatvarsafepriaudio_init_playsys_rforkluphy_cdwdc_default_read_raw_multi_4uao_swap_offmachinewi_cmd_ioVOP_CLOSEuvm_anallocin_pcbdisconnectradioprobeuvm_vnp_terminatepool_cache_putwi_usb_rxfrmz_allocsensor_task_threadsys_getpidnd6_defifindexipmultipathunp_dropuvm_map_advicetcp_mtudisctimeout_startupcue_matchfintek_read_regrn_addroutetrr1_writesdactivateem_cleanup_leddb_print_sadb_elf_sym_numargsural_detachdb_trapperradiocloseukbd_cnpollcshmsegdvd_read_manufactundstackconfig_activate_childrenem_allocate_transmit_structuresnforce_chip_mapmulaw_to_slinear16_be_mtsem_mc_addr_list_updatekrp_req_queueremrunqueueatu_initial_configsoo_closesiop_handle_resetumodem_rtstcp_recvspaceuvm_meterumodem_intruhidev_maxrepidsubnetsarelocalpmap_needs_pte_synctcp_ackdrop_ppslimuhci_ifcdsii3114_write_reglinear8_to_linear16_le_mtsehci_device_ctrl_donend6_lookupieee80211_cache_sizepager_map_wantedurl_openpipesukbd_countrylayoutsys_getppidmii_anarVOP_READDIRdomainsem_led_onsys___sysctlaudio_calcwaterarm32_dma_range_intersectin4_cksumextent_alloc_subregionuscannerwritedb_putcharrt2661_node_allocneedbufferusscanner_cmd_cbusbd_do_request_asyncin6_ifattachtcp_rst_ppslim_lasticsphy_cabs_notimpl_bs_rr_4uvm_rb_removeohci_root_intr_doneiq80321_thecus_irq_mapip6_multipathtickfixusbd_get_device_descriptorcd9660_initumass_fixup_yedataiicprobemichael_initipsec_soft_bytesnselcollemul_elf32usbd_open_pipenumdirtypagesm_tag_unlinkohci_softintrbufhashmulaw_to_ulinear8msdosfs_lookupspec_pathconfmountroothook_listrt2560_powerhook_establishtcptv_keep_initsys_chdirdb_unread_tokenext2fs_diremptyuserconf_cntdcphy_caE_abs_msgin_Useduvscom_methodsem_config_dsp_after_link_changeext2fs_inode_freedb_find_variablexscale_cache_clean_sizeucom_activateip6_rr_prunesbcompressiic_smbus_receive_bytemsf2lbapmap_free_l1nd6_outputrijndael_set_key_enc_onlycdevsw_lookuplogsoftcsys_adjtimeohci_device_clear_togglevop_kqfilter_vp_offsetswdstartamap_splitrefspec_open_clonewskbd_do_opencryptof_kqfilternclruheadural_next_scani80321intc_inituvm_aio_biodonern_initheadusbd_get_descvop_generic_unlockuvmspace_sharert_timer_addpci_get_capabilityieee80211_print_essidroute_usrreqdeextendem_receive_checksumtcp_dropicmpstatcom_irq_overrideudpctl_varsm_prependvop_advlock_desccd9660_pathconfin_pcbrehashre_tickre_resetin_arpinputehci_root_intr_transferufs_accessin6_embedscopeif_alloc_sadlem_arc_subsystem_validunix2winfnreassignbufuhci_confdsiop_minphysip_freemoptionsnetconums_matchsohasoutofbandspec_vnoperatevop_ioctl_descddb_initieee80211_release_nodebs_notimpl_bs_c_2nd6_dad_duplicatedfifo_vnodeop_opv_desc_bus_dmamap_unloadieee80211_free_allnodesmsdosfs_fhtovpbs_notimpl_bs_wr_4ether_crc32_besiop_setuptablesieee80211_add_ssidcpu_reset_addressuaudio_get_clusterpgfindvop_lock_descatu_rx_list_initobio_attachsoftint_pendingtcp_ackdrop_ppslim_lastrqinitloadfirmwareuaudio_chan_free_buffersswcr_compdeccd9660_ihash_slockral_pci_devicesip4_inputtcp_inputsysctl_dumpentrydkcksumnd6_gctimerurl_csr_write_2cd_switchiptimerip_inputaudiowrite_filtopswi_set_txpowernd6_setmtuaxe_ifmedia_updwdc_ata_ctrl_intrdb_last_non_spacemii_detachusbd_get_endpoint_descriptorudp_ctlinputudav_rx_list_initpool_sethardlimitpci_subclass_prehistoricip_freefdb_show_cmdswdc_default_write_regrlphy_statusudbhashsizeicmp6_mtudisc_updatesun_nonamekmeminitnd6_ns_inputdeflateEnddevice_refehci_device_ctrl_abortrd_root_imageffs_syncuvm_map_submapcnioctlrt2560_startufs_vinitehci_noopem_set_d3_lplu_stateuaudio_devicepool_primepgrphashtblcomconsinitsddkdriversys_getpeereidifmedia_matchstatclocksiop_ppr_msgaue_activategetnewbufrt2560_tx_mgtwi_read_data_usbdvd_read_physicalrw_enter_writeuvm_mlk_hintuserconf_argbufatu_media_statusuaudio_chan_closeMD5Update_intm_tag_copyehci_idonesiop_pci_attach_commonpci_io_finddb_value_of_namepmap_l2ptp_ctordata_abort_entryhid_get_itemmsdosfs_getattrdb_find_breakpointm_devgetntp_tick_permanentwritedisklabelmsdosfs_printkernel_pmap_storeem_write_eepromstartprofclockohci_device_isoc_enternsphymatchupl_ioctlundefinedinstruction_bouncesys_getresgidprocinitatu_switch_radiomsdosfs_readdirdead_ebadfbrgphy_attachusbd_interface_countobio_cawddetachsoo_ioctlforkstatwi_card_identaue_miibus_writeregi80321_pci_conf_readicsphy_servicenull_setkeywi_send_packetin6mask64db_lbuf_startohci_rhsc_ableuipaq_activatesoftclockaudio_initbufsre_gmii_readregupdate_modifierdb_breakpoints_insertedpdc203xx_dma_startswdevtblf_decryptdisk_lockuhci_initsbwaithotplug_device_attachufs_reclaimrt2560_alloc_rx_ringsdwriteohci_device_intr_startxscale_minidata_clean_addrkernel_debugwsmouse_cafilt_logreadsysctl_rdquaduaudio_detachuvm_vnp_setsizevmcmdset_extendural_cadefault_product_descip6_use_deprecatedehci_softintruftdi_paramuserconf_hist_intextent_alloc_regionsys_mknodext2fs_mountfskill_vmcmdsuhci_device_ctrl_closeuhid_attachufs_mknodsbinsertoobknotelf_advlockpffinddomaineephy_resetfreeem_phy_get_infopci_device_foreachricohrtc_setcalusscanner_cleanupwi_ioctlugen_get_cdescieee80211_compute_durationswstrategyuserconf_pnumehci_allocxem_get_software_flagscsibusprintehci_root_intr_methodssys_getpgrpuplcom_detachuftdi_breakukbd_ioctlaudio_defaultiicprobewuscanneropensonewconndb_fetch_regufs_direnterrt2560_set_basicratesudav_csr_write1uhid_detachgeneric_armv4_bs_c_2pffindprotocom_obio_caudav_watchdogcluster_readtcp_saveti6wdctimeoutnchrdevieee80211_merge_print_intvlundefinedinstructionaue_cdre_pci_devicesaf2rtafidxpciide_canatsemi_pci_intrpciide_chansetupqsphy_catcr0_writeshmmaxpgs